Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Synaptotagmin-15

Gene

SYT15

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

May be involved in the trafficking and exocytosis of secretory vesicles in non-neuronal tissues.By similarity

GO - Molecular functioni

GO - Biological processi

Names & Taxonomyi

Protein namesi
Recommended name:
Synaptotagmin-15
Alternative name(s):
Chr10Syt
Synaptotagmin XV
Short name:
SytXV
Gene namesi
Name:SYT15
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 10

Organism-specific databases

EuPathDBiHostDB:ENSG00000204176.13
HostDB:ENSG00000277758.4
HGNCiHGNC:17167 SYT15
MIMi608081 gene
neXtProtiNX_Q9BQS2

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 4ExtracellularBy similarity4
Transmembranei5 – 29Helical; Signal-anchor for type III membrane proteinSequence analysisAdd BLAST25
Topological domaini30 – 421CytoplasmicSequence analysisAdd BLAST392

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000204176
ENSG00000277758
PharmGKBiPA134921618

Polymorphism and mutation databases

BioMutaiSYT15
DMDMi317373506

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001839801 – 421Synaptotagmin-15Add BLAST421

Proteomic databases

MaxQBiQ9BQS2
PaxDbiQ9BQS2
PeptideAtlasiQ9BQS2
PRIDEiQ9BQS2

PTM databases

iPTMnetiQ9BQS2
PhosphoSitePlusiQ9BQS2

Expressioni

Gene expression databases

BgeeiENSG00000204176
CleanExiHS_SYT15
ExpressionAtlasiQ9BQS2 baseline and differential
GenevisibleiQ9BQS2 HS

Organism-specific databases

HPAiHPA036971
HPA036972
HPA064559

Interactioni

Subunit structurei

Homodimer.By similarity

GO - Molecular functioni

Protein-protein interaction databases

BioGridi123765, 1 interactor
IntActiQ9BQS2, 1 interactor
STRINGi9606.ENSP00000363441

Structurei

3D structure databases

ProteinModelPortaliQ9BQS2
SMRiQ9BQS2
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini149 – 248C2 1PROSITE-ProRule annotationAdd BLAST100
Domaini280 – 383C2 2PROSITE-ProRule annotationAdd BLAST104

Domaini

Neither C2 domains mediates Ca2+-dependent or -independent phospholipid binding.By similarity

Sequence similaritiesi

Belongs to the synaptotagmin family.Curated

Keywords - Domaini

Repeat, Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG1028 Eukaryota
ENOG410XRME LUCA
GeneTreeiENSGT00910000144119
HOGENOMiHOG000273864
HOVERGENiHBG059275
InParanoidiQ9BQS2
KOiK19914
PhylomeDBiQ9BQS2
TreeFamiTF315600

Family and domain databases

Gene3Di2.60.40.150, 2 hits
InterProiView protein in InterPro
IPR000008 C2_dom
IPR035892 C2_domain_sf
IPR030539 SYT15
PANTHERiPTHR10024:SF234 PTHR10024:SF234, 1 hit
PfamiView protein in Pfam
PF00168 C2, 2 hits
SMARTiView protein in SMART
SM00239 C2, 2 hits
PROSITEiView protein in PROSITE
PS50004 C2, 2 hits

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9BQS2-1) [UniParc]FASTAAdd to basket
Also known as: Syt XV-a

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAEQLALVIG GTIGGLLLLL LIGASCCLWR RFCATLTYEE LPGTPAMATT
60 70 80 90 100
AASSGQRDRP CQPHARTQLS RPPAVPFVVP PTLQGRDWVP LHSGEWADAP
110 120 130 140 150
WDPCPASELL PHTSSGGLGD ACMVGAINPE LYKFPEDKSE TDFPDGCLGR
160 170 180 190 200
LWFSVEYEQE AERLLVGLIK AQHLQAPSET CSPLVKLYLL PDERRFLQSK
210 220 230 240 250
TKRKTSNPQF DEHFIFQVSS KTITQRVLKF SVYHVDRQRK HQLLGQVLFP
260 270 280 290 300
LKNETLVGDC RRVIWRDLEA ESLEPPSEFG DLQFCLSYND YLSRLTVVVL
310 320 330 340 350
RAKGLRLQED RGIVSVFVKV SLMNHNKFVK CKKTSAVLGS INPVYNETFS
360 370 380 390 400
FKADATELDT ASLSLTVVQN MEGDKSQQLG RVVVGPYMYT RGRELEHWDE
410 420
MLSKPKELVK RWHALCRTTE P
Length:421
Mass (Da):47,375
Last modified:January 11, 2011 - v3
Checksum:iAD9C6CE0957625B7
GO
Isoform 2 (identifier: Q9BQS2-2) [UniParc]FASTAAdd to basket
Also known as: Syt XV-b

