Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9BRP4

- PAAF1_HUMAN

UniProt

Q9BRP4 - PAAF1_HUMAN

Protein

Proteasomal ATPase-associated factor 1

Gene

PAAF1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 114 (01 Oct 2014)
      Sequence version 2 (16 May 2006)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Inhibits proteasome 26S assembly and proteolytic activity by impairing the association of the 19S regulatory complex with the 20S core. In case of HIV-1 infection, recruited by viral Tat to the HIV-1 promoter, where it promotes the recruitment of 19S regulatory complex through dissociation of the proteasome 26S. This presumably promotes provirus transcription efficiency. Protects SUPT6H from proteasomal degradation.3 Publications

    GO - Molecular functioni

    1. protein binding Source: IntAct

    GO - Biological processi

    1. viral process Source: UniProtKB-KW

    Keywords - Biological processi

    Host-virus interaction

    Enzyme and pathway databases

    SignaLinkiQ9BRP4.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Proteasomal ATPase-associated factor 1
    Alternative name(s):
    Protein G-16
    WD repeat-containing protein 71
    Gene namesi
    Name:PAAF1
    Synonyms:WDR71
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 11

    Organism-specific databases

    HGNCiHGNC:25687. PAAF1.

    Subcellular locationi

    GO - Cellular componenti

    1. proteasome complex Source: UniProtKB-KW

    Keywords - Cellular componenti

    Proteasome

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA162398551.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Initiator methioninei1 – 11Removed1 Publication
    Chaini2 – 392391Proteasomal ATPase-associated factor 1PRO_0000235685Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei2 – 21N-acetylalanine1 Publication

    Keywords - PTMi

    Acetylation

    Proteomic databases

    MaxQBiQ9BRP4.
    PaxDbiQ9BRP4.
    PRIDEiQ9BRP4.

    PTM databases

    PhosphoSiteiQ9BRP4.

    Expressioni

    Tissue specificityi

    Ubiquitously expressed, with highest levels in kidney, brain and testis.1 Publication

    Gene expression databases

    ArrayExpressiQ9BRP4.
    BgeeiQ9BRP4.
    CleanExiHS_PAAF1.
    GenevestigatoriQ9BRP4.

    Organism-specific databases

    HPAiHPA039952.

    Interactioni

    Subunit structurei

    Interacts with PSMC1, PSMC2, PSMC3, PSMC4, PSMC5 and PSMC6. Interacts with HIV-1 Tat. Interacts with SUPT6H.3 Publications

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    PSMC5P621952EBI-1056358,EBI-357745

    Protein-protein interaction databases

    BioGridi123191. 38 interactions.
    IntActiQ9BRP4. 6 interactions.
    MINTiMINT-3044503.
    STRINGi9606.ENSP00000311665.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9BRP4.
    SMRiQ9BRP4. Positions 72-340.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Repeati90 – 12940WD 1Add
    BLAST
    Repeati132 – 17140WD 2Add
    BLAST
    Repeati174 – 21542WD 3Add
    BLAST
    Repeati278 – 31639WD 4Add
    BLAST
    Repeati360 – 39233WD 5Add
    BLAST

    Sequence similaritiesi

    Belongs to the WD repeat PAAF1/RPN14 family.Curated
    Contains 5 WD repeats.PROSITE-ProRule annotation

    Keywords - Domaini

    Repeat, WD repeat

    Phylogenomic databases

    eggNOGiCOG2319.
    HOVERGENiHBG056033.
    InParanoidiQ9BRP4.
    KOiK11887.
    OMAiVYDVNCC.
    OrthoDBiEOG7Z95MK.
    PhylomeDBiQ9BRP4.
    TreeFamiTF313690.

