Q9BR01 (ST4A1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 102.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Sulfotransferase 4A1 Short name=ST4A1 EC=2.8.2.- Alternative name(s): Brain sulfotransferase-like protein Short name=hBR-STL Short name=hBR-STL-1 Nervous system sulfotransferase Short name=NST | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 284 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Atypical sulfotransferase family member with very low affinity for 3'-phospho-5'-adenylyl sulfate (PAPS) and very low catalytic activity towards L-triiodothyronine, thyroxine, estrone, p-nitrophenol, 2-naphthylamine, and 2-beta-naphthol. May have a role in the metabolism of drugs and neurotransmitters in the CNS. Ref.12 |
| Subcellular location | Cytoplasm By similarity. |
| Tissue specificity | Highly expressed in the cerebral cortex and frontal lobe, slightly less in the cerebellum, occipital and temporal lobes, relatively low in the medulla and putamen, and lowest in the spinal cord. No expression detected in the pancreas (Ref.1). Highly expressed in fetal brain and occipital lobe, slightly less in the whole brain, frontal lobe, hippocampus, and lung, very low expression in cerebellum, medulla oblongata, temporal lobe, testis, kidney and appendix (Ref.2). |
| Sequence similarities | Belongs to the sulfotransferase 1 family. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Lipid metabolism Steroid metabolism |
| Cellular component | Cytoplasm |
| Coding sequence diversity | Alternative splicing |
| Molecular function | Transferase |
| PTM | Phosphoprotein |
| Technical term | 3D-structure Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | 3'-phosphoadenosine 5'-phosphosulfate metabolic process Traceable author statement. Source: Reactome steroid metabolic processInferred from electronic annotation. Source: UniProtKB-KW xenobiotic metabolic processTraceable author statement. Source: Reactome |
| Cellular_component | cytosol Non-traceable author statement. Source: UniProtKB |
| Molecular_function | sulfotransferase activity Non-traceable author statement Ref.1. Source: UniProtKB |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9BR01-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9BR01-2) The sequence of this isoform differs from the canonical sequence as follows: 248-284: GRVGLWKDIFTVSMNEKFDLVYKQKMGKCDLTFDFYL → AHCVFARKIFLSW |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 284 | 284 | Sulfotransferase 4A1 | PRO_0000085167 | |||||||||||||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 205 | 1 | Phosphothreonine Ref.11 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 248 – 284 | 37 | GRVGL…FDFYL → AHCVFARKIFLSW in isoform 2. | VSP_006304 | |||||||||||||||||||||||||||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 55 – 56 | 2 | KS → P in AAH30665. Ref.10 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 239 | 1 | N → S in AAH22459. Ref.10 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 15 – 17 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 18 – 22 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 25 – 27 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 29 – 31 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 35 – 39 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 48 – 52 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 59 – 68 | 10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 91 – 94 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 96 – 101 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 107 – 110 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 114 – 116 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 119 – 122 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 126 – 132 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 135 – 144 | 10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 158 – 166 | 9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 175 – 183 | 9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 184 – 187 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 191 – 195 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 198 – 201 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 203 – 213 | 11 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 220 – 235 | 16 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 242 – 246 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 252 – 255 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 259 – 273 | 15 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Molecular cloning and expression of novel sulphotransferase-like cDNAs from human and rat brain." Falany C.N., Xie X., Wang J., Ferrer J., Falany J.L. Biochem. J. 346:857-864(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), CHARACTERIZATION. Tissue: Brain. |
| [2] | "Highly conserved mouse and human brain sulfotransferases: molecular cloning, expression, and functional characterization." Sakakibara Y., Suiko M., Pai T.G., Nakayama T., Takami Y., Katafuchi J., Liu M.-C. Gene 285:39-47(2002) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), CHARACTERIZATION. Tissue: Brain. |
