SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9BRP4

- PAAF1_HUMAN

UniProt

Q9BRP4 - PAAF1_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Proteasomal ATPase-associated factor 1
Gene
PAAF1, WDR71
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Inhibits proteasome 26S assembly and proteolytic activity by impairing the association of the 19S regulatory complex with the 20S core. In case of HIV-1 infection, recruited by viral Tat to the HIV-1 promoter, where it promotes the recruitment of 19S regulatory complex through dissociation of the proteasome 26S. This presumably promotes provirus transcription efficiency. Protects SUPT6H from proteasomal degradation.3 Publications

GO - Molecular functioni

  1. protein binding Source: IntAct

GO - Biological processi

  1. viral process Source: UniProtKB-KW
Complete GO annotation...

Keywords - Biological processi

Host-virus interaction

Enzyme and pathway databases

SignaLinkiQ9BRP4.

Names & Taxonomyi

Protein namesi
Recommended name:
Proteasomal ATPase-associated factor 1
Alternative name(s):
Protein G-16
WD repeat-containing protein 71
Gene namesi
Name:PAAF1
Synonyms:WDR71
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 11

Organism-specific databases

HGNCiHGNC:25687. PAAF1.

Subcellular locationi

GO - Cellular componenti

  1. proteasome complex Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Proteasome

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA162398551.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Initiator methioninei1 – 11Removed1 Publication
Chaini2 – 392391Proteasomal ATPase-associated factor 1
PRO_0000235685Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei2 – 21N-acetylalanine1 Publication

Keywords - PTMi

Acetylation

Proteomic databases

MaxQBiQ9BRP4.
PaxDbiQ9BRP4.
PRIDEiQ9BRP4.

PTM databases

PhosphoSiteiQ9BRP4.

Expressioni

Tissue specificityi

Ubiquitously expressed, with highest levels in kidney, brain and testis.1 Publication

Gene expression databases

ArrayExpressiQ9BRP4.
BgeeiQ9BRP4.
CleanExiHS_PAAF1.
GenevestigatoriQ9BRP4.

Organism-specific databases

HPAiHPA039952.

Interactioni

Subunit structurei

Interacts with PSMC1, PSMC2, PSMC3, PSMC4, PSMC5 and PSMC6. Interacts with HIV-1 Tat. Interacts with SUPT6H.3 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
PSMC5P621952EBI-1056358,EBI-357745

Protein-protein interaction databases

BioGridi123191. 37 interactions.
IntActiQ9BRP4. 6 interactions.
MINTiMINT-3044503.
STRINGi9606.ENSP00000311665.

Structurei

3D structure databases

ProteinModelPortaliQ9BRP4.
SMRiQ9BRP4. Positions 72-340.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati90 – 12940WD 1
Add
BLAST
Repeati132 – 17140WD 2
Add
BLAST
Repeati174 – 21542WD 3
Add
BLAST
Repeati278 – 31639WD 4
Add
BLAST
Repeati360 – 39233WD 5
Add
BLAST

Sequence similaritiesi

Contains 5 WD repeats.

Keywords - Domaini

Repeat, WD repeat

Phylogenomic databases

eggNOGiCOG2319.
HOVERGENiHBG056033.
InParanoidiQ9BRP4.
KOiK11887.
OMAiVYDVNCC.
OrthoDBiEOG7Z95MK.
PhylomeDBiQ9BRP4.
TreeFamiTF313690.