The sequence of this isoform differs from the canonical sequence as follows:
     376-421: SQQLGRVVVGPYMYTRGRELEHWDEMLSKPKELVKRWHALCRTTEP → QATTVELFLFHLTSG

Show »
Length:390
Mass (Da):43,527
Checksum:i5FB475F7AAD147F6
GO
Isoform 3 (identifier: Q9BQS2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-71: MAEQLALVIG...QPHARTQLSR → MGVVLLPHPA...TSLREQPHGG

Show »
Length:474
Mass (Da):52,239
Checksum:i628723D4D558B350
GO
Isoform 4 (identifier: Q9BQS2-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     333-348: KTSAVLGSINPVYNET → PGPGLGEESRGSLNLK
     349-421: Missing.

Show »
Length:348
Mass (Da):38,899
Checksum:iF39977352580FEC8
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti246Q → R in BAC85479 (PubMed:14702039).Curated1
Sequence conflicti309E → D in BAC76817 (PubMed:12788067).Curated1
Sequence conflicti309E → D in BAC76818 (PubMed:12788067).Curated1
Sequence conflicti309E → D in BAC86979 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0086431 – 71MAEQL…TQLSR → MGVVLLPHPAPSRREPLAPL APGTRPGWSPAVSGSSRSAL RPSTAGPGPGPGTGWGGTAA SGRWVPAPAVHCAAPRAAAG HQQHHGPPLCSPDGAPRRFK RRPGSPAPAAQTGETSLREQ PHGG in isoform 3. 1 PublicationAdd BLAST71
Alternative sequenceiVSP_008644333 – 348KTSAV…VYNET → PGPGLGEESRGSLNLK in isoform 4. 1 PublicationAdd BLAST16
Alternative sequenceiVSP_008645349 – 421Missing in isoform 4. 1 PublicationAdd BLAST73
Alternative sequenceiVSP_008646376 – 421SQQLG…RTTEP → QATTVELFLFHLTSG in isoform 2. 2 PublicationsAdd BLAST46

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB109022 mRNA Translation: BAC76817.1
AB109023 mRNA Translation: BAC76818.1
AK127436 mRNA Translation: BAC86979.1
AK131036 mRNA Translation: BAC85479.1
AL356056 Genomic DNA No translation available.
BC139914 mRNA Translation: AAI39915.1
AJ303363 mRNA Translation: CAC33885.1
CCDSiCCDS73103.1 [Q9BQS2-1]
CCDS73104.1 [Q9BQS2-2]
RefSeqiNP_114118.2, NM_031912.4 [Q9BQS2-1]
NP_852660.1, NM_181519.2 [Q9BQS2-2]
XP_006718074.1, XM_006718011.1 [Q9BQS2-2]
XP_006718160.1, XM_006718097.3 [Q9BQS2-2]
XP_016872240.1, XM_017016751.1 [Q9BQS2-2]
XP_016872241.1, XM_017016752.1 [Q9BQS2-2]
XP_016872510.1, XM_017017021.1 [Q9BQS2-1]
XP_016872512.1, XM_017017023.1 [Q9BQS2-2]
UniGeneiHs.696346

Genome annotation databases

EnsembliENST00000374321; ENSP00000363441; ENSG00000204176 [Q9BQS2-1]
ENST00000503753; ENSP00000427607; ENSG00000204176 [Q9BQS2-2]
GeneIDi102724488
83849
KEGGihsa:102724488
hsa:83849
UCSCiuc001jea.4 human [Q9BQS2-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiSYT15_HUMAN
AccessioniPrimary (citable) accession number: Q9BQS2
Secondary accession number(s): A5D6W8
, Q5VY53, Q5VY55, Q7Z439, Q7Z440
Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 24, 2003
Last sequence update: January 11, 2011
Last modified: March 28, 2018
This is version 138 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health