Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Transcription factor COE4

Gene

EBF4

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at transcript leveli

Functioni

Transcriptional factor which recognizes variations of the palindromic sequence 5'-ATTCCCNNGGGAATT-3'.By similarity

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri152 – 171C5-typeSequence analysisAdd BLAST20

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionActivator, Developmental protein, DNA-binding
Biological processTranscription, Transcription regulation
LigandMetal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
Transcription factor COE4
Alternative name(s):
Early B-cell factor 4
Short name:
EBF-4
Olf-1/EBF-like 4
Short name:
O/E-4
Short name:
OE-4
Gene namesi
Name:EBF4
Synonyms:COE4, KIAA1442
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 20

Organism-specific databases

HGNCiHGNC:29278. EBF4.

Subcellular locationi

GO - Cellular componenti

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000088881.
PharmGKBiPA162384262.

Polymorphism and mutation databases

DMDMi152031576.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001078351 – 602Transcription factor COE4Add BLAST602

Proteomic databases

PaxDbiQ9BQW3.
PeptideAtlasiQ9BQW3.
PRIDEiQ9BQW3.
TopDownProteomicsiQ9BQW3-1. [Q9BQW3-1]

PTM databases

iPTMnetiQ9BQW3.
PhosphoSitePlusiQ9BQW3.

Expressioni

Gene expression databases

BgeeiENSG00000088881.
CleanExiHS_EBF4.
ExpressionAtlasiQ9BQW3. baseline and differential.

Interactioni

Subunit structurei

Forms either a homodimer or a heterodimer with a related family member.By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sitei164Interaction with DNABy similarity1
Sitei173Interaction with DNABy similarity1

Protein-protein interaction databases

BioGridi121644. 3 interactors.
IntActiQ9BQW3. 1 interactor.
STRINGi9606.ENSP00000370022.

Structurei

3D structure databases

ProteinModelPortaliQ9BQW3.
SMRiQ9BQW3.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini256 – 338IPT/TIGAdd BLAST83

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni64 – 67Interaction with DNABy similarity4
Regioni198 – 205Interaction with DNABy similarity8
Regioni237 – 240Interaction with DNABy similarity4

Sequence similaritiesi

Belongs to the COE family.Curated

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri152 – 171C5-typeSequence analysisAdd BLAST20

Keywords - Domaini

Zinc-finger

Phylogenomic databases

eggNOGiKOG3836. Eukaryota.
ENOG410XQ9Z. LUCA.
GeneTreeiENSGT00390000014051.
HOGENOMiHOG000092311.
HOVERGENiHBG005108.
InParanoidiQ9BQW3.
KOiK09103.
PhylomeDBiQ9BQW3.

Family and domain databases

Gene3Di2.60.40.10. 1 hit.
InterProiView protein in InterPro
IPR032200. COE_DBD.
IPR032201. COE_HLH.
IPR013783. Ig-like_fold.
IPR014756. Ig_E-set.
IPR002909. IPT.
IPR003523. Transcription_factor_COE.
IPR018350. Transcription_factor_COE_CS.
PANTHERiPTHR10747. PTHR10747. 1 hit.
PfamiView protein in Pfam
PF16422. COE1_DBD. 1 hit.
PF16423. COE1_HLH. 1 hit.
PF01833. TIG. 1 hit.
SMARTiView protein in SMART
SM00429. IPT. 1 hit.
SUPFAMiSSF81296. SSF81296. 1 hit.
PROSITEiView protein in PROSITE
PS01345. COE. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 2 (identifier: Q9BQW3-2) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MFPAQDALPR SGLNLKEEPL LPAGLGSVRS WMQGAGILDA STAAQSGVGL
60 70 80 90 100
ARAHFEKQPP SNLRKSNFFH FVLAMYDRQG QPVEVERTAF IDFVEKDREP
110 120 130 140 150
GAEKTNNGIH YRLRLVYNNG LRTEQDLYVR LIDSMSKQAI IYEGQDKNPE
160 170 180 190 200
MCRVLLTHEI MCSRCCDRKS CGNRNETPSD PVIIDRFFLK FFLKCNQNCL
210 220 230 240 250
KNAGNPRDMR RFQVVVSTTV SVDGHVLAVS DNMFVHNNSK HGRRARRLDP
260 270 280 290 300
SEAATPCIKA ISPGEGWTTG GATVIVIGDN FFDGLQVVFG NVLVWSELIT
310 320 330 340 350
PHAIRVQTPP RHIPGVVEVT LSYKSKQFCK GCPGRFVYTA LNEPTIDYGF
360 370 380 390 400
QRLQKVIPRH PGDPERLPKE VLLKRAADLA EALYGVPGSN QELLLKRAAD
410 420 430 440 450
VAEALYSTPR APGPLAPLAP SHPHPAVVGI NAFSSPLAIA VGDATPGPEP
460 470 480 490 500
GYARSCSSAS PRGFAPSPGS QQSGYGGGLG AGLGGYGAPG VAGLGVPGSP
510 520 530 540 550
SFLNGSTATS PFAIMPSSPP LAAASSMSLP AAAPTTSVFS FSPVNMISAV
560 570 580 590 600
KQRSAFAPVL RPPSSPPQAC PRAHGEGLPD QSFEDSDKFH SPARGLQGLA

YS
Length:602
Mass (Da):64,473
Last modified:July 10, 2007 - v2
Checksum:iEA340606A71094C1
GO
Isoform 1 (identifier: Q9BQW3-1) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-5: MFPAQ → MARARGQAPG...SAPAASASRM
     514-602: IMPSSPPLAA...ARGLQGLAYS → KERLRPRAAPPKLPTPGLPQSPRRGASRPVF

Note: No experimental confirmation available.
Show »
Length:642
Mass (Da):68,232
Checksum:i18C0BE24442AFA76
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti425P → S in BAA92680 (PubMed:10718198).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0264691 – 5MFPAQ → MARARGQAPGSGGRRRPRRG GAGTGPRGESAGLLLLLLQV LPPGATAGPGRRGTRGAGGG GVCWPGAAPAFPRDARLLLL LPPLPPLSPPPPSSAPAASA SRM in isoform 1. 1 Publication5
Alternative sequenceiVSP_026470514 – 602IMPSS…GLAYS → KERLRPRAAPPKLPTPGLPQ SPRRGASRPVF in isoform 1. 1 PublicationAdd BLAST89

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL035460 Genomic DNA. Translation: CAB82244.1.
AB037863 mRNA. Translation: BAA92680.1.
RefSeqiNP_001103984.1. NM_001110514.1.
UniGeneiHs.471955.

Genome annotation databases

EnsembliENST00000609451; ENSP00000477023; ENSG00000088881. [Q9BQW3-2]
GeneIDi57593.
KEGGihsa:57593.
UCSCiuc061vby.1. human. [Q9BQW3-2]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiCOE4_HUMAN
AccessioniPrimary (citable) accession number: Q9BQW3
Secondary accession number(s): Q1MTP7
, Q5JY53, Q9NUB6, Q9P2A6
Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 10, 2002
Last sequence update: July 10, 2007
Last modified: August 30, 2017
This is version 132 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 20
    Human chromosome 20: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families