Family and domain databases

Gene3Di2.130.10.10. 1 hit.
InterProiIPR020472. G-protein_beta_WD-40_rep.
IPR015943. WD40/YVTN_repeat-like_dom.
IPR001680. WD40_repeat.
IPR019775. WD40_repeat_CS.
IPR017986. WD40_repeat_dom.
[Graphical view]
PfamiPF00400. WD40. 3 hits.
[Graphical view]
PRINTSiPR00320. GPROTEINBRPT.
SMARTiSM00320. WD40. 6 hits.
[Graphical view]
SUPFAMiSSF50978. SSF50978. 1 hit.
PROSITEiPS00678. WD_REPEATS_1. 1 hit.
PS50082. WD_REPEATS_2. 3 hits.
PS50294. WD_REPEATS_REGION. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9BRP4-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MAAPLRIQSD WAQALRKDEG EAWLSCHPPG KPSLYGSLTC QGIGLDGIPE    50
VTASEGFTVN EINKKSIHIS CPKENASSKF LAPYTTFSRI HTKSITCLDI 100
SSRGGLGVSS STDGTMKIWQ ASNGELRRVL EGHVFDVNCC RFFPSGLVVL 150
SGGMDAQLKI WSAEDASCVV TFKGHKGGIL DTAIVDRGRN VVSASRDGTA 200
RLWDCGRSAC LGVLADCGSS INGVAVGAAD NSINLGSPEQ MPSEREVGTE 250
AKMLLLARED KKLQCLGLQS RQLVFLFIGS DAFNCCTFLS GFLLLAGTQD 300
GNIYQLDVRS PRAPVQVIHR SGAPVLSLLS VRDGFIASQG DGSCFIVQQD 350
LDYVTELTGA DCDPVYKVAT WEKQIYTCCR DGLVRRYQLS DL 392
Length:392
Mass (Da):42,190
Last modified:May 16, 2006 - v2
Checksum:i54ECB1DEC1841B49
GO
Isoform 2 (identifier: Q9BRP4-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-30: MAAPLRIQSDWAQALRKDEGEAWLSCHPPG → MLVPCFLYSLQNR

Show »
Length:375
Mass (Da):40,439
Checksum:iC9AAF37840B5F43A
GO
Isoform 3 (identifier: Q9BRP4-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-115: Missing.

Note: No experimental confirmation available.

Show »
Length:277
Mass (Da):29,982
Checksum:i00F78074BBD2F913
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti53 – 531A → V.1 Publication
Corresponds to variant rs17850051 [ dbSNP | Ensembl ].
VAR_026415
Natural varianti139 – 1391C → S.1 Publication
Corresponds to variant rs2067912 [ dbSNP | Ensembl ].
VAR_032082
Natural varianti209 – 2091A → G.3 Publications
Corresponds to variant rs3741138 [ dbSNP | Ensembl ].
VAR_026416

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 115115Missing in isoform 3.
VSP_044699Add
BLAST
Alternative sequencei1 – 3030MAAPL…CHPPG → MLVPCFLYSLQNR in isoform 2.
VSP_018477Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF087895 mRNA. Translation: AAP97194.1.
AK021910 mRNA. Translation: BAB13933.1.
AK222501 mRNA. Translation: BAD96221.1.
AK298258 mRNA. Translation: BAG60522.1.
AK316394 mRNA. Translation: BAH14765.1.
AP002770 Genomic DNA. No translation available.
CH471076 Genomic DNA. Translation: EAW74917.1.
BC006142 mRNA. Translation: AAH06142.2.
BC021541 mRNA. Translation: AAH21541.1.
BC028628 mRNA. Translation: AAH28628.1.
CCDSiCCDS58157.1. [Q9BRP4-2]
CCDS58158.1. [Q9BRP4-3]
CCDS8226.1. [Q9BRP4-1]
RefSeqiNP_001254732.1. NM_001267803.1. [Q9BRP4-2]
NP_001254733.1. NM_001267804.1. [Q9BRP4-2]
NP_001254734.1. NM_001267805.1. [Q9BRP4-2]
NP_001254735.1. NM_001267806.1. [Q9BRP4-3]
NP_079431.1. NM_025155.2. [Q9BRP4-1]
UniGeneiHs.525017.

