Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Sulfotransferase 4A1

Gene

SULT4A1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Atypical sulfotransferase family member with very low affinity for 3'-phospho-5'-adenylyl sulfate (PAPS) and very low catalytic activity towards L-triiodothyronine, thyroxine, estrone, p-nitrophenol, 2-naphthylamine, and 2-beta-naphthol. May have a role in the metabolism of drugs and neurotransmitters in the CNS.1 Publication

GO - Molecular functioni

  • aryl sulfotransferase activity Source: Reactome
  • sulfotransferase activity Source: UniProtKB

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Transferase

Keywords - Biological processi

Lipid metabolism, Steroid metabolism

Enzyme and pathway databases

BioCyciZFISH:ENSG00000130540-MONOMER.
BRENDAi2.8.2.1. 2681.
ReactomeiR-HSA-156584. Cytosolic sulfonation of small molecules.
SIGNORiQ9BR01.

Names & Taxonomyi

Protein namesi
Recommended name:
Sulfotransferase 4A1 (EC:2.8.2.-)
Short name:
ST4A1
Alternative name(s):
Brain sulfotransferase-like protein
Short name:
hBR-STL
Short name:
hBR-STL-1
Nervous system sulfotransferase
Short name:
NST
Gene namesi
Name:SULT4A1
Synonyms:SULTX3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 22

Organism-specific databases

HGNCiHGNC:14903. SULT4A1.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

DisGeNETi25830.
OpenTargetsiENSG00000130540.
PharmGKBiPA412.

Chemistry databases

ChEMBLiCHEMBL1743298.

Polymorphism and mutation databases

BioMutaiSULT4A1.
DMDMi22096149.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000851671 – 284Sulfotransferase 4A1Add BLAST284

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei8PhosphothreonineBy similarity1
Modified residuei11PhosphothreonineBy similarity1
Modified residuei205PhosphothreonineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ9BR01.
PeptideAtlasiQ9BR01.
PRIDEiQ9BR01.

PTM databases

iPTMnetiQ9BR01.
PhosphoSitePlusiQ9BR01.

Expressioni

Tissue specificityi

Highly expressed in the cerebral cortex and frontal lobe, slightly less in the cerebellum, occipital and temporal lobes, relatively low in the medulla and putamen, and lowest in the spinal cord. No expression detected in the pancreas (PubMed:10698717). Highly expressed in fetal brain and occipital lobe, slightly less in the whole brain, frontal lobe, hippocampus, and lung, very low expression in cerebellum, medulla oblongata, temporal lobe, testis, kidney and appendix (PubMed:12039030).2 Publications

Gene expression databases

BgeeiENSG00000130540.
CleanExiHS_SULT4A1.
ExpressionAtlasiQ9BR01. baseline and differential.
GenevisibleiQ9BR01. HS.

Organism-specific databases

HPAiHPA003129.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
PIN1Q135264EBI-6690555,EBI-714158
POT1Q9NUX52EBI-6690555,EBI-752420

Protein-protein interaction databases

BioGridi117358. 10 interactors.
IntActiQ9BR01. 5 interactors.
STRINGi9606.ENSP00000332565.

Structurei

Secondary structure

1284
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi15 – 17Combined sources3
Beta strandi18 – 22Combined sources5
Beta strandi25 – 27Combined sources3
Helixi29 – 31Combined sources3
Helixi35 – 39Combined sources5
Beta strandi48 – 52Combined sources5
Helixi59 – 68Combined sources10
Beta strandi91 – 94Combined sources4
Helixi96 – 101Combined sources6
Beta strandi107 – 110Combined sources4
Helixi114 – 116Combined sources3
Helixi119 – 122Combined sources4
Beta strandi126 – 132Combined sources7
Helixi135 – 144Combined sources10
Helixi158 – 166Combined sources9
Helixi175 – 183Combined sources9
Turni184 – 187Combined sources4
Beta strandi191 – 195Combined sources5
Helixi198 – 201Combined sources4
Helixi203 – 213Combined sources11
Helixi220 – 235Combined sources16
Beta strandi242 – 246Combined sources5
Helixi252 – 255Combined sources4
Helixi259 – 273Combined sources15

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1ZD1X-ray2.24A/B1-284[»]
ProteinModelPortaliQ9BR01.
SMRiQ9BR01.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9BR01.

