SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9BQP9

- BPIA3_HUMAN

UniProt

Q9BQP9 - BPIA3_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

BPI fold-containing family A member 3

Gene
BPIFA3, C20orf71, SPLUNC3
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5 - Experimental evidence at transcript leveli

Functioni

GO - Molecular functioni

  1. lipid binding Source: InterPro
Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
BPI fold-containing family A member 3
Alternative name(s):
Short palate, lung and nasal epithelium carcinoma-associated protein 3
Gene namesi
Name:BPIFA3
Synonyms:C20orf71, SPLUNC3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 20

Organism-specific databases

HGNCiHGNC:16204. BPIFA3.

Subcellular locationi

Secreted Reviewed prediction

GO - Cellular componenti

  1. extracellular region Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Secreted

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA25782.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2121 Reviewed predictionAdd
BLAST
Chaini22 – 254233BPI fold-containing family A member 3PRO_0000017187Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi36 – 361N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi165 ↔ 209 By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiQ9BQP9.
PRIDEiQ9BQP9.

PTM databases

PhosphoSiteiQ9BQP9.

Expressioni

Gene expression databases

BgeeiQ9BQP9.
CleanExiHS_C20orf71.
GenevestigatoriQ9BQP9.

Organism-specific databases

HPAiHPA062708.

Structurei

3D structure databases

ProteinModelPortaliQ9BQP9.
SMRiQ9BQP9. Positions 94-228.

Family & Domainsi

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi87 – 904Poly-Gln

Sequence similaritiesi

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiNOG46110.
HOGENOMiHOG000231509.
HOVERGENiHBG056370.
InParanoidiQ9BQP9.
OMAiMVGWLIG.
OrthoDBiEOG7VTDP5.
PhylomeDBiQ9BQP9.
TreeFamiTF337052.

Family and domain databases

InterProiIPR017943. Bactericidal_perm-incr_a/b_dom.
IPR017942. Lipid-bd_serum_glycop_N.
[Graphical view]
PfamiPF01273. LBP_BPI_CETP. 1 hit.
[Graphical view]
SUPFAMiSSF55394. SSF55394. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9BQP9-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MMCPLWRLLI FLGLLALPLA PHKQPWPGLA QAHRDNKSTL ARIIAQGLIK    50
HNAESRIQNI HFGDRLNASA QVAPGLVGWL ISGRKHQQQQ ESSINITNIQ 100
LDCGGIQISF HKEWFSANIS LEFDLELRPS FDNNIVKMCA HMSIVVEFWL 150
EKDEFGRRDL VIGKCDAEPS SVHVAILTEA IPPKMNQFLY NLKENLQKVL 200
PHMVESQVCP LIGEILGQLD VKLLKSLIEQ EAAHEPTHHE TSQPSACQAG 250
ESPS 254
Length:254
Mass (Da):28,436
Last modified:July 10, 2007 - v3
Checksum:iE03AFBE138CA073B
GO
Isoform 2 (identifier: Q9BQP9-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     93-129: SINITNIQLDCGGIQISFHKEWFSANISLEFDLELRP → R

Note: No experimental confirmation available.

Show »
Length:218
Mass (Da):24,360
Checksum:iEEE6B432E6303D61
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti41 – 411A → E.
Corresponds to variant rs17124391 [ dbSNP | Ensembl ].
VAR_049754
Natural varianti136 – 1361V → I.
Corresponds to variant rs3818222 [ dbSNP | Ensembl ].
VAR_049755

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei93 – 12937SINIT…LELRP → R in isoform 2. VSP_026471Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AL121901 Genomic DNA. Translation: CAI14741.1.
AL121901 Genomic DNA. Translation: CAI14742.1.
BC066354 mRNA. Translation: AAH66354.1.
CCDSiCCDS13216.2. [Q9BQP9-1]
CCDS42865.1. [Q9BQP9-2]
RefSeqiNP_001035904.1. NM_001042439.2. [Q9BQP9-2]
NP_848561.2. NM_178466.4.
UniGeneiHs.360989.

Genome annotation databases

EnsembliENST00000375452; ENSP00000364601; ENSG00000131059. [Q9BQP9-2]
ENST00000375454; ENSP00000364603; ENSG00000131059. [Q9BQP9-1]
GeneIDi128861.
KEGGihsa:128861.
UCSCiuc002wyr.3. human. [Q9BQP9-1]
uc002wys.3. human. [Q9BQP9-2]

Polymorphism databases

DMDMi152031690.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AL121901 Genomic DNA. Translation: CAI14741.1 .
AL121901 Genomic DNA. Translation: CAI14742.1 .
BC066354 mRNA. Translation: AAH66354.1 .
CCDSi CCDS13216.2. [Q9BQP9-1 ]
CCDS42865.1. [Q9BQP9-2 ]
RefSeqi NP_001035904.1. NM_001042439.2. [Q9BQP9-2 ]
NP_848561.2. NM_178466.4.
UniGenei Hs.360989.