| [3] | "Molecular identification of a human nervous system cytoplasmic sulfotransferase, NST." Martin S.C., Farb D.H. Submitted (AUG-1999) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE (ISOFORM 1). Tissue: Brain. |
| [4] | "Molecular and physical characterization of human SULT4A1, representing a novel cytosolic sulfotransferase 1 family." Walther S.E., Raftogianis R.B. Submitted (MAR-2000) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE (ISOFORM 1). Tissue: Brain. |
| [5] | "Reevaluating human gene annotation: a second-generation analysis of chromosome 22." Collins J.E., Goward M.E., Cole C.G., Smink L.J., Huckle E.J., Knowles S., Bye J.M., Beare D.M., Dunham I. Genome Res. 13:27-36(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Testis. |
| [6] | "A genome annotation-driven approach to cloning the human ORFeome." Collins J.E., Wright C.L., Edwards C.A., Davis M.P., Grinham J.A., Cole C.G., Goward M.E., Aguado B., Mallya M., Mokrab Y., Huckle E.J., Beare D.M., Dunham I. Genome Biol. 5:R84.1-R84.11(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [7] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain. |
| [8] | "The DNA sequence of human chromosome 22." Dunham I., Hunt A.R., Collins J.E., Bruskiewich R., Beare D.M., Clamp M., Smink L.J., Ainscough R., Almeida J.P., Babbage A.K., Bagguley C., Bailey J., Barlow K.F., Bates K.N., Beasley O.P., Bird C.P., Blakey S.E., Bridgeman A.M. Wright H.Nature 402:489-495(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [9] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [10] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Tissue: Fetal brain, Hippocampus and Hypothalamus. |
| [11] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-205, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| [12] | "Structural and chemical profiling of the human cytosolic sulfotransferases." Allali-Hassani A., Pan P.W., Dombrovski L., Najmanovich R., Tempel W., Dong A., Loppnau P., Martin F., Thornton J., Edwards A.M., Bochkarev A., Plotnikov A.N., Vedadi M., Arrowsmith C.H. PLoS Biol. 5:E97-E97(2007) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.24 ANGSTROMS), FUNCTION, CHARACTERIZATION. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AF188698 mRNA. Translation: AAF61197.1. AF115311 mRNA. Translation: AAF21970.1. AF176342 mRNA. Translation: AAK64595.1. AF251263 mRNA. Translation: AAF98152.1. AL590119 mRNA. Translation: CAC34872.1. CR456588 mRNA. Translation: CAG30474.1. AK313048 mRNA. Translation: BAG35880.1. Z97055 Genomic DNA. Translation: CAB09788.1. CH471138 Genomic DNA. Translation: EAW73320.1. BC022459 mRNA. Translation: AAH22459.1. BC028171 mRNA. Translation: AAH28171.1. BC030665 mRNA. Translation: AAH30665.1. | ||||||||||||
| IPI | IPI00161549. IPI00219423. | ||||||||||||
| RefSeq | NP_055166.1. NM_014351.3. | ||||||||||||
| UniGene | Hs.189810. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | Q9BR01. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| STRING | 9606.ENSP00000332565. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | Q9BR01. | ||||||||||||
Polymorphism databases | |||||||||||||
| DMDM | 22096149. | ||||||||||||
Proteomic databases | |||||||||||||
| PaxDb | Q9BR01. | ||||||||||||
| PRIDE | Q9BR01. | ||||||||||||
Protocols and materials databases | |||||||||||||
| DNASU | 25830. | ||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000249130; ENSP00000249130; ENSG00000130540. ENST00000330884; ENSP00000332565; ENSG00000130540. ENST00000422525; ENSP00000388285; ENSG00000130540. | ||||||||||||
| GeneID | 25830. | ||||||||||||
| KEGG | hsa:25830. | ||||||||||||
| UCSC | uc003bed.1. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 25830. | ||||||||||||
| GeneCards | GC22M044220. | ||||||||||||
| HGNC | HGNC:14903. SULT4A1. | ||||||||||||
| HPA | HPA003129. | ||||||||||||
| MIM | 608359. gene. | ||||||||||||
| neXtProt | NX_Q9BR01. | ||||||||||||
| PharmGKB | PA412. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | NOG267541. | ||||||||||||
| HOGENOM | HOG000037209. | ||||||||||||
| HOVERGEN | HBG105932. | ||||||||||||
| InParanoid | Q9BR01. | ||||||||||||
| KO | K11823. | ||||||||||||
| OMA | RSSDIWI. | ||||||||||||
| OrthoDB | EOG4HMJ9Q. | ||||||||||||
| PhylomeDB | Q9BR01. | ||||||||||||
Enzyme and pathway databases | |||||||||||||
| BRENDA | 2.8.2.1. 2681. | ||||||||||||
| Reactome | REACT_111217. Metabolism. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | Q9BR01. | ||||||||||||
| Bgee | Q9BR01. | ||||||||||||
| CleanEx | HS_SULT4A1. | ||||||||||||
| Genevestigator | Q9BR01. | ||||||||||||
| GermOnline | ENSG00000130540. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| InterPro | IPR000863. Sulfotransferase_dom. [Graphical view] | ||||||||||||
| Pfam | PF00685. Sulfotransfer_1. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| ChEMBL | CHEMBL1743298. | ||||||||||||
| EvolutionaryTrace | Q9BR01. | ||||||||||||
| GenomeRNAi | 25830. | ||||||||||||
| NextBio | 47121. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | ST4A1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9BR01 Secondary accession number(s): B2R7N3, O43728 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 22 Human chromosome 22: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
