Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9BQP9

- BPIA3_HUMAN

UniProt

Q9BQP9 - BPIA3_HUMAN

Protein

BPI fold-containing family A member 3

Gene

BPIFA3

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 93 (01 Oct 2014)
      Sequence version 3 (10 Jul 2007)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    GO - Molecular functioni

    1. lipid binding Source: InterPro

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    BPI fold-containing family A member 3
    Alternative name(s):
    Short palate, lung and nasal epithelium carcinoma-associated protein 3
    Gene namesi
    Name:BPIFA3
    Synonyms:C20orf71, SPLUNC3
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 20

    Organism-specific databases

    HGNCiHGNC:16204. BPIFA3.

    Subcellular locationi

    Secreted Curated

    GO - Cellular componenti

    1. extracellular region Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Secreted

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA25782.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 2121Sequence AnalysisAdd
    BLAST
    Chaini22 – 254233BPI fold-containing family A member 3PRO_0000017187Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi36 – 361N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi165 ↔ 209By similarity

    Keywords - PTMi

    Disulfide bond, Glycoprotein

    Proteomic databases

    PaxDbiQ9BQP9.
    PRIDEiQ9BQP9.

    PTM databases

    PhosphoSiteiQ9BQP9.

    Expressioni

    Gene expression databases

    BgeeiQ9BQP9.
    CleanExiHS_C20orf71.
    GenevestigatoriQ9BQP9.

    Organism-specific databases

    HPAiHPA062708.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9BQP9.
    SMRiQ9BQP9. Positions 94-228.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi87 – 904Poly-Gln

    Sequence similaritiesi

    Belongs to the BPI/LBP/Plunc superfamily. Plunc family.Curated

    Keywords - Domaini

    Signal

    Phylogenomic databases

    eggNOGiNOG46110.
    HOGENOMiHOG000231509.
    HOVERGENiHBG056370.
    InParanoidiQ9BQP9.
    OMAiMVGWLIG.
    OrthoDBiEOG7VTDP5.
    PhylomeDBiQ9BQP9.
    TreeFamiTF337052.

    Family and domain databases

    InterProiIPR017943. Bactericidal_perm-incr_a/b_dom.
    IPR017942. Lipid-bd_serum_glycop_N.
    [Graphical view]
    PfamiPF01273. LBP_BPI_CETP. 1 hit.
    [Graphical view]
    SUPFAMiSSF55394. SSF55394. 1 hit.

    Sequences (2)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9BQP9-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MMCPLWRLLI FLGLLALPLA PHKQPWPGLA QAHRDNKSTL ARIIAQGLIK    50
    HNAESRIQNI HFGDRLNASA QVAPGLVGWL ISGRKHQQQQ ESSINITNIQ 100
    LDCGGIQISF HKEWFSANIS LEFDLELRPS FDNNIVKMCA HMSIVVEFWL 150
    EKDEFGRRDL VIGKCDAEPS SVHVAILTEA IPPKMNQFLY NLKENLQKVL 200
    PHMVESQVCP LIGEILGQLD VKLLKSLIEQ EAAHEPTHHE TSQPSACQAG 250
    ESPS 254
    Length:254
    Mass (Da):28,436
    Last modified:July 10, 2007 - v3
    Checksum:iE03AFBE138CA073B
    GO
    Isoform 2 (identifier: Q9BQP9-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         93-129: SINITNIQLDCGGIQISFHKEWFSANISLEFDLELRP → R

    Note: No experimental confirmation available.

    Show »
    Length:218
    Mass (Da):24,360
    Checksum:iEEE6B432E6303D61
    GO

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti41 – 411A → E.
    Corresponds to variant rs17124391 [ dbSNP | Ensembl ].
    VAR_049754
    Natural varianti136 – 1361V → I.
    Corresponds to variant rs3818222 [ dbSNP | Ensembl ].
    VAR_049755

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei93 – 12937SINIT…LELRP → R in isoform 2. 1 PublicationVSP_026471Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AL121901 Genomic DNA. Translation: CAI14741.1.
    AL121901 Genomic DNA. Translation: CAI14742.1.
    BC066354 mRNA. Translation: AAH66354.1.
    CCDSiCCDS13216.2. [Q9BQP9-1]
    CCDS42865.1. [Q9BQP9-2]
    RefSeqiNP_001035904.1. NM_001042439.2. [Q9BQP9-2]
    NP_848561.2. NM_178466.4.
    UniGeneiHs.360989.

    Genome annotation databases

    EnsembliENST00000375452; ENSP00000364601; ENSG00000131059. [Q9BQP9-2]
    ENST00000375454; ENSP00000364603; ENSG00000131059. [Q9BQP9-1]
    GeneIDi128861.
    KEGGihsa:128861.
    UCSCiuc002wyr.3. human. [Q9BQP9-1]
    uc002wys.3. human. [Q9BQP9-2]

    Polymorphism databases

    DMDMi152031690.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AL121901 Genomic DNA. Translation: CAI14741.1 .
    AL121901 Genomic DNA. Translation: CAI14742.1 .
    BC066354 mRNA. Translation: AAH66354.1 .
    CCDSi CCDS13216.2. [Q9BQP9-1 ]
    CCDS42865.1. [Q9BQP9-2 ]
    RefSeqi NP_001035904.1. NM_001042439.2. [Q9BQP9-2 ]
    NP_848561.2. NM_178466.4.
    UniGenei Hs.360989.