    Family and domain databases

    Gene3Di2.130.10.10. 1 hit.
    InterProiIPR020472. G-protein_beta_WD-40_rep.
    IPR015943. WD40/YVTN_repeat-like_dom.
    IPR001680. WD40_repeat.
    IPR019775. WD40_repeat_CS.
    IPR017986. WD40_repeat_dom.
    [Graphical view]
    PfamiPF00400. WD40. 3 hits.
    [Graphical view]
    PRINTSiPR00320. GPROTEINBRPT.
    SMARTiSM00320. WD40. 6 hits.
    [Graphical view]
    SUPFAMiSSF50978. SSF50978. 1 hit.
    PROSITEiPS00678. WD_REPEATS_1. 1 hit.
    PS50082. WD_REPEATS_2. 3 hits.
    PS50294. WD_REPEATS_REGION. 1 hit.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9BRP4-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MAAPLRIQSD WAQALRKDEG EAWLSCHPPG KPSLYGSLTC QGIGLDGIPE    50
    VTASEGFTVN EINKKSIHIS CPKENASSKF LAPYTTFSRI HTKSITCLDI 100
    SSRGGLGVSS STDGTMKIWQ ASNGELRRVL EGHVFDVNCC RFFPSGLVVL 150
    SGGMDAQLKI WSAEDASCVV TFKGHKGGIL DTAIVDRGRN VVSASRDGTA 200
    RLWDCGRSAC LGVLADCGSS INGVAVGAAD NSINLGSPEQ MPSEREVGTE 250
    AKMLLLARED KKLQCLGLQS RQLVFLFIGS DAFNCCTFLS GFLLLAGTQD 300
    GNIYQLDVRS PRAPVQVIHR SGAPVLSLLS VRDGFIASQG DGSCFIVQQD 350
    LDYVTELTGA DCDPVYKVAT WEKQIYTCCR DGLVRRYQLS DL 392
    Length:392
    Mass (Da):42,190
    Last modified:May 16, 2006 - v2
    Checksum:i54ECB1DEC1841B49
    GO
    Isoform 2 (identifier: Q9BRP4-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-30: MAAPLRIQSDWAQALRKDEGEAWLSCHPPG → MLVPCFLYSLQNR

    Show »
    Length:375
    Mass (Da):40,439
    Checksum:iC9AAF37840B5F43A
    GO
    Isoform 3 (identifier: Q9BRP4-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-115: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:277
    Mass (Da):29,982
    Checksum:i00F78074BBD2F913
    GO

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti53 – 531A → V.1 Publication
    Corresponds to variant rs17850051 [ dbSNP | Ensembl ].
    VAR_026415
    Natural varianti139 – 1391C → S.1 Publication
    Corresponds to variant rs2067912 [ dbSNP | Ensembl ].
    VAR_032082
    Natural varianti209 – 2091A → G.3 Publications
    Corresponds to variant rs3741138 [ dbSNP | Ensembl ].
    VAR_026416

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 115115Missing in isoform 3. 1 PublicationVSP_044699Add
    BLAST
    Alternative sequencei1 – 3030MAAPL…CHPPG → MLVPCFLYSLQNR in isoform 2. 2 PublicationsVSP_018477Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF087895 mRNA. Translation: AAP97194.1.
    AK021910 mRNA. Translation: BAB13933.1.
    AK222501 mRNA. Translation: BAD96221.1.
    AK298258 mRNA. Translation: BAG60522.1.
    AK316394 mRNA. Translation: BAH14765.1.
    AP002770 Genomic DNA. No translation available.
    CH471076 Genomic DNA. Translation: EAW74917.1.
    BC006142 mRNA. Translation: AAH06142.2.
    BC021541 mRNA. Translation: AAH21541.1.
    BC028628 mRNA. Translation: AAH28628.1.
    CCDSiCCDS58157.1. [Q9BRP4-2]
    CCDS58158.1. [Q9BRP4-3]
    CCDS8226.1. [Q9BRP4-1]
    RefSeqiNP_001254732.1. NM_001267803.1. [Q9BRP4-2]
    NP_001254733.1. NM_001267804.1. [Q9BRP4-2]
    NP_001254734.1. NM_001267805.1. [Q9BRP4-2]
    NP_001254735.1. NM_001267806.1. [Q9BRP4-3]
    NP_079431.1. NM_025155.2. [Q9BRP4-1]
    UniGeneiHs.525017.

