Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

BPI fold-containing family A member 3

Gene

BPIFA3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at transcript leveli

Functioni

GO - Molecular functioni

Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
BPI fold-containing family A member 3
Alternative name(s):
Short palate, lung and nasal epithelium carcinoma-associated protein 3
Gene namesi
Name:BPIFA3
Synonyms:C20orf71, SPLUNC3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640 Componenti: Chromosome 20

Organism-specific databases

HGNCiHGNC:16204. BPIFA3.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Secreted

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA25782.

Polymorphism and mutation databases

BioMutaiBPIFA3.
DMDMi152031690.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2121Sequence AnalysisAdd
BLAST
Chaini22 – 254233BPI fold-containing family A member 3PRO_0000017187Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi36 – 361N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi165 ↔ 209By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiQ9BQP9.
PRIDEiQ9BQP9.

PTM databases

PhosphoSiteiQ9BQP9.

Expressioni

Gene expression databases

BgeeiQ9BQP9.
CleanExiHS_C20orf71.
GenevestigatoriQ9BQP9.

Organism-specific databases

HPAiHPA062708.

Structurei

3D structure databases

ProteinModelPortaliQ9BQP9.
SMRiQ9BQP9. Positions 94-228.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi87 – 904Poly-Gln

Sequence similaritiesi

Belongs to the BPI/LBP/Plunc superfamily. Plunc family.Curated

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiNOG46110.
GeneTreeiENSGT00720000108820.
HOGENOMiHOG000231509.
HOVERGENiHBG056370.
InParanoidiQ9BQP9.
OMAiMVGWLIG.
OrthoDBiEOG7VTDP5.
PhylomeDBiQ9BQP9.
TreeFamiTF337052.

Family and domain databases

InterProiIPR017943. Bactericidal_perm-incr_a/b_dom.
IPR017942. Lipid-bd_serum_glycop_N.
[Graphical view]
PfamiPF01273. LBP_BPI_CETP. 1 hit.
[Graphical view]
SUPFAMiSSF55394. SSF55394. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9BQP9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MMCPLWRLLI FLGLLALPLA PHKQPWPGLA QAHRDNKSTL ARIIAQGLIK
60 70 80 90 100
HNAESRIQNI HFGDRLNASA QVAPGLVGWL ISGRKHQQQQ ESSINITNIQ
110 120 130 140 150
LDCGGIQISF HKEWFSANIS LEFDLELRPS FDNNIVKMCA HMSIVVEFWL
160 170 180 190 200
EKDEFGRRDL VIGKCDAEPS SVHVAILTEA IPPKMNQFLY NLKENLQKVL
210 220 230 240 250
PHMVESQVCP LIGEILGQLD VKLLKSLIEQ EAAHEPTHHE TSQPSACQAG

ESPS
Length:254
Mass (Da):28,436
Last modified:July 10, 2007 - v3
Checksum:iE03AFBE138CA073B
GO
Isoform 2 (identifier: Q9BQP9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     93-129: SINITNIQLDCGGIQISFHKEWFSANISLEFDLELRP → R

Note: No experimental confirmation available.

Show »
Length:218
Mass (Da):24,360
Checksum:iEEE6B432E6303D61
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti41 – 411A → E.
Corresponds to variant rs17124391 [ dbSNP | Ensembl ].
VAR_049754
Natural varianti136 – 1361V → I.
Corresponds to variant rs3818222 [ dbSNP | Ensembl ].
VAR_049755

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei93 – 12937SINIT…LELRP → R in isoform 2. 1 PublicationVSP_026471Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL121901 Genomic DNA. Translation: CAI14741.1.
AL121901 Genomic DNA. Translation: CAI14742.1.
BC066354 mRNA. Translation: AAH66354.1.
CCDSiCCDS13216.2. [Q9BQP9-1]
CCDS42865.1. [Q9BQP9-2]
RefSeqiNP_001035904.1. NM_001042439.2. [Q9BQP9-2]
NP_848561.2. NM_178466.4.
UniGeneiHs.360989.

Genome annotation databases

EnsembliENST00000375452; ENSP00000364601; ENSG00000131059. [Q9BQP9-2]
ENST00000375454; ENSP00000364603; ENSG00000131059. [Q9BQP9-1]
GeneIDi128861.
KEGGihsa:128861.
UCSCiuc002wyr.3. human. [Q9BQP9-1]
uc002wys.3. human. [Q9BQP9-2]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL121901 Genomic DNA. Translation: CAI14741.1.
AL121901 Genomic DNA. Translation: CAI14742.1.
BC066354 mRNA. Translation: AAH66354.1.
CCDSiCCDS13216.2. [Q9BQP9-1]
CCDS42865.1. [Q9BQP9-2]
RefSeqiNP_001035904.1. NM_001042439.2. [Q9BQP9-2]
NP_848561.2. NM_178466.4.
UniGeneiHs.360989.

