Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

BPI fold-containing family A member 3

Gene

BPIFA3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at transcript leveli

Functioni

GO - Molecular functioni

Complete GO annotation...

Enzyme and pathway databases

BioCyciZFISH:ENSG00000131059-MONOMER.

Names & Taxonomyi

Protein namesi
Recommended name:
BPI fold-containing family A member 3
Alternative name(s):
Short palate, lung and nasal epithelium carcinoma-associated protein 3
Gene namesi
Name:BPIFA3
Synonyms:C20orf71, SPLUNC3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 20

Organism-specific databases

HGNCiHGNC:16204. BPIFA3.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Secreted

Pathology & Biotechi

Organism-specific databases

DisGeNETi128861.
OpenTargetsiENSG00000131059.
PharmGKBiPA25782.

Polymorphism and mutation databases

BioMutaiBPIFA3.
DMDMi152031690.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 21Sequence analysisAdd BLAST21
ChainiPRO_000001718722 – 254BPI fold-containing family A member 3Add BLAST233

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi36N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi165 ↔ 209By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

MaxQBiQ9BQP9.
PaxDbiQ9BQP9.
PeptideAtlasiQ9BQP9.
PRIDEiQ9BQP9.

Expressioni

Gene expression databases

BgeeiENSG00000131059.
CleanExiHS_C20orf71.
GenevisibleiQ9BQP9. HS.

Organism-specific databases

HPAiHPA062708.

Interactioni

Protein-protein interaction databases

STRINGi9606.ENSP00000364603.

Structurei

3D structure databases

ProteinModelPortaliQ9BQP9.
SMRiQ9BQP9.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi87 – 90Poly-Gln4

Sequence similaritiesi

Belongs to the BPI/LBP/Plunc superfamily. Plunc family.Curated

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiENOG410IES4. Eukaryota.
ENOG41119VF. LUCA.
GeneTreeiENSGT00840000129898.
HOGENOMiHOG000231509.
HOVERGENiHBG056370.
InParanoidiQ9BQP9.
OMAiHKEWFSA.
OrthoDBiEOG091G0K2Z.
PhylomeDBiQ9BQP9.
TreeFamiTF337052.

Family and domain databases

InterProiIPR017943. Bactericidal_perm-incr_a/b_dom.
IPR032942. BPI/LBP/Plunc.
IPR032946. Bpifa3.
IPR017942. Lipid-bd_serum_glycop_N.
[Graphical view]
PANTHERiPTHR10504. PTHR10504. 1 hit.
PTHR10504:SF85. PTHR10504:SF85. 1 hit.
PfamiPF01273. LBP_BPI_CETP. 1 hit.
[Graphical view]
SUPFAMiSSF55394. SSF55394. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9BQP9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MMCPLWRLLI FLGLLALPLA PHKQPWPGLA QAHRDNKSTL ARIIAQGLIK
60 70 80 90 100
HNAESRIQNI HFGDRLNASA QVAPGLVGWL ISGRKHQQQQ ESSINITNIQ
110 120 130 140 150
LDCGGIQISF HKEWFSANIS LEFDLELRPS FDNNIVKMCA HMSIVVEFWL
160 170 180 190 200
EKDEFGRRDL VIGKCDAEPS SVHVAILTEA IPPKMNQFLY NLKENLQKVL
210 220 230 240 250
PHMVESQVCP LIGEILGQLD VKLLKSLIEQ EAAHEPTHHE TSQPSACQAG

ESPS
Length:254
Mass (Da):28,436
Last modified:July 10, 2007 - v3
Checksum:iE03AFBE138CA073B
GO
Isoform 2 (identifier: Q9BQP9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     93-129: SINITNIQLDCGGIQISFHKEWFSANISLEFDLELRP → R

Note: No experimental confirmation available.
Show »
Length:218
Mass (Da):24,360
Checksum:iEEE6B432E6303D61
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_04975441A → E.Corresponds to variant rs17124391dbSNPEnsembl.1
Natural variantiVAR_049755136V → I.Corresponds to variant rs3818222dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_02647193 – 129SINIT…LELRP → R in isoform 2. 1 PublicationAdd BLAST37

