Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9BQP9 (BPIA3_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 92. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (4) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
BPI fold-containing family A member 3
Alternative name(s):
Short palate, lung and nasal epithelium carcinoma-associated protein 3
Gene names
Name:BPIFA3
Synonyms:C20orf71, SPLUNC3
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length254 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at transcript level

General annotation (Comments)

Subcellular location

Secreted Potential.

Sequence similarities

Belongs to the BPI/LBP/Plunc superfamily. Plunc family.

Ontologies

Keywords
   Cellular componentSecreted
   Coding sequence diversityAlternative splicing
Polymorphism
   DomainSignal
   PTMDisulfide bond
Glycoprotein
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Cellular_componentextracellular region

Inferred from electronic annotation. Source: UniProtKB-SubCell

   Molecular_functionlipid binding

Inferred from electronic annotation. Source: InterPro

Complete GO annotation...

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q9BQP9-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q9BQP9-2)

The sequence of this isoform differs from the canonical sequence as follows:
     93-129: SINITNIQLDCGGIQISFHKEWFSANISLEFDLELRP → R
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Signal peptide1 – 2121 Potential
Chain22 – 254233BPI fold-containing family A member 3
PRO_0000017187

Regions

Compositional bias87 – 904Poly-Gln

Amino acid modifications

Glycosylation361N-linked (GlcNAc...) Potential
Disulfide bond165 ↔ 209 By similarity

Natural variations

Alternative sequence93 – 12937SINIT…LELRP → R in isoform 2.
VSP_026471
Natural variant411A → E.
Corresponds to variant rs17124391 [ dbSNP | Ensembl ].
VAR_049754
Natural variant1361V → I.
Corresponds to variant rs3818222 [ dbSNP | Ensembl ].
VAR_049755

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified July 10, 2007. Version 3.
Checksum: E03AFBE138CA073B

FASTA25428,436
        10         20         30         40         50         60 
MMCPLWRLLI FLGLLALPLA PHKQPWPGLA QAHRDNKSTL ARIIAQGLIK HNAESRIQNI 

        70         80         90        100        110        120 
HFGDRLNASA QVAPGLVGWL ISGRKHQQQQ ESSINITNIQ LDCGGIQISF HKEWFSANIS 

       130        140        150        160        170        180 
LEFDLELRPS FDNNIVKMCA HMSIVVEFWL EKDEFGRRDL VIGKCDAEPS SVHVAILTEA 

       190        200        210        220        230        240 
IPPKMNQFLY NLKENLQKVL PHMVESQVCP LIGEILGQLD VKLLKSLIEQ EAAHEPTHHE 

       250 
TSQPSACQAG ESPS 

« Hide

Isoform 2 [UniParc].

Checksum: EEE6B432E6303D61
Show »

