Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

SMC5-SMC6 complex localization factor protein 1

Gene

SLF1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Plays a role in the DNA damage response (DDR) pathway by regulating postreplication repair of UV-damaged DNA and genomic stability maintenance (PubMed:25931565). The SLF1-SLF2 complex acts to link RAD18 with the SMC5-SMC6 complex at replication-coupled interstrand cross-links (ICL) and DNA double-strand breaks (DSBs) sites on chromatin during DNA repair in response to stalled replication forks (PubMed:25931565). Promotes the recruitment of SLF2 and the SMC5-SMC6 complex to DNA lesions (PubMed:25931565).1 Publication

GO - Molecular functioni

  • protein complex binding Source: UniProtKB
  • ubiquitin protein ligase binding Source: UniProtKB

GO - Biological processi

  • cellular response to DNA damage stimulus Source: UniProtKB
  • DNA repair Source: UniProtKB-KW
  • positive regulation of double-strand break repair Source: UniProtKB
  • positive regulation of maintenance of mitotic sister chromatid cohesion Source: UniProtKB
  • positive regulation of protein complex assembly Source: UniProtKB
  • protein localization to site of double-strand break Source: UniProtKB
Complete GO annotation...

Keywords - Biological processi

DNA damage, DNA repair

Names & Taxonomyi

Protein namesi
Recommended name:
SMC5-SMC6 complex localization factor protein 1Imported
Alternative name(s):
Ankyrin repeat domain-containing protein 32
BRCT domain-containing protein 1
Smc5/6 localization factor 11 Publication
Gene namesi
Name:SLF11 PublicationImported
Synonyms:ANKRD32, BRCTD1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 5

Organism-specific databases

HGNCiHGNC:25408. SLF1.

Subcellular locationi

GO - Cellular componenti

  • centrosome Source: UniProtKB
  • cytoplasm Source: UniProtKB
  • nuclear inclusion body Source: UniProtKB
  • nucleosome Source: UniProtKB
  • nucleus Source: UniProtKB
  • site of double-strand break Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134911523.

Polymorphism and mutation databases

BioMutaiANKRD32.
DMDMi193806371.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 10581058SMC5-SMC6 complex localization factor protein 1PRO_0000243906Add
BLAST

Proteomic databases

MaxQBiQ9BQI6.
PaxDbiQ9BQI6.
PRIDEiQ9BQI6.

PTM databases

iPTMnetiQ9BQI6.
PhosphoSiteiQ9BQI6.

Expressioni

Gene expression databases

BgeeiQ9BQI6.
CleanExiHS_ANKRD32.
ExpressionAtlasiQ9BQI6. baseline and differential.
GenevisibleiQ9BQI6. HS.

Organism-specific databases

HPAiHPA040793.
HPA054213.

Interactioni

Subunit structurei

Interacts (via N-terminus) with SLF2; this interaction links RAD18 to the SMC5-SMC6 complex (PubMed:25931565). Interacts (via BRCT domains) with RAD18; this interaction occurs in a SLF2-independent manner (PubMed:25931565). Interacts with SMC6 (PubMed:25931565). Interacts (via BRCT domains) with RAD18 (via C-terminus and phosphorylated form); this interaction is required for efficient repair of UV-induced DNA damage (By similarity).By similarity1 Publication

GO - Molecular functioni

  • protein complex binding Source: UniProtKB
  • ubiquitin protein ligase binding Source: UniProtKB

Protein-protein interaction databases

BioGridi123978. 7 interactions.
IntActiQ9BQI6. 5 interactions.
MINTiMINT-4711958.
STRINGi9606.ENSP00000265140.

