Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

SH2 domain-containing protein 3A

Gene

SH2D3A

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

May play a role in JNK activation.

GO - Molecular functioni

  • guanyl-nucleotide exchange factor activity Source: InterPro
  • SH3/SH2 adaptor activity Source: ProtInc

GO - Biological processi

  • JNK cascade Source: ProtInc
  • small GTPase mediated signal transduction Source: InterPro

Enzyme and pathway databases

SignaLinkiQ9BRG2

Names & Taxonomyi

Protein namesi
Recommended name:
SH2 domain-containing protein 3A
Alternative name(s):
Novel SH2-containing protein 1
Gene namesi
Name:SH2D3A
Synonyms:NSP1
ORF Names:UNQ175/PRO201
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 19

Organism-specific databases

EuPathDBiHostDB:ENSG00000125731.12
HGNCiHGNC:16885 SH2D3A
MIMi604721 gene
neXtProtiNX_Q9BRG2

Subcellular locationi

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi95Y → F: Loss of phosphorylation. 1 Publication1
Mutagenesisi231Y → F: Weak phosphorylation. 1 Publication1

Organism-specific databases

DisGeNETi10045
OpenTargetsiENSG00000125731
PharmGKBiPA38192

Polymorphism and mutation databases

BioMutaiSH2D3A
DMDMi74732879

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002331321 – 576SH2 domain-containing protein 3AAdd BLAST576

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei123PhosphoserineCombined sources1
Modified residuei125PhosphoserineCombined sources1
Modified residuei147PhosphoserineCombined sources1
Modified residuei180PhosphoserineCombined sources1
Modified residuei201PhosphoserineCombined sources1

Post-translational modificationi

Phosphorylated on tyrosine.1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ9BRG2
MaxQBiQ9BRG2
PaxDbiQ9BRG2
PeptideAtlasiQ9BRG2
PRIDEiQ9BRG2
ProteomicsDBi78763

PTM databases

iPTMnetiQ9BRG2
PhosphoSitePlusiQ9BRG2

Expressioni

Tissue specificityi

Weakly expressed in placenta, fetal kidney, fetal lung, adult pancreas, adult kidney and adult lung.1 Publication

Gene expression databases

BgeeiENSG00000125731
CleanExiHS_SH2D3A
ExpressionAtlasiQ9BRG2 baseline and differential
GenevisibleiQ9BRG2 HS

Organism-specific databases

HPAiHPA035722
HPA064382

Interactioni

Subunit structurei

Interacts with BCAR1.1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
EGFRP005332EBI-2339271,EBI-297353

GO - Molecular functioni

  • guanyl-nucleotide exchange factor activity Source: InterPro
  • SH3/SH2 adaptor activity Source: ProtInc

Protein-protein interaction databases

BioGridi115356, 8 interactors
IntActiQ9BRG2, 6 interactors
MINTiQ9BRG2
STRINGi9606.ENSP00000245908

Structurei

3D structure databases

ProteinModelPortaliQ9BRG2
SMRiQ9BRG2
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini15 – 114SH2PROSITE-ProRule annotationAdd BLAST100

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi259 – 267Poly-Glu9

Keywords - Domaini

SH2 domain

Phylogenomic databases

eggNOGiENOG410IJB1 Eukaryota
ENOG4111D9X LUCA
GeneTreeiENSGT00390000008976
HOGENOMiHOG000231595
HOVERGENiHBG053174
InParanoidiQ9BRG2
OMAiGCSGPLE
OrthoDBiEOG091G01KG
PhylomeDBiQ9BRG2
TreeFamiTF323756

Family and domain databases

Gene3Di1.10.840.10, 1 hit
3.30.505.10, 1 hit
InterProiView protein in InterPro
IPR023578 Ras_GEF_dom_sf
IPR001895 RASGEF_cat_dom
IPR036964 RASGEF_cat_dom_sf
IPR000980 SH2
IPR036860 SH2_dom_sf
PfamiView protein in Pfam
PF00017 SH2, 1 hit
PRINTSiPR00401 SH2DOMAIN
SMARTiView protein in SMART
SM00147 RasGEF, 1 hit
SM00252 SH2, 1 hit
SUPFAMiSSF48366 SSF48366, 1 hit
SSF55550 SSF55550, 1 hit
PROSITEiView protein in PROSITE
PS50001 SH2, 1 hit