Family & Domainsi

Sequence similaritiesi

Belongs to the sulfotransferase 1 family.Curated

Phylogenomic databases

eggNOGiKOG1584. Eukaryota.
ENOG4111H56. LUCA.
GeneTreeiENSGT00760000118932.
HOGENOMiHOG000037209.
HOVERGENiHBG105932.
InParanoidiQ9BR01.
KOiK11823.
OMAiSDIWIVT.
OrthoDBiEOG091G0D5F.
PhylomeDBiQ9BR01.
TreeFamiTF321745.

Family and domain databases

Gene3Di3.40.50.300. 1 hit.
InterProiIPR027417. P-loop_NTPase.
IPR000863. Sulfotransferase_dom.
[Graphical view]
PfamiPF00685. Sulfotransfer_1. 1 hit.
[Graphical view]
SUPFAMiSSF52540. SSF52540. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9BR01-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAESEAETPS TPGEFESKYF EFHGVRLPPF CRGKMEEIAN FPVRPSDVWI
60 70 80 90 100
VTYPKSGTSL LQEVVYLVSQ GADPDEIGLM NIDEQLPVLE YPQPGLDIIK
110 120 130 140 150
ELTSPRLIKS HLPYRFLPSD LHNGDSKVIY MARNPKDLVV SYYQFHRSLR
160 170 180 190 200
TMSYRGTFQE FCRRFMNDKL GYGSWFEHVQ EFWEHRMDSN VLFLKYEDMH
210 220 230 240 250
RDLVTMVEQL ARFLGVSCDK AQLEALTEHC HQLVDQCCNA EALPVGRGRV
260 270 280
GLWKDIFTVS MNEKFDLVYK QKMGKCDLTF DFYL
Length:284
Mass (Da):33,085
Last modified:August 2, 2002 - v2
Checksum:iA6EA6844B66C400B
GO
Isoform 2 (identifier: Q9BR01-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     248-284: GRVGLWKDIFTVSMNEKFDLVYKQKMGKCDLTFDFYL → AHCVFARKIFLSW

Show »
Length:260
Mass (Da):30,226
Checksum:i7F71F2C8A264D34F
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti55 – 56KS → P in AAH30665 (PubMed:15489334).Curated2
Sequence conflicti239N → S in AAH22459 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_006304248 – 284GRVGL…FDFYL → AHCVFARKIFLSW in isoform 2. 2 PublicationsAdd BLAST37

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF188698 mRNA. Translation: AAF61197.1.
AF115311 mRNA. Translation: AAF21970.1.
AF176342 mRNA. Translation: AAK64595.1.
AF251263 mRNA. Translation: AAF98152.1.
AL590119 mRNA. Translation: CAC34872.1.
CR456588 mRNA. Translation: CAG30474.1.
AK313048 mRNA. Translation: BAG35880.1.
Z97055 Genomic DNA. Translation: CAB09788.1.
CH471138 Genomic DNA. Translation: EAW73320.1.
BC022459 mRNA. Translation: AAH22459.1.
BC028171 mRNA. Translation: AAH28171.1.
BC030665 mRNA. Translation: AAH30665.1.
CCDSiCCDS14051.1. [Q9BR01-1]
RefSeqiNP_055166.1. NM_014351.3. [Q9BR01-1]
UniGeneiHs.189810.