3D structure databases

ProteinModelPortaliQ9BQP9.
SMRiQ9BQP9. Positions 94-228.
ModBaseiSearch...
MobiDBiSearch...

PTM databases

PhosphoSiteiQ9BQP9.

Polymorphism and mutation databases

BioMutaiBPIFA3.
DMDMi152031690.

Proteomic databases

PaxDbiQ9BQP9.
PRIDEiQ9BQP9.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000375452; ENSP00000364601; ENSG00000131059. [Q9BQP9-2]
ENST00000375454; ENSP00000364603; ENSG00000131059. [Q9BQP9-1]
GeneIDi128861.
KEGGihsa:128861.
UCSCiuc002wyr.3. human. [Q9BQP9-1]
uc002wys.3. human. [Q9BQP9-2]

Organism-specific databases

CTDi128861.
GeneCardsiGC20P031806.
HGNCiHGNC:16204. BPIFA3.
HPAiHPA062708.
neXtProtiNX_Q9BQP9.
PharmGKBiPA25782.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiNOG46110.
GeneTreeiENSGT00720000108820.
HOGENOMiHOG000231509.
HOVERGENiHBG056370.
InParanoidiQ9BQP9.
OMAiMVGWLIG.
OrthoDBiEOG7VTDP5.
PhylomeDBiQ9BQP9.
TreeFamiTF337052.

Miscellaneous databases

GenomeRNAii128861.
NextBioi82490.
PROiQ9BQP9.

Gene expression databases

BgeeiQ9BQP9.
CleanExiHS_C20orf71.
GenevestigatoriQ9BQP9.

Family and domain databases

InterProiIPR017943. Bactericidal_perm-incr_a/b_dom.
IPR017942. Lipid-bd_serum_glycop_N.
[Graphical view]
PfamiPF01273. LBP_BPI_CETP. 1 hit.
[Graphical view]
SUPFAMiSSF55394. SSF55394. 1 hit.
ProtoNetiSearch...

Publicationsi

  1. "The DNA sequence and comparative analysis of human chromosome 20."
    Deloukas P., Matthews L.H., Ashurst J.L., Burton J., Gilbert J.G.R., Jones M., Stavrides G., Almeida J.P., Babbage A.K., Bagguley C.L., Bailey J., Barlow K.F., Bates K.N., Beard L.M., Beare D.M., Beasley O.P., Bird C.P., Blakey S.E.
    , Bridgeman A.M., Brown A.J., Buck D., Burrill W.D., Butler A.P., Carder C., Carter N.P., Chapman J.C., Clamp M., Clark G., Clark L.N., Clark S.Y., Clee C.M., Clegg S., Cobley V.E., Collier R.E., Connor R.E., Corby N.R., Coulson A., Coville G.J., Deadman R., Dhami P.D., Dunn M., Ellington A.G., Frankland J.A., Fraser A., French L., Garner P., Grafham D.V., Griffiths C., Griffiths M.N.D., Gwilliam R., Hall R.E., Hammond S., Harley J.L., Heath P.D., Ho S., Holden J.L., Howden P.J., Huckle E., Hunt A.R., Hunt S.E., Jekosch K., Johnson C.M., Johnson D., Kay M.P., Kimberley A.M., King A., Knights A., Laird G.K., Lawlor S., Lehvaeslaiho M.H., Leversha M.A., Lloyd C., Lloyd D.M., Lovell J.D., Marsh V.L., Martin S.L., McConnachie L.J., McLay K., McMurray A.A., Milne S.A., Mistry D., Moore M.J.F., Mullikin J.C., Nickerson T., Oliver K., Parker A., Patel R., Pearce T.A.V., Peck A.I., Phillimore B.J.C.T., Prathalingam S.R., Plumb R.W., Ramsay H., Rice C.M., Ross M.T., Scott C.E., Sehra H.K., Shownkeen R., Sims S., Skuce C.D., Smith M.L., Soderlund C., Steward C.A., Sulston J.E., Swann R.M., Sycamore N., Taylor R., Tee L., Thomas D.W., Thorpe A., Tracey A., Tromans A.C., Vaudin M., Wall M., Wallis J.M., Whitehead S.L., Whittaker P., Willey D.L., Williams L., Williams S.A., Wilming L., Wray P.W., Hubbard T., Durbin R.M., Bentley D.R., Beck S., Rogers J.
    Nature 414:865-871(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Testis.

Entry informationi

Entry nameiBPIA3_HUMAN
AccessioniPrimary (citable) accession number: Q9BQP9
Secondary accession number(s): Q5JWG8, Q6NZ38
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 10, 2002
Last sequence update: July 10, 2007
Last modified: May 27, 2015
This is version 98 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 20
    Human chromosome 20: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.