Genome annotation databases

EnsembliENST00000310571; ENSP00000311665; ENSG00000175575. [Q9BRP4-1]
ENST00000376384; ENSP00000365564; ENSG00000175575. [Q9BRP4-2]
ENST00000535604; ENSP00000438789; ENSG00000175575. [Q9BRP4-3]
ENST00000536003; ENSP00000438124; ENSG00000175575. [Q9BRP4-2]
ENST00000541951; ENSP00000441333; ENSG00000175575. [Q9BRP4-3]
ENST00000544552; ENSP00000441494; ENSG00000175575. [Q9BRP4-2]
GeneIDi80227.
KEGGihsa:80227.
UCSCiuc001ouk.2. human. [Q9BRP4-1]
uc001oul.2. human. [Q9BRP4-2]

Polymorphism databases

DMDMi97217547.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF087895 mRNA. Translation: AAP97194.1 .
AK021910 mRNA. Translation: BAB13933.1 .
AK222501 mRNA. Translation: BAD96221.1 .
AK298258 mRNA. Translation: BAG60522.1 .
AK316394 mRNA. Translation: BAH14765.1 .
AP002770 Genomic DNA. No translation available.
CH471076 Genomic DNA. Translation: EAW74917.1 .
BC006142 mRNA. Translation: AAH06142.2 .
BC021541 mRNA. Translation: AAH21541.1 .
BC028628 mRNA. Translation: AAH28628.1 .
CCDSi CCDS58157.1. [Q9BRP4-2 ]
CCDS58158.1. [Q9BRP4-3 ]
CCDS8226.1. [Q9BRP4-1 ]
RefSeqi NP_001254732.1. NM_001267803.1. [Q9BRP4-2 ]
NP_001254733.1. NM_001267804.1. [Q9BRP4-2 ]
NP_001254734.1. NM_001267805.1. [Q9BRP4-2 ]
NP_001254735.1. NM_001267806.1. [Q9BRP4-3 ]
NP_079431.1. NM_025155.2. [Q9BRP4-1 ]
UniGenei Hs.525017.

3D structure databases

ProteinModelPortali Q9BRP4.
SMRi Q9BRP4. Positions 72-340.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 123191. 37 interactions.
IntActi Q9BRP4. 6 interactions.
MINTi MINT-3044503.
STRINGi 9606.ENSP00000311665.

PTM databases

PhosphoSitei Q9BRP4.

Polymorphism databases

DMDMi 97217547.

Proteomic databases

MaxQBi Q9BRP4.
PaxDbi Q9BRP4.
PRIDEi Q9BRP4.

Protocols and materials databases

DNASUi 80227.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000310571 ; ENSP00000311665 ; ENSG00000175575 . [Q9BRP4-1 ]
ENST00000376384 ; ENSP00000365564 ; ENSG00000175575 . [Q9BRP4-2 ]
ENST00000535604 ; ENSP00000438789 ; ENSG00000175575 . [Q9BRP4-3 ]
ENST00000536003 ; ENSP00000438124 ; ENSG00000175575 . [Q9BRP4-2 ]
ENST00000541951 ; ENSP00000441333 ; ENSG00000175575 . [Q9BRP4-3 ]
ENST00000544552 ; ENSP00000441494 ; ENSG00000175575 . [Q9BRP4-2 ]
GeneIDi 80227.
KEGGi hsa:80227.
UCSCi uc001ouk.2. human. [Q9BRP4-1 ]
uc001oul.2. human. [Q9BRP4-2 ]

Organism-specific databases

CTDi 80227.
GeneCardsi GC11P073588.
H-InvDB HIX0009924.
HGNCi HGNC:25687. PAAF1.
HPAi HPA039952.
neXtProti NX_Q9BRP4.
PharmGKBi PA162398551.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG2319.
HOVERGENi HBG056033.
InParanoidi Q9BRP4.
KOi K11887.
OMAi VYDVNCC.
OrthoDBi EOG7Z95MK.
PhylomeDBi Q9BRP4.
TreeFami TF313690.

