Q9BQW3 (COE4_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 92.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Transcription factor COE4 Alternative name(s): Early B-cell factor 4 Short name=EBF-4 Olf-1/EBF-like 4 Short name=O/E-4 Short name=OE-4 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 602 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | Transcriptional factor which recognizes variations of the palindromic sequence 5'-ATTCCCNNGGGAATT-3' By similarity. |
| Subunit structure | Forms either a homodimer or a heterodimer with a related family member By similarity. |
| Subcellular location | Nucleus Potential. |
| Sequence similarities | Belongs to the COE family. Contains 1 IPT/TIG domain. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Transcription Transcription regulation |
| Cellular component | Nucleus |
| Coding sequence diversity | Alternative splicing |
| Domain | Zinc-finger |
| Ligand | DNA-binding Metal-binding Zinc |
| Molecular function | Activator Developmental protein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological process | multicellular organismal development Inferred from electronic annotation. Source: UniProtKB-KW regulation of transcription, DNA-dependentInferred from electronic annotation. Source: UniProtKB-KW transcription, DNA-dependentInferred from electronic annotation. Source: UniProtKB-KW |
| Cellular component | nucleus Inferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular function | DNA binding Inferred from electronic annotation. Source: UniProtKB-KW metal ion bindingInferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 2 (identifier: Q9BQW3-2) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 1 (identifier: Q9BQW3-1) The sequence of this isoform differs from the canonical sequence as follows: 1-5: MFPAQ → MARARGQAPG...SAPAASASRM 514-602: IMPSSPPLAA...ARGLQGLAYS → KERLRPRAAPPKLPTPGLPQSPRRGASRPVF | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 602 | 602 | Transcription factor COE4 | PRO_0000107835 | |||||
Regions | |||||||||
| Domain | 256 – 338 | 83 | IPT/TIG | ||||||
| Zinc finger | 152 – 171 | 20 | C5-type Potential | ||||||
| Region | 64 – 67 | 4 | Interaction with DNA By similarity | ||||||
| Region | 198 – 205 | 8 | Interaction with DNA By similarity | ||||||
| Region | 237 – 240 | 4 | Interaction with DNA By similarity | ||||||
Sites | |||||||||
| Site | 164 | 1 | Interaction with DNA By similarity | ||||||
| Site | 173 | 1 | Interaction with DNA By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 5 | 5 | MFPAQ → MARARGQAPGSGGRRRPRRG GAGTGPRGESAGLLLLLLQV LPPGATAGPGRRGTRGAGGG GVCWPGAAPAFPRDARLLLL LPPLPPLSPPPPSSAPAASA SRM in isoform 1. | VSP_026469 | |||||
| Alternative sequence | 514 – 602 | 89 | IMPSS…GLAYS → KERLRPRAAPPKLPTPGLPQ SPRRGASRPVF in isoform 1. | VSP_026470 | |||||
Experimental info | |||||||||
| Sequence conflict | 425 | 1 | P → S in BAA92680. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| [1] | "The DNA sequence and comparative analysis of human chromosome 20." Deloukas P., Matthews L.H., Ashurst J.L., Burton J., Gilbert J.G.R., Jones M., Stavrides G., Almeida J.P., Babbage A.K., Bagguley C.L., Bailey J., Barlow K.F., Bates K.N., Beard L.M., Beare D.M., Beasley O.P., Bird C.P., Blakey S.E. Rogers J.Nature 414:865-871(2001) [PubMed: 11780052] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [2] | "Prediction of the coding sequences of unidentified human genes. XVI. The complete sequences of 150 new cDNA clones from brain which code for large proteins in vitro." Nagase T., Kikuno R., Ishikawa K., Hirosawa M., Ohara O. DNA Res. 7:65-73(2000) [PubMed: 10718198] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 16-602 (ISOFORM 1). Tissue: Brain. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AL035460 Genomic DNA. Translation: CAB82244.1. AB037863 mRNA. Translation: BAA92680.1. |
| IPI | IPI00215773. IPI00853002. |
| RefSeq | NP_001103984.1. NM_001110514.1. |
| UniGene | Hs.471955. |
3D structure databases | |
| ProteinModelPortal | Q9BQW3. |
| SMR | Q9BQW3. Positions 37-387. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | Q9BQW3. |
Polymorphism databases | |
| DMDM | 152031576. |
Proteomic databases | |
| PRIDE | Q9BQW3. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000342725; ENSP00000345030; ENSG00000088881. |
| GeneID | 57593. |
| KEGG | hsa:57593. |
| NMPDR | fig|9606.3.peg.19739. |
| UCSC | uc002wgt.2. human. |
Organism-specific databases | |
| CTD | 57593. |
| GeneCards | GC20P002673. |
| HGNC | HGNC:29278. EBF4. |
| MIM | 609935. gene. |
| neXtProt | NX_Q9BQW3. |
| HUGE | Search... |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG04415. |
| GeneTree | ENSGT00390000014051. |
| HOVERGEN | HBG005108. |
| InParanoid | Q9BQW3. |
| OMA | QACPRTH. |
Gene expression databases | |
| ArrayExpress | Q9BQW3. |
| Bgee | Q9BQW3. |
| CleanEx | HS_EBF4. |
| Genevestigator | Q9BQW3. |
Family and domain databases | |
| InterPro | IPR011598. HLH_DNA-bd. IPR013783. Ig-like_fold. IPR014756. Ig_E-set. IPR002909. IPT_TIG_rcpt. IPR003523. Transcription_factor_COE. IPR018350. Transcription_factor_COE_CS. [Graphical view] |
| Gene3D | G3DSA:2.60.40.10. Ig-like_fold. 1 hit. |
| KO | K09103. |
| PANTHER | PTHR10747. TF_COE. 1 hit. |
| Pfam | PF01833. TIG. 1 hit. [Graphical view] |
| SMART | SM00353. HLH. 1 hit. SM00429. IPT. 1 hit. [Graphical view] |
| SUPFAM | SSF81296. Ig_E-set. 1 hit. |
| PROSITE | PS01345. COE. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 64186. |
| SOURCE | Search... |
Entry information
| Entry name | COE4_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9BQW3 Secondary accession number(s): Q1MTP7 Q9P2A6 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 20 Human chromosome 20: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with