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL121901 Genomic DNA. Translation: CAI14741.1.
AL121901 Genomic DNA. Translation: CAI14742.1.
BC066354 mRNA. Translation: AAH66354.1.
CCDSiCCDS13216.2. [Q9BQP9-1]
CCDS42865.1. [Q9BQP9-2]
RefSeqiNP_001035904.1. NM_001042439.2. [Q9BQP9-2]
NP_848561.2. NM_178466.4.
UniGeneiHs.360989.

Genome annotation databases

EnsembliENST00000375452; ENSP00000364601; ENSG00000131059. [Q9BQP9-2]
ENST00000375454; ENSP00000364603; ENSG00000131059. [Q9BQP9-1]
GeneIDi128861.
KEGGihsa:128861.
UCSCiuc002wyr.5. human. [Q9BQP9-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL121901 Genomic DNA. Translation: CAI14741.1.
AL121901 Genomic DNA. Translation: CAI14742.1.
BC066354 mRNA. Translation: AAH66354.1.
CCDSiCCDS13216.2. [Q9BQP9-1]
CCDS42865.1. [Q9BQP9-2]
RefSeqiNP_001035904.1. NM_001042439.2. [Q9BQP9-2]
NP_848561.2. NM_178466.4.
UniGeneiHs.360989.

3D structure databases

ProteinModelPortaliQ9BQP9.
SMRiQ9BQP9.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi9606.ENSP00000364603.

Polymorphism and mutation databases

BioMutaiBPIFA3.
DMDMi152031690.

Proteomic databases

MaxQBiQ9BQP9.
PaxDbiQ9BQP9.
PeptideAtlasiQ9BQP9.
PRIDEiQ9BQP9.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000375452; ENSP00000364601; ENSG00000131059. [Q9BQP9-2]
ENST00000375454; ENSP00000364603; ENSG00000131059. [Q9BQP9-1]
GeneIDi128861.
KEGGihsa:128861.
UCSCiuc002wyr.5. human. [Q9BQP9-1]

Organism-specific databases

CTDi128861.
DisGeNETi128861.
GeneCardsiBPIFA3.
HGNCiHGNC:16204. BPIFA3.
HPAiHPA062708.
neXtProtiNX_Q9BQP9.
OpenTargetsiENSG00000131059.
PharmGKBiPA25782.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IES4. Eukaryota.
ENOG41119VF. LUCA.
GeneTreeiENSGT00840000129898.
HOGENOMiHOG000231509.
HOVERGENiHBG056370.
InParanoidiQ9BQP9.
OMAiHKEWFSA.
OrthoDBiEOG091G0K2Z.
PhylomeDBiQ9BQP9.
TreeFamiTF337052.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000131059-MONOMER.

Miscellaneous databases

GenomeRNAii128861.
PROiQ9BQP9.

Gene expression databases

BgeeiENSG00000131059.
CleanExiHS_C20orf71.
GenevisibleiQ9BQP9. HS.

Family and domain databases

InterProiIPR017943. Bactericidal_perm-incr_a/b_dom.
IPR032942. BPI/LBP/Plunc.
IPR032946. Bpifa3.
IPR017942. Lipid-bd_serum_glycop_N.
[Graphical view]
PANTHERiPTHR10504. PTHR10504. 1 hit.
PTHR10504:SF85. PTHR10504:SF85. 1 hit.
PfamiPF01273. LBP_BPI_CETP. 1 hit.
[Graphical view]
SUPFAMiSSF55394. SSF55394. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiBPIA3_HUMAN
AccessioniPrimary (citable) accession number: Q9BQP9
Secondary accession number(s): Q5JWG8, Q6NZ38
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 10, 2002
Last sequence update: July 10, 2007
Last modified: November 2, 2016
This is version 111 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 20
    Human chromosome 20: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.