Q9BQP9 (BPIA3_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 82.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: BPI fold-containing family A member 3 Alternative name(s): Short palate, lung and nasal epithelium carcinoma-associated protein 3 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 254 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Subcellular location | Secreted Potential. |
| Sequence similarities | Belongs to the BPI/LBP/Plunc superfamily. Plunc family. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Secreted |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Signal |
| PTM | Glycoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular_component | extracellular region Inferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular_function | lipid binding Inferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9BQP9-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9BQP9-2) The sequence of this isoform differs from the canonical sequence as follows: 93-129: SINITNIQLDCGGIQISFHKEWFSANISLEFDLELRP → R | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 21 | 21 | Potential | ||||||
| Chain | 22 – 254 | 233 | BPI fold-containing family A member 3 | PRO_0000017187 | |||||
Regions | |||||||||
| Compositional bias | 87 – 90 | 4 | Poly-Gln | ||||||
Amino acid modifications | |||||||||
| Glycosylation | 36 | 1 | N-linked (GlcNAc...) Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 93 – 129 | 37 | SINIT…LELRP → R in isoform 2. | VSP_026471 | |||||
| Natural variant | 41 | 1 | A → E. Corresponds to variant rs17124391 [ dbSNP | Ensembl ]. | VAR_049754 | |||||
| Natural variant | 136 | 1 | V → I. Corresponds to variant rs3818222 [ dbSNP | Ensembl ]. | VAR_049755 | |||||
Sequences
| ||||||||||||||||||||||||
References
| [1] | "The DNA sequence and comparative analysis of human chromosome 20." Deloukas P., Matthews L.H., Ashurst J.L., Burton J., Gilbert J.G.R., Jones M., Stavrides G., Almeida J.P., Babbage A.K., Bagguley C.L., Bailey J., Barlow K.F., Bates K.N., Beard L.M., Beare D.M., Beasley O.P., Bird C.P., Blakey S.E. Rogers J.Nature 414:865-871(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [2] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Testis. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AL121901 Genomic DNA. Translation: CAI14741.1. AL121901 Genomic DNA. Translation: CAI14742.1. BC066354 mRNA. Translation: AAH66354.1. |
| IPI | IPI00150189. IPI00433811. |
| RefSeq | NP_001035904.1. NM_001042439.1. NP_848561.2. NM_178466.3. |
| UniGene | Hs.360989. |
3D structure databases | |
| ProteinModelPortal | Q9BQP9. |
| ModBase | Search... |
PTM databases | |
| PhosphoSite | Q9BQP9. |
Polymorphism databases | |
| DMDM | 152031690. |
Proteomic databases | |
| PaxDb | Q9BQP9. |
| PRIDE | Q9BQP9. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000375452; ENSP00000364601; ENSG00000131059. ENST00000375454; ENSP00000364603; ENSG00000131059. |
| GeneID | 128861. |
| KEGG | hsa:128861. |
| UCSC | uc002wyr.3. human. uc002wys.3. human. |
Organism-specific databases | |
| CTD | 128861. |
| GeneCards | GC20P031806. |
| HGNC | HGNC:16204. BPIFA3. |
| neXtProt | NX_Q9BQP9. |
| PharmGKB | PA25782. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG46110. |
| HOGENOM | HOG000231509. |
| HOVERGEN | HBG056370. |
| InParanoid | Q9BQP9. |
| OMA | MVGWLIG. |
| OrthoDB | EOG4CNQS7. |
Gene expression databases | |
| Bgee | Q9BQP9. |
| CleanEx | HS_C20orf71. |
| Genevestigator | Q9BQP9. |
| GermOnline | ENSG00000131059. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR017943. Bactericidal_perm-incr_a/b_dom. IPR017942. Lipid-bd_serum_glycop_N. [Graphical view] |
| Pfam | PF01273. LBP_BPI_CETP. 1 hit. [Graphical view] |
| SUPFAM | SSF55394. Bactericidal_perm-incr_a/b_dom. 1 hit. |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 128861. |
| NextBio | 82490. |
Entry information
| Entry name | BPIA3_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9BQP9 Secondary accession number(s): Q5JWG8, Q6NZ38 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 20 Human chromosome 20: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| SIMILARITY comments Index of protein domains and families |

Clusters with
