Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Proteasomal ATPase-associated factor 1

Gene

PAAF1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Inhibits proteasome 26S assembly and proteolytic activity by impairing the association of the 19S regulatory complex with the 20S core. In case of HIV-1 infection, recruited by viral Tat to the HIV-1 promoter, where it promotes the recruitment of 19S regulatory complex through dissociation of the proteasome 26S. This presumably promotes provirus transcription efficiency. Protects SUPT6H from proteasomal degradation.3 Publications

GO - Biological processi

Keywordsi

Biological processHost-virus interaction

Enzyme and pathway databases

SignaLinkiQ9BRP4

Names & Taxonomyi

Protein namesi
Recommended name:
Proteasomal ATPase-associated factor 1
Alternative name(s):
Protein G-16
WD repeat-containing protein 71
Gene namesi
Name:PAAF1
Synonyms:WDR71
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 11

Organism-specific databases

EuPathDBiHostDB:ENSG00000175575.12
HGNCiHGNC:25687 PAAF1
neXtProtiNX_Q9BRP4

Subcellular locationi

Keywords - Cellular componenti

Proteasome

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000175575
PharmGKBiPA162398551

Polymorphism and mutation databases

BioMutaiPAAF1
DMDMi97217547

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedCombined sources
ChainiPRO_00002356852 – 392Proteasomal ATPase-associated factor 1Add BLAST391

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylalanineCombined sources1

Keywords - PTMi

Acetylation

Proteomic databases

EPDiQ9BRP4
MaxQBiQ9BRP4
PaxDbiQ9BRP4
PeptideAtlasiQ9BRP4
PRIDEiQ9BRP4

PTM databases

iPTMnetiQ9BRP4
PhosphoSitePlusiQ9BRP4

Expressioni

Tissue specificityi

Ubiquitously expressed, with highest levels in kidney, brain and testis.1 Publication

Gene expression databases

BgeeiENSG00000175575
CleanExiHS_PAAF1
ExpressionAtlasiQ9BRP4 baseline and differential
GenevisibleiQ9BRP4 HS

Organism-specific databases

HPAiHPA039952
HPA040020

Interactioni

Subunit structurei

Interacts with PSMC1, PSMC2, PSMC3, PSMC4, PSMC5 and PSMC6. Interacts with HIV-1 Tat. Interacts with SUPT6H.3 Publications

Binary interactionsi

Show more details

Protein-protein interaction databases

BioGridi123191, 41 interactors
IntActiQ9BRP4, 25 interactors
MINTiQ9BRP4
STRINGi9606.ENSP00000311665

Structurei

3D structure databases

ProteinModelPortaliQ9BRP4
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati82 – 121WD 1Add BLAST40
Repeati125 – 163WD 2Add BLAST39
Repeati167 – 205WD 3Add BLAST39
Repeati209 – 259WD 4Add BLAST51
Repeati270 – 308WD 5Add BLAST39
Repeati313 – 349WD 6Add BLAST37
Repeati353 – 389WD 7Add BLAST37

Sequence similaritiesi

Belongs to the WD repeat PAAF1/RPN14 family.Curated

Keywords - Domaini

Repeat, WD repeat

Phylogenomic databases

eggNOGiENOG410IQ12 Eukaryota
ENOG410XWCN LUCA
GeneTreeiENSGT00390000005948
HOGENOMiHOG000006858
HOVERGENiHBG056033
InParanoidiQ9BRP4
KOiK11887
OMAiVYDVNCC
PhylomeDBiQ9BRP4
TreeFamiTF313690

Family and domain databases

Gene3Di2.130.10.10, 2 hits
InterProiView protein in InterPro
IPR020472 G-protein_beta_WD-40_rep
IPR015943 WD40/YVTN_repeat-like_dom_sf
IPR001680 WD40_repeat
IPR019775 WD40_repeat_CS
IPR017986 WD40_repeat_dom
IPR036322 WD40_repeat_dom_sf
PfamiView protein in Pfam
PF00400 WD40, 3 hits
PRINTSiPR00320 GPROTEINBRPT
SMARTiView protein in SMART
SM00320 WD40, 6 hits
SUPFAMiSSF50978 SSF50978, 1 hit
PROSITEiView protein in PROSITE
PS00678 WD_REPEATS_1, 1 hit
PS50082 WD_REPEATS_2, 3 hits
PS50294 WD_REPEATS_REGION, 1 hit

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9BRP4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAAPLRIQSD WAQALRKDEG EAWLSCHPPG KPSLYGSLTC QGIGLDGIPE
60 70 80 90 100
VTASEGFTVN EINKKSIHIS CPKENASSKF LAPYTTFSRI HTKSITCLDI
110 120 130 140 150
SSRGGLGVSS STDGTMKIWQ ASNGELRRVL EGHVFDVNCC RFFPSGLVVL
160 170 180 190 200
SGGMDAQLKI WSAEDASCVV TFKGHKGGIL DTAIVDRGRN VVSASRDGTA
210 220 230 240 250
RLWDCGRSAC LGVLADCGSS INGVAVGAAD NSINLGSPEQ MPSEREVGTE
260 270 280 290 300
AKMLLLARED KKLQCLGLQS RQLVFLFIGS DAFNCCTFLS GFLLLAGTQD
310 320 330 340 350
GNIYQLDVRS PRAPVQVIHR SGAPVLSLLS VRDGFIASQG DGSCFIVQQD
360 370 380 390
LDYVTELTGA DCDPVYKVAT WEKQIYTCCR DGLVRRYQLS DL
Length:392
Mass (Da):42,190
Last modified:May 16, 2006 - v2
Checksum:i54ECB1DEC1841B49
GO
Isoform 2 (identifier: Q9BRP4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-30: MAAPLRIQSDWAQALRKDEGEAWLSCHPPG → MLVPCFLYSLQNR

Show »
Length:375
Mass (Da):40,439
Checksum:iC9AAF37840B5F43A
GO
Isoform 3 (identifier: Q9BRP4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-115: Missing.

Note: No experimental confirmation available.
Show »
Length:277
Mass (Da):29,982
Checksum:i00F78074BBD2F913
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_02641553A → V1 PublicationCorresponds to variant dbSNP:rs17850051Ensembl.1
Natural variantiVAR_032082139C → S1 PublicationCorresponds to variant dbSNP:rs2067912Ensembl.1
Natural variantiVAR_026416209A → G3 PublicationsCorresponds to variant dbSNP:rs3741138Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0446991 – 115Missing in isoform 3. 1 PublicationAdd BLAST115
Alternative sequenceiVSP_0184771 – 30MAAPL…CHPPG → MLVPCFLYSLQNR in isoform 2. 2 PublicationsAdd BLAST30

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF087895 mRNA Translation: AAP97194.1
AK021910 mRNA Translation: BAB13933.1
AK222501 mRNA Translation: BAD96221.1
AK298258 mRNA Translation: BAG60522.1
AK316394 mRNA Translation: BAH14765.1
AP002770 Genomic DNA No translation available.
CH471076 Genomic DNA Translation: EAW74917.1
BC006142 mRNA Translation: AAH06142.2
BC021541 mRNA Translation: AAH21541.1
BC028628 mRNA Translation: AAH28628.1
CCDSiCCDS58157.1 [Q9BRP4-2]
CCDS58158.1 [Q9BRP4-3]
CCDS8226.1 [Q9BRP4-1]
RefSeqiNP_001254732.1, NM_001267803.1 [Q9BRP4-2]
NP_001254733.1, NM_001267804.1 [Q9BRP4-2]
NP_001254734.1, NM_001267805.1 [Q9BRP4-2]
NP_001254735.1, NM_001267806.1 [Q9BRP4-3]
NP_079431.1, NM_025155.2 [Q9BRP4-1]
UniGeneiHs.525017

Genome annotation databases

EnsembliENST00000310571; ENSP00000311665; ENSG00000175575 [Q9BRP4-1]
ENST00000376384; ENSP00000365564; ENSG00000175575 [Q9BRP4-2]
ENST00000535604; ENSP00000438789; ENSG00000175575 [Q9BRP4-3]
ENST00000536003; ENSP00000438124; ENSG00000175575 [Q9BRP4-2]
ENST00000541951; ENSP00000441333; ENSG00000175575 [Q9BRP4-3]
ENST00000544552; ENSP00000441494; ENSG00000175575 [Q9BRP4-2]
GeneIDi80227
KEGGihsa:80227
UCSCiuc001ouk.3 human [Q9BRP4-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiPAAF1_HUMAN
AccessioniPrimary (citable) accession number: Q9BRP4
Secondary accession number(s): A6NDR5
, B4DPB0, B7ZAS9, Q4G165, Q53HS9, Q7Z500, Q8TBU6, Q9HAB6
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 16, 2006
Last sequence update: May 16, 2006
Last modified: March 28, 2018
This is version 143 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health