Enzyme and pathway databases

SignaLinki Q9BRP4.

Miscellaneous databases

GeneWikii PAAF1.
GenomeRNAii 80227.
NextBioi 70653.
PROi Q9BRP4.

Gene expression databases

ArrayExpressi Q9BRP4.
Bgeei Q9BRP4.
CleanExi HS_PAAF1.
Genevestigatori Q9BRP4.

Family and domain databases

Gene3Di 2.130.10.10. 1 hit.
InterProi IPR020472. G-protein_beta_WD-40_rep.
IPR015943. WD40/YVTN_repeat-like_dom.
IPR001680. WD40_repeat.
IPR019775. WD40_repeat_CS.
IPR017986. WD40_repeat_dom.
[Graphical view ]
Pfami PF00400. WD40. 3 hits.
[Graphical view ]
PRINTSi PR00320. GPROTEINBRPT.
SMARTi SM00320. WD40. 6 hits.
[Graphical view ]
SUPFAMi SSF50978. SSF50978. 1 hit.
PROSITEi PS00678. WD_REPEATS_1. 1 hit.
PS50082. WD_REPEATS_2. 3 hits.
PS50294. WD_REPEATS_REGION. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Cloning of a new human cDNA homology to Xenopus laevis gene 16 mRNA."
    Bi A.D., Yu L., Tu Q., Yang J., Dai F.Y., Cui W.C., Zheng L.H., Zhao S.Y.
    Submitted (AUG-1998) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), VARIANT GLY-209.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3), VARIANT GLY-209.
    Tissue: Embryo, Kidney and Testis.
  3. Suzuki Y., Sugano S., Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S.
    Submitted (APR-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT SER-139.
    Tissue: Adipose tissue.
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2), VARIANTS VAL-53 AND GLY-209.
    Tissue: Brain and Lung.
  7. "Proteasomal ATPase-associated factor 1 negatively regulates proteasome activity by interacting with proteasomal ATPases."
    Park Y., Hwang Y.-P., Lee J.-S., Seo S.-H., Yoon S.K., Yoon J.-B.
    Mol. Cell. Biol. 25:3842-3853(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, TISSUE SPECIFICITY, INTERACTION WITH PSMC1; PSMC2; PSMC3; PSMC4; PSMC5 AND PSMC6, IDENTIFICATION BY MASS SPECTROMETRY.
  8. "Mass spectrometric characterization of the affinity-purified human 26S proteasome complex."
    Wang X., Chen C.-F., Baker P.R., Chen P.-L., Kaiser P., Huang L.
    Biochemistry 46:3553-3565(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Embryonic kidney.
  9. "The proteasome regulates HIV-1 transcription by both proteolytic and nonproteolytic mechanisms."
    Lassot I., Latreille D., Rousset E., Sourisseau M., Linares L.K., Chable-Bessia C., Coux O., Benkirane M., Kiernan R.E.
    Mol. Cell 25:369-383(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, INTERACTION WITH HIV-1 TAT.
  10. "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
    Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
    Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS], CLEAVAGE OF INITIATOR METHIONINE [LARGE SCALE ANALYSIS].
  11. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  12. "Spt6 levels are modulated by PAAF1 and proteasome to regulate the HIV-1 LTR."
    Nakamura M., Basavarajaiah P., Rousset E., Beraud C., Latreille D., Henaoui I.S., Lassot I., Mari B., Kiernan R.
    Retrovirology 9:13-13(2012) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, INTERACTION WITH SUPT6H.

Entry informationi

Entry nameiPAAF1_HUMAN
AccessioniPrimary (citable) accession number: Q9BRP4
Secondary accession number(s): A6NDR5
, B4DPB0, B7ZAS9, Q4G165, Q53HS9, Q7Z500, Q8TBU6, Q9HAB6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 16, 2006
Last sequence update: May 16, 2006
Last modified: July 9, 2014
This is version 113 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi