Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9BRG2

- SH23A_HUMAN

UniProt

Q9BRG2 - SH23A_HUMAN

Protein

SH2 domain-containing protein 3A

Gene

SH2D3A

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 104 (01 Oct 2014)
      Sequence version 1 (01 Jun 2001)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    May play a role in JNK activation.

    GO - Molecular functioni

    1. guanyl-nucleotide exchange factor activity Source: InterPro
    2. SH3/SH2 adaptor activity Source: ProtInc

    GO - Biological processi

    1. JNK cascade Source: ProtInc
    2. positive regulation of signal transduction Source: GOC
    3. small GTPase mediated signal transduction Source: InterPro

    Enzyme and pathway databases

    SignaLinkiQ9BRG2.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    SH2 domain-containing protein 3A
    Alternative name(s):
    Novel SH2-containing protein 1
    Gene namesi
    Name:SH2D3A
    Synonyms:NSP1
    ORF Names:UNQ175/PRO201
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 19

    Organism-specific databases

    HGNCiHGNC:16885. SH2D3A.

    Subcellular locationi

    GO - Cellular componenti

    1. intracellular Source: InterPro

    Pathology & Biotechi

    Mutagenesis

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Mutagenesisi95 – 951Y → F: Loss of phosphorylation. 1 Publication
    Mutagenesisi231 – 2311Y → F: Weak phosphorylation. 1 Publication

    Organism-specific databases

    PharmGKBiPA38192.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 576576SH2 domain-containing protein 3APRO_0000233132Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei123 – 1231Phosphoserine3 Publications
    Modified residuei125 – 1251Phosphoserine3 Publications
    Modified residuei147 – 1471Phosphoserine2 Publications
    Modified residuei180 – 1801Phosphoserine3 Publications

    Post-translational modificationi

    Phosphorylated on tyrosine.4 Publications

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    MaxQBiQ9BRG2.
    PaxDbiQ9BRG2.
    PRIDEiQ9BRG2.

    PTM databases

    PhosphoSiteiQ9BRG2.

    Expressioni

    Tissue specificityi

    Weakly expressed in placenta, fetal kidney, fetal lung, adult pancreas, adult kidney and adult lung.1 Publication

    Gene expression databases

    ArrayExpressiQ9BRG2.
    BgeeiQ9BRG2.
    CleanExiHS_SH2D3A.
    GenevestigatoriQ9BRG2.

    Organism-specific databases

    HPAiHPA035722.

    Interactioni

    Subunit structurei

    Interacts with BCAR1.1 Publication

    Protein-protein interaction databases

    BioGridi115356. 7 interactions.
    IntActiQ9BRG2. 4 interactions.
    MINTiMINT-1498531.
    STRINGi9606.ENSP00000245908.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9BRG2.
    SMRiQ9BRG2. Positions 15-97.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini15 – 114100SH2PROSITE-ProRule annotationAdd
    BLAST

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi259 – 2679Poly-Glu

    Sequence similaritiesi

    Contains 1 SH2 domain.PROSITE-ProRule annotation

    Keywords - Domaini

    SH2 domain

    Phylogenomic databases

    eggNOGiNOG148579.
    HOGENOMiHOG000231595.
    HOVERGENiHBG053174.
    InParanoidiQ9BRG2.
    OMAiGCSGPLE.
    OrthoDBiEOG7J9VPN.
    PhylomeDBiQ9BRG2.
    TreeFamiTF323756.

    Family and domain databases

    Gene3Di1.10.840.10. 1 hit.
    3.30.505.10. 1 hit.
    InterProiIPR023578. Ras_GEF_dom.
    IPR001895. RasGRF_CDC25.
    IPR000980. SH2.
    [Graphical view]
    PfamiPF00617. RasGEF. 1 hit.
    PF00017. SH2. 1 hit.
    [Graphical view]
    PRINTSiPR00401. SH2DOMAIN.
    SMARTiSM00252. SH2. 1 hit.
    [Graphical view]
    SUPFAMiSSF48366. SSF48366. 1 hit.
    SSF55550. SSF55550. 1 hit.
    PROSITEiPS50001. SH2. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9BRG2-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MQVPQDGEDL AGQPWYHGLL SRQKAEALLQ QNGDFLVRAS GSRGGNPVIS    50
    CRWRGSALHF EVFRVALRPR PGRPTALFQL EDEQFPSIPA LVHSYMTGRR 100
    PLSQATGAVV SRPVTWQGPL RRSFSEDTLM DGPARIEPLR ARKWSNSQPA 150
    DLAHMGRSRE DPAGMEASTM PISALPRTSS DPVLLKAPAP LGTVADSLRA 200
    SDGQLQAKAP TKPPRTPSFE LPDASERPPT YCELVPRVPS VQGTSPSQSC 250
    PEPEAPWWEA EEDEEEENRC FTRPQAEISF CPHDAPSCLL GPQNRPLEPQ 300
    VLHTLRGLFL EHHPGSTALH LLLVDCQATG LLGVTRDQRG NMGVSSGLEL 350
    LTLPHGHHLR LELLERHQTL ALAGALAVLG CSGPLEERAA ALRGLVELAL 400
    ALRPGAAGDL PGLAAVMGAL LMPQVSRLEH TWRQLRRSHT EAALAFEQEL 450
    KPLMRALDEG AGPCDPGEVA LPHVAPMVRL LEGEEVAGPL DESCERLLRT 500
    LHGARHMVRD APKFRKVAAQ RLRGFRPNPE LREALTTGFV RRLLWGSRGA 550
    GAPRAERFEK FQRVLGVLSQ RLEPDR 576
    Length:576
    Mass (Da):63,093
    Last modified:June 1, 2001 - v1
    Checksum:i2909F7632B61F18D
    GO
    Isoform 2 (identifier: Q9BRG2-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-17: MQVPQDGEDLAGQPWYH → MEKTLLANLGTTASCPA
         18-139: Missing.
         423-423: P → PQVRGEQGLEEAGVRVTGKTGEEACSDLFS

    Note: No experimental confirmation available.

    Show »
    Length:483
    Mass (Da):52,402
    Checksum:i6760CBC56523568B
    GO

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti32 – 321N → D.2 Publications
    Corresponds to variant rs7258236 [ dbSNP | Ensembl ].
    VAR_026054
    Natural varianti223 – 2231D → G.
    Corresponds to variant rs12608960 [ dbSNP | Ensembl ].
    VAR_051349
    Natural varianti265 – 2651E → G in a breast cancer sample; somatic mutation. 1 Publication
    VAR_035989

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 1717MQVPQ…QPWYH → MEKTLLANLGTTASCPA in isoform 2. 1 PublicationVSP_056268Add
    BLAST
    Alternative sequencei18 – 139122Missing in isoform 2. 1 PublicationVSP_056269Add
    BLAST
    Alternative sequencei423 – 4231P → PQVRGEQGLEEAGVRVTGKT GEEACSDLFS in isoform 2. 1 PublicationVSP_056270

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF124249 mRNA. Translation: AAD28244.1.
    AY358406 mRNA. Translation: AAQ88772.1.
    AK292781 mRNA. Translation: BAF85470.1.
    AK299406 mRNA. Translation: BAG61389.1.
    AC008760 Genomic DNA. No translation available.
    AC020954 Genomic DNA. No translation available.
    CH471139 Genomic DNA. Translation: EAW69059.1.
    BC006281 mRNA. Translation: AAH06281.1.
    CCDSiCCDS12173.1.
    RefSeqiNP_005481.2. NM_005490.2.
    XP_005259529.1. XM_005259472.2.
    UniGeneiHs.439645.

    Genome annotation databases

    EnsembliENST00000245908; ENSP00000245908; ENSG00000125731.
    ENST00000437152; ENSP00000393303; ENSG00000125731.
    GeneIDi10045.
    KEGGihsa:10045.
    UCSCiuc002mft.3. human.

    Polymorphism databases

    DMDMi74732879.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF124249 mRNA. Translation: AAD28244.1 .
    AY358406 mRNA. Translation: AAQ88772.1 .
    AK292781 mRNA. Translation: BAF85470.1 .
    AK299406 mRNA. Translation: BAG61389.1 .
    AC008760 Genomic DNA. No translation available.
    AC020954 Genomic DNA. No translation available.
    CH471139 Genomic DNA. Translation: EAW69059.1 .
    BC006281 mRNA. Translation: AAH06281.1 .
    CCDSi CCDS12173.1.
    RefSeqi NP_005481.2. NM_005490.2.
    XP_005259529.1. XM_005259472.2.
    UniGenei Hs.439645.

    3D structure databases

    ProteinModelPortali Q9BRG2.
    SMRi Q9BRG2. Positions 15-97.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 115356. 7 interactions.
    IntActi Q9BRG2. 4 interactions.
    MINTi MINT-1498531.
    STRINGi 9606.ENSP00000245908.

    PTM databases

    PhosphoSitei Q9BRG2.

