Reviewed,
UniProtKB/Swiss-Prot Q9BRP4 (PAAF1_HUMAN)
Last modified
January 19, 2010.
Version 70.
History...
Clusters with 100%,
90%,
50% identity |
Documents (4) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Proteasomal ATPase-associated factor 1 Alternative name(s): WD repeat-containing protein 71 Protein G-16 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Complete proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 392 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Inhibits proteasome 26S assembly and proteolytic activity by impairing the association of the 19S regulatory complex with the 20S core. In case of HIV-1 infection, recruited by viral Tat to the HIV-1 promoter, where it promotes the recruitment of 19S regulatory complex through dissociation of the proteasome 26S. This presumably promotes provirus transcription efficiency. Ref.7 Ref.9 |
| Subunit structure | Interacts with PSMC1, PSMC2, PSMC3, PSMC4, PSMC5 and PSMC6. Interacts with HIV-1 Tat. Ref.7 Ref.9 |
| Tissue specificity | Ubiquitously expressed, with highest levels in kidney, brain and testis. Ref.7 |
| Sequence similarities | Belongs to the WD repeat PAAF1/RPN14 family. Contains 5 WD repeats. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Host-virus interaction |
| Cellular component | Proteasome |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Repeat WD repeat |
| PTM | Acetylation |
| Technical term | Complete proteome |
| Gene Ontology (GO) | |
| Biological process | interspecies interaction between organisms Inferred from electronic annotation. Source: UniProtKB-KW |
| Cellular component | proteasome complex Inferred from electronic annotation. Source: UniProtKB-KW |
| Molecular function | protein binding Inferred from physical interaction. Source: IntAct |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| ALDH16A1 | Q8IZ83 | 1 | EBI-1056358,EBI-1044483 | |
| DERA | Q9Y315 | 1 | EBI-1056358,EBI-1048152 | |
| FADS1 | O60427 | 1 | EBI-1056358,EBI-1055473 | |
| PSMC1 | P62191 | 1 | EBI-1056358,EBI-357598 | |
| PSMC2 | P35998 | 1 | EBI-1056358,EBI-359710 | |
| PSMC3 | P17980 | 1 | EBI-1056358,EBI-359720 | |
| PSMC4 | P43686 | 1 | EBI-1056358,EBI-743997 | |
| PSMC5 | P62195 | 2 | EBI-1056358,EBI-357745 | |
| PSMC6 | P62333 | 1 | EBI-1056358,EBI-357669 | |
| PSMD1 | Q99460 | 1 | EBI-1056358,EBI-357874 | |
| PSMD10 | O75832 | 1 | EBI-1056358,EBI-752185 | |
| PSMD11 | O00231 | 1 | EBI-1056358,EBI-357816 | |
| PSMD12 | O00232 | 1 | EBI-1056358,EBI-359733 | |
| PSMD14 | O00487 | 1 | EBI-1056358,EBI-722193 | |
| PSMD2 | Q13200 | 1 | EBI-1056358,EBI-357648 | |
| PSMD3 | O43242 | 1 | EBI-1056358,EBI-357622 | |
| PSMD6 | Q15008 | 1 | EBI-1056358,EBI-359701 | |
| PSMD7 | P51665 | 1 | EBI-1056358,EBI-357659 | |
| PSMD8 | P48556 | 1 | EBI-1056358,EBI-359304 |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9BRP4-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9BRP4-2) The sequence of this isoform differs from the canonical sequence as follows: 1-30: MAAPLRIQSDWAQALRKDEGEAWLSCHPPG → MLVPCFLYSLQNR |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Initiator methionine | 1 | 1 | Removed | ||||||
| Chain | 2 – 392 | 391 | Proteasomal ATPase-associated factor 1 | PRO_0000235685 | |||||
Regions | |||||||||
| Repeat | 90 – 129 | 40 | WD 1 | ||||||
| Repeat | 132 – 171 | 40 | WD 2 | ||||||
| Repeat | 174 – 215 | 42 | WD 3 | ||||||
| Repeat | 278 – 316 | 39 | WD 4 | ||||||
| Repeat | 360 – 392 | 33 | WD 5 | ||||||
Amino acid modifications | |||||||||
| Modified residue | 2 | 1 | N-acetylalanine Ref.11 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 30 | 30 | MAAPL…CHPPG → MLVPCFLYSLQNR in isoform 2. | VSP_018477 | |||||
| Natural variant | 53 | 1 | A → V: dbSNP rs17850051. Ref.6 | VAR_026415 | |||||
| Natural variant | 139 | 1 | C → S: dbSNP rs2067912. Ref.3 | VAR_032082 | |||||
| Natural variant | 209 | 1 | A → G: dbSNP rs3741138. Ref.6 Ref.1 | VAR_026416 | |||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cloning of a new human cDNA homology to Xenopus laevis gene 16 mRNA." Bi A.D., Yu L., Tu Q., Yang J., Dai F.Y., Cui W.C., Zheng L.H., Zhao S.Y. Submitted (AUG-1998) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), VARIANT GLY-209. |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Embryo. |
| [3] | Suzuki Y., Sugano S., Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S. Submitted (APR-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT SER-139. Tissue: Adipose tissue. |