FASTA21824,360

References

[1]"The DNA sequence and comparative analysis of human chromosome 20."
Deloukas P., Matthews L.H., Ashurst J.L., Burton J., Gilbert J.G.R., Jones M., Stavrides G., Almeida J.P., Babbage A.K., Bagguley C.L., Bailey J., Barlow K.F., Bates K.N., Beard L.M., Beare D.M., Beasley O.P., Bird C.P., Blakey S.E. expand/collapse author list , Bridgeman A.M., Brown A.J., Buck D., Burrill W.D., Butler A.P., Carder C., Carter N.P., Chapman J.C., Clamp M., Clark G., Clark L.N., Clark S.Y., Clee C.M., Clegg S., Cobley V.E., Collier R.E., Connor R.E., Corby N.R., Coulson A., Coville G.J., Deadman R., Dhami P.D., Dunn M., Ellington A.G., Frankland J.A., Fraser A., French L., Garner P., Grafham D.V., Griffiths C., Griffiths M.N.D., Gwilliam R., Hall R.E., Hammond S., Harley J.L., Heath P.D., Ho S., Holden J.L., Howden P.J., Huckle E., Hunt A.R., Hunt S.E., Jekosch K., Johnson C.M., Johnson D., Kay M.P., Kimberley A.M., King A., Knights A., Laird G.K., Lawlor S., Lehvaeslaiho M.H., Leversha M.A., Lloyd C., Lloyd D.M., Lovell J.D., Marsh V.L., Martin S.L., McConnachie L.J., McLay K., McMurray A.A., Milne S.A., Mistry D., Moore M.J.F., Mullikin J.C., Nickerson T., Oliver K., Parker A., Patel R., Pearce T.A.V., Peck A.I., Phillimore B.J.C.T., Prathalingam S.R., Plumb R.W., Ramsay H., Rice C.M., Ross M.T., Scott C.E., Sehra H.K., Shownkeen R., Sims S., Skuce C.D., Smith M.L., Soderlund C., Steward C.A., Sulston J.E., Swann R.M., Sycamore N., Taylor R., Tee L., Thomas D.W., Thorpe A., Tracey A., Tromans A.C., Vaudin M., Wall M., Wallis J.M., Whitehead S.L., Whittaker P., Willey D.L., Williams L., Williams S.A., Wilming L., Wray P.W., Hubbard T., Durbin R.M., Bentley D.R., Beck S., Rogers J.
Nature 414:865-871(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[2]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
Tissue: Testis.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AL121901 Genomic DNA. Translation: CAI14741.1.
AL121901 Genomic DNA. Translation: CAI14742.1.
BC066354 mRNA. Translation: AAH66354.1.
CCDSCCDS13216.2. [Q9BQP9-1]
CCDS42865.1. [Q9BQP9-2]
RefSeqNP_001035904.1. NM_001042439.2. [Q9BQP9-2]
NP_848561.2. NM_178466.4.
UniGeneHs.360989.

3D structure databases

ProteinModelPortalQ9BQP9.
SMRQ9BQP9. Positions 94-228.
ModBaseSearch...
MobiDBSearch...

PTM databases

PhosphoSiteQ9BQP9.

Polymorphism databases

DMDM152031690.

Proteomic databases

PaxDbQ9BQP9.
PRIDEQ9BQP9.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000375452; ENSP00000364601; ENSG00000131059. [Q9BQP9-2]
ENST00000375454; ENSP00000364603; ENSG00000131059. [Q9BQP9-1]
GeneID128861.
KEGGhsa:128861.
UCSCuc002wyr.3. human. [Q9BQP9-1]
uc002wys.3. human. [Q9BQP9-2]

Organism-specific databases

CTD128861.
GeneCardsGC20P031806.
HGNCHGNC:16204. BPIFA3.
HPAHPA062708.
neXtProtNX_Q9BQP9.
PharmGKBPA25782.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG46110.
HOGENOMHOG000231509.
HOVERGENHBG056370.
InParanoidQ9BQP9.
OMAMVGWLIG.
OrthoDBEOG7VTDP5.
PhylomeDBQ9BQP9.
TreeFamTF337052.

Gene expression databases

BgeeQ9BQP9.
CleanExHS_C20orf71.
GenevestigatorQ9BQP9.

Family and domain databases

InterProIPR017943. Bactericidal_perm-incr_a/b_dom.
IPR017942. Lipid-bd_serum_glycop_N.
[Graphical view]
PfamPF01273. LBP_BPI_CETP. 1 hit.
[Graphical view]
SUPFAMSSF55394. SSF55394. 1 hit.
ProtoNetSearch...

Other

GenomeRNAi128861.
NextBio82490.
PROQ9BQP9.

Entry information

Entry nameBPIA3_HUMAN
AccessionPrimary (citable) accession number: Q9BQP9
Secondary accession number(s): Q5JWG8, Q6NZ38
Entry history
Integrated into UniProtKB/Swiss-Prot: October 10, 2002
Last sequence update: July 10, 2007
Last modified: July 9, 2014
This is version 92 of the entry and version 3 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 20

Human chromosome 20: entries, gene names and cross-references to MIM