    Polymorphism databases

    DMDMi 74732879.

    Proteomic databases

    MaxQBi Q9BRG2.
    PaxDbi Q9BRG2.
    PRIDEi Q9BRG2.

    Protocols and materials databases

    DNASUi 10045.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000245908 ; ENSP00000245908 ; ENSG00000125731 .
    ENST00000437152 ; ENSP00000393303 ; ENSG00000125731 .
    GeneIDi 10045.
    KEGGi hsa:10045.
    UCSCi uc002mft.3. human.

    Organism-specific databases

    CTDi 10045.
    GeneCardsi GC19M006752.
    HGNCi HGNC:16885. SH2D3A.
    HPAi HPA035722.
    MIMi 604721. gene.
    neXtProti NX_Q9BRG2.
    PharmGKBi PA38192.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG148579.
    HOGENOMi HOG000231595.
    HOVERGENi HBG053174.
    InParanoidi Q9BRG2.
    OMAi GCSGPLE.
    OrthoDBi EOG7J9VPN.
    PhylomeDBi Q9BRG2.
    TreeFami TF323756.

    Enzyme and pathway databases

    SignaLinki Q9BRG2.

    Miscellaneous databases

    GeneWikii SH2D3A.
    GenomeRNAii 10045.
    NextBioi 37943.
    PROi Q9BRG2.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q9BRG2.
    Bgeei Q9BRG2.
    CleanExi HS_SH2D3A.
    Genevestigatori Q9BRG2.

    Family and domain databases

    Gene3Di 1.10.840.10. 1 hit.
    3.30.505.10. 1 hit.
    InterProi IPR023578. Ras_GEF_dom.
    IPR001895. RasGRF_CDC25.
    IPR000980. SH2.
    [Graphical view ]
    Pfami PF00617. RasGEF. 1 hit.
    PF00017. SH2. 1 hit.
    [Graphical view ]
    PRINTSi PR00401. SH2DOMAIN.
    SMARTi SM00252. SH2. 1 hit.
    [Graphical view ]
    SUPFAMi SSF48366. SSF48366. 1 hit.
    SSF55550. SSF55550. 1 hit.
    PROSITEi PS50001. SH2. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "NSP1 defines a novel family of adaptor proteins linking integrin and tyrosine kinase receptors to the c-Jun N-terminal kinase/stress-activated protein kinase signaling pathway."
      Lu Y., Brush J., Stewart T.A.
      J. Biol. Chem. 274:10047-10052(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY, PHOSPHORYLATION, INTERACTION WITH BCAR1, MUTAGENESIS OF TYR-95 AND TYR-231, VARIANT ASP-32.
      Tissue: Fetal kidney.
    2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT ASP-32.
    3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
      Tissue: Tongue and Trachea.
    4. "The DNA sequence and biology of human chromosome 19."
      Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M., Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E., Caenepeel S., Carrano A.V.
      , Caoile C., Chan Y.M., Christensen M., Cleland C.A., Copeland A., Dalin E., Dehal P., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Garcia C., Georgescu A.M., Glavina T., Gomez M., Gonzales E., Groza M., Hammon N., Hawkins T., Haydu L., Ho I., Huang W., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Larionov V., Leem S.-H., Lopez F., Lou Y., Lowry S., Malfatti S., Martinez D., McCready P.M., Medina C., Morgan J., Nelson K., Nolan M., Ovcharenko I., Pitluck S., Pollard M., Popkie A.P., Predki P., Quan G., Ramirez L., Rash S., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., She X., Smith D., Slezak T., Solovyev V., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wagner M., Wheeler J., Wu K., Xie G., Yang J., Dubchak I., Furey T.S., DeJong P., Dickson M., Gordon D., Eichler E.E., Pennacchio L.A., Richardson P., Stubbs L., Rokhsar D.S., Myers R.M., Rubin E.M., Lucas S.M.
      Nature 428:529-535(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Placenta.
    7. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-123; SER-125 AND SER-180, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    8. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
      Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
      Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-123, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    9. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
      Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
      Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-125; SER-147 AND SER-180, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    10. Cited for: VARIANT [LARGE SCALE ANALYSIS] GLY-265.

    Entry informationi

    Entry nameiSH23A_HUMAN
    AccessioniPrimary (citable) accession number: Q9BRG2
    Secondary accession number(s): A8K9R6, B4DRS7, Q9Y2X4
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: May 2, 2006
    Last sequence update: June 1, 2001
    Last modified: October 1, 2014
    This is version 104 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 19
      Human chromosome 19: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3