3D structure databases

ProteinModelPortali Q9BQP9.
SMRi Q9BQP9. Positions 94-228.
ModBasei Search...
MobiDBi Search...

PTM databases

PhosphoSitei Q9BQP9.

Polymorphism databases

DMDMi 152031690.

Proteomic databases

PaxDbi Q9BQP9.
PRIDEi Q9BQP9.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000375452 ; ENSP00000364601 ; ENSG00000131059 . [Q9BQP9-2 ]
ENST00000375454 ; ENSP00000364603 ; ENSG00000131059 . [Q9BQP9-1 ]
GeneIDi 128861.
KEGGi hsa:128861.
UCSCi uc002wyr.3. human. [Q9BQP9-1 ]
uc002wys.3. human. [Q9BQP9-2 ]

Organism-specific databases

CTDi 128861.
GeneCardsi GC20P031806.
HGNCi HGNC:16204. BPIFA3.
HPAi HPA062708.
neXtProti NX_Q9BQP9.
PharmGKBi PA25782.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG46110.
HOGENOMi HOG000231509.
HOVERGENi HBG056370.
InParanoidi Q9BQP9.
OMAi MVGWLIG.
OrthoDBi EOG7VTDP5.
PhylomeDBi Q9BQP9.
TreeFami TF337052.

Miscellaneous databases

GenomeRNAii 128861.
NextBioi 82490.
PROi Q9BQP9.

Gene expression databases

Bgeei Q9BQP9.
CleanExi HS_C20orf71.
Genevestigatori Q9BQP9.

Family and domain databases

InterProi IPR017943. Bactericidal_perm-incr_a/b_dom.
IPR017942. Lipid-bd_serum_glycop_N.
[Graphical view ]
Pfami PF01273. LBP_BPI_CETP. 1 hit.
[Graphical view ]
SUPFAMi SSF55394. SSF55394. 1 hit.
ProtoNeti Search...

Publicationsi

  1. "The DNA sequence and comparative analysis of human chromosome 20."
    Deloukas P., Matthews L.H., Ashurst J.L., Burton J., Gilbert J.G.R., Jones M., Stavrides G., Almeida J.P., Babbage A.K., Bagguley C.L., Bailey J., Barlow K.F., Bates K.N., Beard L.M., Beare D.M., Beasley O.P., Bird C.P., Blakey S.E.
    , Bridgeman A.M., Brown A.J., Buck D., Burrill W.D., Butler A.P., Carder C., Carter N.P., Chapman J.C., Clamp M., Clark G., Clark L.N., Clark S.Y., Clee C.M., Clegg S., Cobley V.E., Collier R.E., Connor R.E., Corby N.R., Coulson A., Coville G.J., Deadman R., Dhami P.D., Dunn M., Ellington A.G., Frankland J.A., Fraser A., French L., Garner P., Grafham D.V., Griffiths C., Griffiths M.N.D., Gwilliam R., Hall R.E., Hammond S., Harley J.L., Heath P.D., Ho S., Holden J.L., Howden P.J., Huckle E., Hunt A.R., Hunt S.E., Jekosch K., Johnson C.M., Johnson D., Kay M.P., Kimberley A.M., King A., Knights A., Laird G.K., Lawlor S., Lehvaeslaiho M.H., Leversha M.A., Lloyd C., Lloyd D.M., Lovell J.D., Marsh V.L., Martin S.L., McConnachie L.J., McLay K., McMurray A.A., Milne S.A., Mistry D., Moore M.J.F., Mullikin J.C., Nickerson T., Oliver K., Parker A., Patel R., Pearce T.A.V., Peck A.I., Phillimore B.J.C.T., Prathalingam S.R., Plumb R.W., Ramsay H., Rice C.M., Ross M.T., Scott C.E., Sehra H.K., Shownkeen R., Sims S., Skuce C.D., Smith M.L., Soderlund C., Steward C.A., Sulston J.E., Swann R.M., Sycamore N., Taylor R., Tee L., Thomas D.W., Thorpe A., Tracey A., Tromans A.C., Vaudin M., Wall M., Wallis J.M., Whitehead S.L., Whittaker P., Willey D.L., Williams L., Williams S.A., Wilming L., Wray P.W., Hubbard T., Durbin R.M., Bentley D.R., Beck S., Rogers J.
    Nature 414:865-871(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Testis.

Entry informationi

Entry nameiBPIA3_HUMAN
AccessioniPrimary (citable) accession number: Q9BQP9
Secondary accession number(s): Q5JWG8, Q6NZ38
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 10, 2002
Last sequence update: July 10, 2007
Last modified: July 9, 2014
This is version 92 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 20
    Human chromosome 20: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi