Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Synaptotagmin-15

Gene

SYT15

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at transcript leveli

Functioni

May be involved in the trafficking and exocytosis of secretory vesicles in non-neuronal tissues.By similarity

GO - Molecular functioni

Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Synaptotagmin-15
Alternative name(s):
Chr10Syt
Synaptotagmin XV
Short name:
SytXV
Gene namesi
Name:SYT15
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 10

Organism-specific databases

HGNCiHGNC:17167. SYT15.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 44ExtracellularBy similarity
Transmembranei5 – 2925Helical; Signal-anchor for type III membrane proteinSequence analysisAdd
BLAST
Topological domaini30 – 421392CytoplasmicSequence analysisAdd
BLAST

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134921618.

Polymorphism and mutation databases

BioMutaiSYT15.
DMDMi317373506.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 421421Synaptotagmin-15PRO_0000183980Add
BLAST

Proteomic databases

MaxQBiQ9BQS2.
PaxDbiQ9BQS2.
PRIDEiQ9BQS2.

PTM databases

PhosphoSiteiQ9BQS2.

Expressioni

Gene expression databases

BgeeiQ9BQS2.
CleanExiHS_SYT15.
ExpressionAtlasiQ9BQS2. baseline and differential.
GenevisibleiQ9BQS2. HS.

Organism-specific databases

HPAiHPA036971.
HPA036972.

Interactioni

Subunit structurei

Homodimer.By similarity

GO - Molecular functioni

Protein-protein interaction databases

BioGridi123765. 1 interaction.
STRINGi9606.ENSP00000363441.

Structurei

3D structure databases

ProteinModelPortaliQ9BQS2.
SMRiQ9BQS2. Positions 148-415.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini149 – 248100C2 1PROSITE-ProRule annotationAdd
BLAST
Domaini280 – 383104C2 2PROSITE-ProRule annotationAdd
BLAST

Domaini

Neither C2 domains mediates Ca2+-dependent or -independent phospholipid binding.By similarity

Sequence similaritiesi

Belongs to the synaptotagmin family.Curated
Contains 2 C2 domains.PROSITE-ProRule annotation

Keywords - Domaini

Repeat, Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG1028. Eukaryota.
ENOG410XRME. LUCA.
GeneTreeiENSGT00830000128339.
HOGENOMiHOG000273864.
HOVERGENiHBG059275.
InParanoidiQ9BQS2.
KOiK19914.
PhylomeDBiQ9BQS2.
TreeFamiTF315600.

Family and domain databases

Gene3Di2.60.40.150. 2 hits.
InterProiIPR000008. C2_dom.
IPR030539. SYT15.
[Graphical view]
PANTHERiPTHR10024:SF234. PTHR10024:SF234. 1 hit.
PfamiPF00168. C2. 2 hits.
[Graphical view]
SMARTiSM00239. C2. 2 hits.
[Graphical view]
SUPFAMiSSF49562. SSF49562. 2 hits.
PROSITEiPS50004. C2. 2 hits.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9BQS2-1) [UniParc]FASTAAdd to basket

Also known as: Syt XV-a

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAEQLALVIG GTIGGLLLLL LIGASCCLWR RFCATLTYEE LPGTPAMATT
60 70 80 90 100
AASSGQRDRP CQPHARTQLS RPPAVPFVVP PTLQGRDWVP LHSGEWADAP
110 120 130 140 150
WDPCPASELL PHTSSGGLGD ACMVGAINPE LYKFPEDKSE TDFPDGCLGR
160 170 180 190 200
LWFSVEYEQE AERLLVGLIK AQHLQAPSET CSPLVKLYLL PDERRFLQSK
210 220 230 240 250
TKRKTSNPQF DEHFIFQVSS KTITQRVLKF SVYHVDRQRK HQLLGQVLFP
260 270 280 290 300
LKNETLVGDC RRVIWRDLEA ESLEPPSEFG DLQFCLSYND YLSRLTVVVL
310 320 330 340 350
RAKGLRLQED RGIVSVFVKV SLMNHNKFVK CKKTSAVLGS INPVYNETFS
360 370 380 390 400
FKADATELDT ASLSLTVVQN MEGDKSQQLG RVVVGPYMYT RGRELEHWDE
410 420
MLSKPKELVK RWHALCRTTE P
Length:421
Mass (Da):47,375
Last modified:January 11, 2011 - v3
Checksum:iAD9C6CE0957625B7
GO
Isoform 2 (identifier: Q9BQS2-2) [UniParc]FASTAAdd to basket

Also known as: Syt XV-b

The sequence of this isoform differs from the canonical sequence as follows:
     376-421: SQQLGRVVVGPYMYTRGRELEHWDEMLSKPKELVKRWHALCRTTEP → QATTVELFLFHLTSG

Show »
Length:390
Mass (Da):43,527
Checksum:i5FB475F7AAD147F6
GO
Isoform 3 (identifier: Q9BQS2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-71: MAEQLALVIG...QPHARTQLSR → MGVVLLPHPA...TSLREQPHGG

Show »
Length:474
Mass (Da):52,239
Checksum:i628723D4D558B350
GO
Isoform 4 (identifier: Q9BQS2-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     333-348: KTSAVLGSINPVYNET → PGPGLGEESRGSLNLK
     349-421: Missing.

Show »
Length:348
Mass (Da):38,899
Checksum:iF39977352580FEC8
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti246 – 2461Q → R in BAC85479 (PubMed:14702039).Curated
Sequence conflicti309 – 3091E → D in BAC76817 (PubMed:12788067).Curated
Sequence conflicti309 – 3091E → D in BAC76818 (PubMed:12788067).Curated
Sequence conflicti309 – 3091E → D in BAC86979 (PubMed:14702039).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 7171MAEQL…TQLSR → MGVVLLPHPAPSRREPLAPL APGTRPGWSPAVSGSSRSAL RPSTAGPGPGPGTGWGGTAA SGRWVPAPAVHCAAPRAAAG HQQHHGPPLCSPDGAPRRFK RRPGSPAPAAQTGETSLREQ PHGG in isoform 3. 1 PublicationVSP_008643Add
BLAST
Alternative sequencei333 – 34816KTSAV…VYNET → PGPGLGEESRGSLNLK in isoform 4. 1 PublicationVSP_008644Add
BLAST
Alternative sequencei349 – 42173Missing in isoform 4. 1 PublicationVSP_008645Add
BLAST
Alternative sequencei376 – 42146SQQLG…RTTEP → QATTVELFLFHLTSG in isoform 2. 2 PublicationsVSP_008646Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB109022 mRNA. Translation: BAC76817.1.
AB109023 mRNA. Translation: BAC76818.1.
AK127436 mRNA. Translation: BAC86979.1.
AK131036 mRNA. Translation: BAC85479.1.
AL356056 Genomic DNA. Translation: CAH73270.1.
AL356056 Genomic DNA. Translation: CAH73271.1.
BC139914 mRNA. Translation: AAI39915.1.
AJ303363 mRNA. Translation: CAC33885.1.
CCDSiCCDS73103.1. [Q9BQS2-1]
CCDS73104.1. [Q9BQS2-2]
RefSeqiNP_114118.2. NM_031912.4. [Q9BQS2-1]
NP_852660.1. NM_181519.2. [Q9BQS2-2]
XP_006718074.1. XM_006718011.1. [Q9BQS2-2]
XP_006718158.1. XM_006718095.2. [Q9BQS2-1]
XP_006718160.1. XM_006718097.2. [Q9BQS2-2]
UniGeneiHs.696346.

Genome annotation databases

EnsembliENST00000374321; ENSP00000363441; ENSG00000204176. [Q9BQS2-1]
ENST00000503753; ENSP00000427607; ENSG00000204176. [Q9BQS2-2]
GeneIDi102724488.
83849.
KEGGihsa:83849.
UCSCiuc001jea.4. human. [Q9BQS2-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB109022 mRNA. Translation: BAC76817.1.
AB109023 mRNA. Translation: BAC76818.1.
AK127436 mRNA. Translation: BAC86979.1.
AK131036 mRNA. Translation: BAC85479.1.
AL356056 Genomic DNA. Translation: CAH73270.1.
AL356056 Genomic DNA. Translation: CAH73271.1.
BC139914 mRNA. Translation: AAI39915.1.
AJ303363 mRNA. Translation: CAC33885.1.
CCDSiCCDS73103.1. [Q9BQS2-1]
CCDS73104.1. [Q9BQS2-2]
RefSeqiNP_114118.2. NM_031912.4. [Q9BQS2-1]
NP_852660.1. NM_181519.2. [Q9BQS2-2]
XP_006718074.1. XM_006718011.1. [Q9BQS2-2]
XP_006718158.1. XM_006718095.2. [Q9BQS2-1]
XP_006718160.1. XM_006718097.2. [Q9BQS2-2]
UniGeneiHs.696346.

3D structure databases

ProteinModelPortaliQ9BQS2.
SMRiQ9BQS2. Positions 148-415.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi123765. 1 interaction.
STRINGi9606.ENSP00000363441.

PTM databases

PhosphoSiteiQ9BQS2.

Polymorphism and mutation databases

BioMutaiSYT15.
DMDMi317373506.

Proteomic databases

MaxQBiQ9BQS2.
PaxDbiQ9BQS2.
PRIDEiQ9BQS2.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000374321; ENSP00000363441; ENSG00000204176. [Q9BQS2-1]
ENST00000503753; ENSP00000427607; ENSG00000204176. [Q9BQS2-2]
GeneIDi102724488.
83849.
KEGGihsa:83849.
UCSCiuc001jea.4. human. [Q9BQS2-1]

Organism-specific databases

CTDi83849.
GeneCardsiSYT15.
HGNCiHGNC:17167. SYT15.
HPAiHPA036971.
HPA036972.
MIMi608081. gene.
neXtProtiNX_Q9BQS2.
PharmGKBiPA134921618.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1028. Eukaryota.
ENOG410XRME. LUCA.
GeneTreeiENSGT00830000128339.
HOGENOMiHOG000273864.
HOVERGENiHBG059275.
InParanoidiQ9BQS2.
KOiK19914.
PhylomeDBiQ9BQS2.
TreeFamiTF315600.

Miscellaneous databases

NextBioi72815.
PROiQ9BQS2.
SOURCEiSearch...

Gene expression databases

BgeeiQ9BQS2.
CleanExiHS_SYT15.
ExpressionAtlasiQ9BQS2. baseline and differential.
GenevisibleiQ9BQS2. HS.

Family and domain databases

Gene3Di2.60.40.150. 2 hits.
InterProiIPR000008. C2_dom.
IPR030539. SYT15.
[Graphical view]
PANTHERiPTHR10024:SF234. PTHR10024:SF234. 1 hit.
PfamiPF00168. C2. 2 hits.
[Graphical view]
SMARTiSM00239. C2. 2 hits.
[Graphical view]
SUPFAMiSSF49562. SSF49562. 2 hits.
PROSITEiPS50004. C2. 2 hits.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Molecular cloning and characterization of human, rat, and mouse synaptotagmin XV."
    Fukuda M.
    Biochem. Biophys. Res. Commun. 306:64-71(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2).
    Tissue: Heart.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 4).
    Tissue: Cerebellum and Thalamus.
  3. "The DNA sequence and comparative analysis of human chromosome 10."
    Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J.
    , Bird C.P., Ainscough R., Almeida J.P., Ashwell R.I.S., Ambrose K.D., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Bates K., Beasley H., Bray-Allen S., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Cahill P., Camire D., Carter N.P., Chapman J.C., Clark S.Y., Clarke G., Clee C.M., Clegg S., Corby N., Coulson A., Dhami P., Dutta I., Dunn M., Faulkner L., Frankish A., Frankland J.A., Garner P., Garnett J., Gribble S., Griffiths C., Grocock R., Gustafson E., Hammond S., Harley J.L., Hart E., Heath P.D., Ho T.P., Hopkins B., Horne J., Howden P.J., Huckle E., Hynds C., Johnson C., Johnson D., Kana A., Kay M., Kimberley A.M., Kershaw J.K., Kokkinaki M., Laird G.K., Lawlor S., Lee H.M., Leongamornlert D.A., Laird G., Lloyd C., Lloyd D.M., Loveland J., Lovell J., McLaren S., McLay K.E., McMurray A., Mashreghi-Mohammadi M., Matthews L., Milne S., Nickerson T., Nguyen M., Overton-Larty E., Palmer S.A., Pearce A.V., Peck A.I., Pelan S., Phillimore B., Porter K., Rice C.M., Rogosin A., Ross M.T., Sarafidou T., Sehra H.K., Shownkeen R., Skuce C.D., Smith M., Standring L., Sycamore N., Tester J., Thorpe A., Torcasso W., Tracey A., Tromans A., Tsolas J., Wall M., Walsh J., Wang H., Weinstock K., West A.P., Willey D.L., Whitehead S.L., Wilming L., Wray P.W., Young L., Chen Y., Lovering R.C., Moschonas N.K., Siebert R., Fechtel K., Bentley D., Durbin R.M., Hubbard T., Doucette-Stamm L., Beck S., Smith D.R., Rogers J.
    Nature 429:375-381(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
  5. "Genomic analysis of synaptotagmin genes."
    Craxton M.A.
    Genomics 77:43-49(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 211-374 (ISOFORMS 1/2/3/4).
    Tissue: Brain.

Entry informationi

Entry nameiSYT15_HUMAN
AccessioniPrimary (citable) accession number: Q9BQS2
Secondary accession number(s): A5D6W8
, Q5VY53, Q5VY55, Q7Z439, Q7Z440
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 24, 2003
Last sequence update: January 11, 2011
Last modified: May 11, 2016
This is version 126 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.