Genome annotation databases

EnsembliENST00000330884; ENSP00000332565; ENSG00000130540. [Q9BR01-1]
ENST00000422525; ENSP00000388285; ENSG00000130540. [Q9BR01-2]
GeneIDi25830.
KEGGihsa:25830.
UCSCiuc003bee.2. human. [Q9BR01-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF188698 mRNA. Translation: AAF61197.1.
AF115311 mRNA. Translation: AAF21970.1.
AF176342 mRNA. Translation: AAK64595.1.
AF251263 mRNA. Translation: AAF98152.1.
AL590119 mRNA. Translation: CAC34872.1.
CR456588 mRNA. Translation: CAG30474.1.
AK313048 mRNA. Translation: BAG35880.1.
Z97055 Genomic DNA. Translation: CAB09788.1.
CH471138 Genomic DNA. Translation: EAW73320.1.
BC022459 mRNA. Translation: AAH22459.1.
BC028171 mRNA. Translation: AAH28171.1.
BC030665 mRNA. Translation: AAH30665.1.
CCDSiCCDS14051.1. [Q9BR01-1]
RefSeqiNP_055166.1. NM_014351.3. [Q9BR01-1]
UniGeneiHs.189810.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1ZD1X-ray2.24A/B1-284[»]
ProteinModelPortaliQ9BR01.
SMRiQ9BR01.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi117358. 10 interactors.
IntActiQ9BR01. 5 interactors.
STRINGi9606.ENSP00000332565.

Chemistry databases

ChEMBLiCHEMBL1743298.

PTM databases

iPTMnetiQ9BR01.
PhosphoSitePlusiQ9BR01.

Polymorphism and mutation databases

BioMutaiSULT4A1.
DMDMi22096149.

Proteomic databases

PaxDbiQ9BR01.
PeptideAtlasiQ9BR01.
PRIDEiQ9BR01.

Protocols and materials databases

DNASUi25830.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000330884; ENSP00000332565; ENSG00000130540. [Q9BR01-1]
ENST00000422525; ENSP00000388285; ENSG00000130540. [Q9BR01-2]
GeneIDi25830.
KEGGihsa:25830.
UCSCiuc003bee.2. human. [Q9BR01-1]

Organism-specific databases

CTDi25830.
DisGeNETi25830.
GeneCardsiSULT4A1.
HGNCiHGNC:14903. SULT4A1.
HPAiHPA003129.
MIMi608359. gene.
neXtProtiNX_Q9BR01.
OpenTargetsiENSG00000130540.
PharmGKBiPA412.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1584. Eukaryota.
ENOG4111H56. LUCA.
GeneTreeiENSGT00760000118932.
HOGENOMiHOG000037209.
HOVERGENiHBG105932.
InParanoidiQ9BR01.
KOiK11823.
OMAiSDIWIVT.
OrthoDBiEOG091G0D5F.
PhylomeDBiQ9BR01.
TreeFamiTF321745.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000130540-MONOMER.
BRENDAi2.8.2.1. 2681.
ReactomeiR-HSA-156584. Cytosolic sulfonation of small molecules.
SIGNORiQ9BR01.

Miscellaneous databases

EvolutionaryTraceiQ9BR01.
GeneWikiiSULT4A1.
GenomeRNAii25830.
PROiQ9BR01.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000130540.
CleanExiHS_SULT4A1.
ExpressionAtlasiQ9BR01. baseline and differential.
GenevisibleiQ9BR01. HS.

Family and domain databases

Gene3Di3.40.50.300. 1 hit.
InterProiIPR027417. P-loop_NTPase.
IPR000863. Sulfotransferase_dom.
[Graphical view]
PfamiPF00685. Sulfotransfer_1. 1 hit.
[Graphical view]
SUPFAMiSSF52540. SSF52540. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiST4A1_HUMAN
AccessioniPrimary (citable) accession number: Q9BR01
Secondary accession number(s): B2R7N3, O43728
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 2, 2002
Last sequence update: August 2, 2002
Last modified: November 30, 2016
This is version 136 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 22
    Human chromosome 22: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.