    Genome annotation databases

    EnsembliENST00000310571; ENSP00000311665; ENSG00000175575. [Q9BRP4-1]
    ENST00000376384; ENSP00000365564; ENSG00000175575. [Q9BRP4-2]
    ENST00000535604; ENSP00000438789; ENSG00000175575. [Q9BRP4-3]
    ENST00000536003; ENSP00000438124; ENSG00000175575. [Q9BRP4-2]
    ENST00000541951; ENSP00000441333; ENSG00000175575. [Q9BRP4-3]
    ENST00000544552; ENSP00000441494; ENSG00000175575. [Q9BRP4-2]
    GeneIDi80227.
    KEGGihsa:80227.
    UCSCiuc001ouk.2. human. [Q9BRP4-1]
    uc001oul.2. human. [Q9BRP4-2]

    Polymorphism databases

    DMDMi97217547.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF087895 mRNA. Translation: AAP97194.1 .
    AK021910 mRNA. Translation: BAB13933.1 .
    AK222501 mRNA. Translation: BAD96221.1 .
    AK298258 mRNA. Translation: BAG60522.1 .
    AK316394 mRNA. Translation: BAH14765.1 .
    AP002770 Genomic DNA. No translation available.
    CH471076 Genomic DNA. Translation: EAW74917.1 .
    BC006142 mRNA. Translation: AAH06142.2 .
    BC021541 mRNA. Translation: AAH21541.1 .
    BC028628 mRNA. Translation: AAH28628.1 .
    CCDSi CCDS58157.1. [Q9BRP4-2 ]
    CCDS58158.1. [Q9BRP4-3 ]
    CCDS8226.1. [Q9BRP4-1 ]
    RefSeqi NP_001254732.1. NM_001267803.1. [Q9BRP4-2 ]
    NP_001254733.1. NM_001267804.1. [Q9BRP4-2 ]
    NP_001254734.1. NM_001267805.1. [Q9BRP4-2 ]
    NP_001254735.1. NM_001267806.1. [Q9BRP4-3 ]
    NP_079431.1. NM_025155.2. [Q9BRP4-1 ]
    UniGenei Hs.525017.

    3D structure databases

    ProteinModelPortali Q9BRP4.
    SMRi Q9BRP4. Positions 72-340.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 123191. 38 interactions.
    IntActi Q9BRP4. 6 interactions.
    MINTi MINT-3044503.
    STRINGi 9606.ENSP00000311665.

    PTM databases

    PhosphoSitei Q9BRP4.

    Polymorphism databases

    DMDMi 97217547.

    Proteomic databases

    MaxQBi Q9BRP4.
    PaxDbi Q9BRP4.
    PRIDEi Q9BRP4.

    Protocols and materials databases

    DNASUi 80227.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000310571 ; ENSP00000311665 ; ENSG00000175575 . [Q9BRP4-1 ]
    ENST00000376384 ; ENSP00000365564 ; ENSG00000175575 . [Q9BRP4-2 ]
    ENST00000535604 ; ENSP00000438789 ; ENSG00000175575 . [Q9BRP4-3 ]
    ENST00000536003 ; ENSP00000438124 ; ENSG00000175575 . [Q9BRP4-2 ]
    ENST00000541951 ; ENSP00000441333 ; ENSG00000175575 . [Q9BRP4-3 ]
    ENST00000544552 ; ENSP00000441494 ; ENSG00000175575 . [Q9BRP4-2 ]
    GeneIDi 80227.
    KEGGi hsa:80227.
    UCSCi uc001ouk.2. human. [Q9BRP4-1 ]
    uc001oul.2. human. [Q9BRP4-2 ]

    Organism-specific databases

    CTDi 80227.
    GeneCardsi GC11P073588.
    H-InvDB HIX0009924.
    HGNCi HGNC:25687. PAAF1.
    HPAi HPA039952.
    neXtProti NX_Q9BRP4.
    PharmGKBi PA162398551.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG2319.
    HOVERGENi HBG056033.
    InParanoidi Q9BRP4.
    KOi K11887.
    OMAi VYDVNCC.
    OrthoDBi EOG7Z95MK.
    PhylomeDBi Q9BRP4.
    TreeFami TF313690.