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9BRG2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MQVPQDGEDL AGQPWYHGLL SRQKAEALLQ QNGDFLVRAS GSRGGNPVIS
60 70 80 90 100
CRWRGSALHF EVFRVALRPR PGRPTALFQL EDEQFPSIPA LVHSYMTGRR
110 120 130 140 150
PLSQATGAVV SRPVTWQGPL RRSFSEDTLM DGPARIEPLR ARKWSNSQPA
160 170 180 190 200
DLAHMGRSRE DPAGMEASTM PISALPRTSS DPVLLKAPAP LGTVADSLRA
210 220 230 240 250
SDGQLQAKAP TKPPRTPSFE LPDASERPPT YCELVPRVPS VQGTSPSQSC
260 270 280 290 300
PEPEAPWWEA EEDEEEENRC FTRPQAEISF CPHDAPSCLL GPQNRPLEPQ
310 320 330 340 350
VLHTLRGLFL EHHPGSTALH LLLVDCQATG LLGVTRDQRG NMGVSSGLEL
360 370 380 390 400
LTLPHGHHLR LELLERHQTL ALAGALAVLG CSGPLEERAA ALRGLVELAL
410 420 430 440 450
ALRPGAAGDL PGLAAVMGAL LMPQVSRLEH TWRQLRRSHT EAALAFEQEL
460 470 480 490 500
KPLMRALDEG AGPCDPGEVA LPHVAPMVRL LEGEEVAGPL DESCERLLRT
510 520 530 540 550
LHGARHMVRD APKFRKVAAQ RLRGFRPNPE LREALTTGFV RRLLWGSRGA
560 570
GAPRAERFEK FQRVLGVLSQ RLEPDR
Length:576
Mass (Da):63,093
Last modified:June 1, 2001 - v1
Checksum:i2909F7632B61F18D
GO
Isoform 2 (identifier: Q9BRG2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-17: MQVPQDGEDLAGQPWYH → MEKTLLANLGTTASCPA
     18-139: Missing.
     423-423: P → PQVRGEQGLEEAGVRVTGKTGEEACSDLFS

Note: No experimental confirmation available.
Show »
Length:483
Mass (Da):52,402
Checksum:i6760CBC56523568B
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_02605432N → D2 PublicationsCorresponds to variant dbSNP:rs7258236Ensembl.1
Natural variantiVAR_051349223D → G. Corresponds to variant dbSNP:rs12608960Ensembl.1
Natural variantiVAR_035989265E → G in a breast cancer sample; somatic mutation. 1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0562681 – 17MQVPQ…QPWYH → MEKTLLANLGTTASCPA in isoform 2. 1 PublicationAdd BLAST17
Alternative sequenceiVSP_05626918 – 139Missing in isoform 2. 1 PublicationAdd BLAST122
Alternative sequenceiVSP_056270423P → PQVRGEQGLEEAGVRVTGKT GEEACSDLFS in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF124249 mRNA Translation: AAD28244.1
AY358406 mRNA Translation: AAQ88772.1
AK292781 mRNA Translation: BAF85470.1
AK299406 mRNA Translation: BAG61389.1
AC008760 Genomic DNA No translation available.
AC020954 Genomic DNA No translation available.
CH471139 Genomic DNA Translation: EAW69059.1
BC006281 mRNA Translation: AAH06281.1
CCDSiCCDS12173.1 [Q9BRG2-1]
RefSeqiNP_005481.2, NM_005490.2 [Q9BRG2-1]
XP_005259529.1, XM_005259472.2 [Q9BRG2-2]
UniGeneiHs.439645

Genome annotation databases

EnsembliENST00000245908; ENSP00000245908; ENSG00000125731 [Q9BRG2-1]
ENST00000437152; ENSP00000393303; ENSG00000125731 [Q9BRG2-2]
GeneIDi10045
KEGGihsa:10045
UCSCiuc002mft.4 human [Q9BRG2-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiSH23A_HUMAN
AccessioniPrimary (citable) accession number: Q9BRG2
Secondary accession number(s): A8K9R6, B4DRS7, Q9Y2X4
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 2, 2006
Last sequence update: June 1, 2001
Last modified: June 20, 2018
This is version 130 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health