    3D structure databases

    ProteinModelPortali Q9BQP9.
    SMRi Q9BQP9. Positions 94-228.
    ModBasei Search...
    MobiDBi Search...

    PTM databases

    PhosphoSitei Q9BQP9.

    Polymorphism databases

    DMDMi 152031690.

    Proteomic databases

    PaxDbi Q9BQP9.
    PRIDEi Q9BQP9.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000375452 ; ENSP00000364601 ; ENSG00000131059 . [Q9BQP9-2 ]
    ENST00000375454 ; ENSP00000364603 ; ENSG00000131059 . [Q9BQP9-1 ]
    GeneIDi 128861.
    KEGGi hsa:128861.
    UCSCi uc002wyr.3. human. [Q9BQP9-1 ]
    uc002wys.3. human. [Q9BQP9-2 ]

    Organism-specific databases

    CTDi 128861.
    GeneCardsi GC20P031806.
    HGNCi HGNC:16204. BPIFA3.
    HPAi HPA062708.
    neXtProti NX_Q9BQP9.
    PharmGKBi PA25782.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG46110.
    HOGENOMi HOG000231509.
    HOVERGENi HBG056370.
    InParanoidi Q9BQP9.
    OMAi MVGWLIG.
    OrthoDBi EOG7VTDP5.
    PhylomeDBi Q9BQP9.
    TreeFami TF337052.

    Miscellaneous databases

    GenomeRNAii 128861.
    NextBioi 82490.
    PROi Q9BQP9.

    Gene expression databases

    Bgeei Q9BQP9.
    CleanExi HS_C20orf71.
    Genevestigatori Q9BQP9.

    Family and domain databases

    InterProi IPR017943. Bactericidal_perm-incr_a/b_dom.
    IPR017942. Lipid-bd_serum_glycop_N.
    [Graphical view ]
    Pfami PF01273. LBP_BPI_CETP. 1 hit.
    [Graphical view ]
    SUPFAMi SSF55394. SSF55394. 1 hit.
    ProtoNeti Search...

    Publicationsi

    1. "The DNA sequence and comparative analysis of human chromosome 20."
      Deloukas P., Matthews L.H., Ashurst J.L., Burton J., Gilbert J.G.R., Jones M., Stavrides G., Almeida J.P., Babbage A.K., Bagguley C.L., Bailey J., Barlow K.F., Bates K.N., Beard L.M., Beare D.M., Beasley O.P., Bird C.P., Blakey S.E.
      , Bridgeman A.M., Brown A.J., Buck D., Burrill W.D., Butler A.P., Carder C., Carter N.P., Chapman J.C., Clamp M., Clark G., Clark L.N., Clark S.Y., Clee C.M., Clegg S., Cobley V.E., Collier R.E., Connor R.E., Corby N.R., Coulson A., Coville G.J., Deadman R., Dhami P.D., Dunn M., Ellington A.G., Frankland J.A., Fraser A., French L., Garner P., Grafham D.V., Griffiths C., Griffiths M.N.D., Gwilliam R., Hall R.E., Hammond S., Harley J.L., Heath P.D., Ho S., Holden J.L., Howden P.J., Huckle E., Hunt A.R., Hunt S.E., Jekosch K., Johnson C.M., Johnson D., Kay M.P., Kimberley A.M., King A., Knights A., Laird G.K., Lawlor S., Lehvaeslaiho M.H., Leversha M.A., Lloyd C., Lloyd D.M., Lovell J.D., Marsh V.L., Martin S.L., McConnachie L.J., McLay K., McMurray A.A., Milne S.A., Mistry D., Moore M.J.F., Mullikin J.C., Nickerson T., Oliver K., Parker A., Patel R., Pearce T.A.V., Peck A.I., Phillimore B.J.C.T., Prathalingam S.R., Plumb R.W., Ramsay H., Rice C.M., Ross M.T., Scott C.E., Sehra H.K., Shownkeen R., Sims S., Skuce C.D., Smith M.L., Soderlund C., Steward C.A., Sulston J.E., Swann R.M., Sycamore N., Taylor R., Tee L., Thomas D.W., Thorpe A., Tracey A., Tromans A.C., Vaudin M., Wall M., Wallis J.M., Whitehead S.L., Whittaker P., Willey D.L., Williams L., Williams S.A., Wilming L., Wray P.W., Hubbard T., Durbin R.M., Bentley D.R., Beck S., Rogers J.
      Nature 414:865-871(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Testis.

    Entry informationi

    Entry nameiBPIA3_HUMAN
    AccessioniPrimary (citable) accession number: Q9BQP9
    Secondary accession number(s): Q5JWG8, Q6NZ38
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: October 10, 2002
    Last sequence update: July 10, 2007
    Last modified: October 1, 2014
    This is version 93 of the entry and version 3 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 20
      Human chromosome 20: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3