| [4] | "Human chromosome 11 DNA sequence and analysis including novel gene identification." Taylor T.D., Noguchi H., Totoki Y., Toyoda A., Kuroki Y., Dewar K., Lloyd C., Itoh T., Takeda T., Kim D.-W., She X., Barlow K.F., Bloom T., Bruford E., Chang J.L., Cuomo C.A., Eichler E., FitzGerald M.G. Sakaki Y.Nature 440:497-500(2006) [PubMed: 16554811] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2), VARIANTS VAL-53 AND GLY-209. Tissue: Brain and Lung. |
| [7] | "Proteasomal ATPase-associated factor 1 negatively regulates proteasome activity by interacting with proteasomal ATPases." Park Y., Hwang Y.-P., Lee J.-S., Seo S.-H., Yoon S.K., Yoon J.-B. Mol. Cell. Biol. 25:3842-3853(2005) [PubMed: 15831487] [Abstract] Cited for: FUNCTION, TISSUE SPECIFICITY, INTERACTION WITH PSMC1; PSMC2; PSMC3; PSMC4; PSMC5 AND PSMC6, MASS SPECTROMETRY. |
| [8] | "Mass spectrometric characterization of the affinity-purified human 26S proteasome complex." Wang X., Chen C.-F., Baker P.R., Chen P.-L., Kaiser P., Huang L. Biochemistry 46:3553-3565(2007) [PubMed: 17323924] [Abstract] Cited for: IDENTIFICATION [LARGE SCALE ANALYSIS], MASS SPECTROMETRY. |
| [9] | "The proteasome regulates HIV-1 transcription by both proteolytic and nonproteolytic mechanisms." Lassot I., Latreille D., Rousset E., Sourisseau M., Linares L.K., Chable-Bessia C., Coux O., Benkirane M., Kiernan R.E. Mol. Cell 25:369-383(2007) [PubMed: 17289585] [Abstract] Cited for: FUNCTION, INTERACTION WITH HIV-1 TAT. |
| [10] | Colinge J., Superti-Furga G., Bennett K.L. Submitted (OCT-2008) to UniProtKB Cited for: IDENTIFICATION [LARGE SCALE ANALYSIS], MASS SPECTROMETRY. |
| [11] | "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach." Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S. Anal. Chem. 81:4493-4501(2009) [PubMed: 19413330] [Abstract] Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, MASS SPECTROMETRY. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF087895 mRNA. Translation: AAP97194.1. AK021910 mRNA. Translation: BAB13933.1. AK222501 mRNA. Translation: BAD96221.1. AP002770 Genomic DNA. No translation available. CH471076 Genomic DNA. Translation: EAW74917.1. BC006142 mRNA. Translation: AAH06142.2. BC021541 mRNA. Translation: AAH21541.1. BC028628 mRNA. Translation: AAH28628.1. |
| IPI | IPI00743862. IPI00867542. |
| RefSeq | NP_079431.1. |
| UniGene | Hs.525017 |
3D structure databases | |
| SMR | Q9BRP4. Positions 78-382. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q9BRP4. 19 interactions. |
| STRING | Q9BRP4. |
Proteomic databases | |
| PRIDE | Q9BRP4. |
Genome annotation databases | |
| Ensembl | ENST00000310571; ENSP00000311665; ENSG00000175575; Homo sapiens. [Genome view] |
| GeneID | 80227. |
| KEGG | hsa:80227. |
| UCSC | uc001ouk.1. human. uc001oul.1. human. |
Organism-specific databases | |
| CTD | 80227. |
| GeneCards | GC11P073267. |
| HGNC | HGNC:25687. PAAF1. |
| PharmGKB | PA142670604. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG13310. |
| HOVERGEN | Q9BRP4. |
| InParanoid | Q9BRP4. |
| OMA | HTKSITC. |
| OrthoDB | EOG9577SW. |
| PhylomeDB | Q9BRP4. |
Gene expression databases | |
| ArrayExpress | Q9BRP4. |
| Bgee | Q9BRP4. |
| CleanEx | HS_PAAF1. |
| Genevestigator | Q9BRP4. |
| GermOnline | ENSG00000175575. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR020472. G-protein_beta_WD-40_rep_reg. IPR015943. WD40/YVTN_repeat-like_dom. IPR001680. WD40_repeat. IPR011046. WD40_repeat-like_dom. IPR019782. WD40_repeat_2. IPR019775. WD40_repeat_CS. IPR017986. WD40_repeat_dom. IPR019781. WD40_repeat_sg. [Graphical view] |
| Gene3D | G3DSA:2.130.10.10. WD40/YVTN_repeat-like. 1 hit. |
| Pfam | PF00400. WD40. 3 hits. [Graphical view] |
| PRINTS | PR00320. GPROTEINBRPT. |
| SMART | SM00320. WD40. 6 hits. [Graphical view] |
| PROSITE | PS00678. WD_REPEATS_1. 1 hit. PS50082. WD_REPEATS_2. 3 hits. PS50294. WD_REPEATS_REGION. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 70653. |
Entry information
| Entry name | PAAF1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9BRP4 Secondary accession number(s): A6NDR5 Q9HAB6 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 11 Human chromosome 11: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| SIMILARITY comments Index of protein domains and families |

Clusters with