    Enzyme and pathway databases

    SignaLinki Q9BRP4.

    Miscellaneous databases

    GeneWikii PAAF1.
    GenomeRNAii 80227.
    NextBioi 70653.
    PROi Q9BRP4.

    Gene expression databases

    ArrayExpressi Q9BRP4.
    Bgeei Q9BRP4.
    CleanExi HS_PAAF1.
    Genevestigatori Q9BRP4.

    Family and domain databases

    Gene3Di 2.130.10.10. 1 hit.
    InterProi IPR020472. G-protein_beta_WD-40_rep.
    IPR015943. WD40/YVTN_repeat-like_dom.
    IPR001680. WD40_repeat.
    IPR019775. WD40_repeat_CS.
    IPR017986. WD40_repeat_dom.
    [Graphical view ]
    Pfami PF00400. WD40. 3 hits.
    [Graphical view ]
    PRINTSi PR00320. GPROTEINBRPT.
    SMARTi SM00320. WD40. 6 hits.
    [Graphical view ]
    SUPFAMi SSF50978. SSF50978. 1 hit.
    PROSITEi PS00678. WD_REPEATS_1. 1 hit.
    PS50082. WD_REPEATS_2. 3 hits.
    PS50294. WD_REPEATS_REGION. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Cloning of a new human cDNA homology to Xenopus laevis gene 16 mRNA."
      Bi A.D., Yu L., Tu Q., Yang J., Dai F.Y., Cui W.C., Zheng L.H., Zhao S.Y.
      Submitted (AUG-1998) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), VARIANT GLY-209.
    2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3), VARIANT GLY-209.
      Tissue: Embryo, Kidney and Testis.
    3. Suzuki Y., Sugano S., Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S.
      Submitted (APR-2005) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT SER-139.
      Tissue: Adipose tissue.
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2), VARIANTS VAL-53 AND GLY-209.
      Tissue: Brain and Lung.
    7. "Proteasomal ATPase-associated factor 1 negatively regulates proteasome activity by interacting with proteasomal ATPases."
      Park Y., Hwang Y.-P., Lee J.-S., Seo S.-H., Yoon S.K., Yoon J.-B.
      Mol. Cell. Biol. 25:3842-3853(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, TISSUE SPECIFICITY, INTERACTION WITH PSMC1; PSMC2; PSMC3; PSMC4; PSMC5 AND PSMC6, IDENTIFICATION BY MASS SPECTROMETRY.
    8. "Mass spectrometric characterization of the affinity-purified human 26S proteasome complex."
      Wang X., Chen C.-F., Baker P.R., Chen P.-L., Kaiser P., Huang L.
      Biochemistry 46:3553-3565(2007) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Embryonic kidney.
    9. "The proteasome regulates HIV-1 transcription by both proteolytic and nonproteolytic mechanisms."
      Lassot I., Latreille D., Rousset E., Sourisseau M., Linares L.K., Chable-Bessia C., Coux O., Benkirane M., Kiernan R.E.
      Mol. Cell 25:369-383(2007) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, INTERACTION WITH HIV-1 TAT.
    10. "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
      Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
      Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS], CLEAVAGE OF INITIATOR METHIONINE [LARGE SCALE ANALYSIS].
    11. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    12. "Spt6 levels are modulated by PAAF1 and proteasome to regulate the HIV-1 LTR."
      Nakamura M., Basavarajaiah P., Rousset E., Beraud C., Latreille D., Henaoui I.S., Lassot I., Mari B., Kiernan R.
      Retrovirology 9:13-13(2012) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, INTERACTION WITH SUPT6H.

    Entry informationi

    Entry nameiPAAF1_HUMAN
    AccessioniPrimary (citable) accession number: Q9BRP4
    Secondary accession number(s): A6NDR5
    , B4DPB0, B7ZAS9, Q4G165, Q53HS9, Q7Z500, Q8TBU6, Q9HAB6
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: May 16, 2006
    Last sequence update: May 16, 2006
    Last modified: October 1, 2014
    This is version 114 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 11
      Human chromosome 11: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3