Structurei

3D structure databases

ProteinModelPortaliQ9BQI6.
SMRiQ9BQI6. Positions 7-199, 762-928.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini12 – 7766BRCT 1Add
BLAST
Domaini119 – 19678BRCT 2Add
BLAST
Repeati806 – 83631ANK 1Add
BLAST
Repeati840 – 86930ANK 2Add
BLAST
Repeati874 – 90330ANK 3Add
BLAST

Domaini

BRCT domains are necessary for its targeting to ionizing radiation-induced nuclear foci.By similarity

Sequence similaritiesi

Contains 3 ANK repeats.PROSITE-ProRule annotation
Contains 2 BRCT domains.Curated

Keywords - Domaini

ANK repeat, Repeat

Phylogenomic databases

eggNOGiKOG0504. Eukaryota.
KOG1929. Eukaryota.
ENOG410XPFH. LUCA.
GeneTreeiENSGT00760000119090.
HOGENOMiHOG000033961.
HOVERGENiHBG103143.
InParanoidiQ9BQI6.
OMAiYLELFQC.
OrthoDBiEOG79PJNF.
PhylomeDBiQ9BQI6.
TreeFamiTF329705.

Family and domain databases

Gene3Di1.25.40.20. 1 hit.
3.40.50.10190. 1 hit.
InterProiIPR002110. Ankyrin_rpt.
IPR020683. Ankyrin_rpt-contain_dom.
IPR001357. BRCT_dom.
[Graphical view]
PfamiPF12796. Ank_2. 1 hit.
PF16770. RTT107_BRCT_5. 1 hit.
[Graphical view]
SMARTiSM00248. ANK. 3 hits.
SM00292. BRCT. 2 hits.
[Graphical view]
SUPFAMiSSF48403. SSF48403. 1 hit.
SSF52113. SSF52113. 1 hit.
PROSITEiPS50297. ANK_REP_REGION. 1 hit.
PS50088. ANK_REPEAT. 3 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9BQI6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEDGTPKHII QMTGFKMEEK EALVKLLLKL DCTFIKSEKY KNCTHLIAER
60 70 80 90 100
LCKSEKFLAA CAAGKWILTK DYIIHSAKSG RWLDETTYEW GYKIEKDSRY
110 120 130 140 150
SPQMQSAPKR WREELKRTGA PGAFHRWKVV LLVRTDKRSD SLIRVLEAGK
160 170 180 190 200
ANVILPKSSP SGITHVIASN ARIKAEKEKD NFKAPFYPIQ YLGDFLLEKE
210 220 230 240 250
IQNDEDSQTN SVWTEHSNEE TNKDFRKDAG FLEMKGALRE TMYRTQKEMQ
260 270 280 290 300
NHEDVNVGSI LIQHHKKEKF SGSSKDLKFV KMRNTFGSHT YENQKEIKKK
310 320 330 340 350
DEDIQRSYTL RRKRKKGKES NCKKGVEHEK IKSTLRRHIY NRDQKEMKNS
360 370 380 390 400
IFAEYAKESK AMAIKTDVDV VEIKNTLRKH IYRAQAVRYN CIRIDKQPVY
410 420 430 440 450
NVEVKNAEFP RGVLNLIESL IEGHFFKEAI EELSTLQAHY IPPVCVLHAL
460 470 480 490 500
LENVLQDNID TFSGRYFHIL SALLHLHPPW KSPAMSRYYL ELFQCPTCMK
510 520 530 540 550
GAWSLVEVLI RSCLFNESFC HQISENIGSK VLHLTLLKFF FNLIESEVQH
560 570 580 590 600
LSQKLYDWSD SQNLKITGKA MLLEIFWSGS ETSGLLTKPV NMLLEWTIYS
610 620 630 640 650
HKEKFKSNDV FKHELAYLLA GILGAAIDYW IFLGLKMGRN VMRHMSDDLG
660 670 680 690 700
SYVSLSCDDF SSQELEIFIC SFSSSWLQMF VAEAVFKKLC LQSSGSVSSE
710 720 730 740 750
PLSLQKMVYS YLPALGKTGV LGSGKIQVSK KIGQRPCFDS QRTLLMLNGT
760 770 780 790 800
KQKQVEGLPE LLDLNLAKCS SSLKKLKKKS EGELSCSKEN CPSVVKKMNF
810 820 830 840 850
HKTNLKGETA LHRACINNQV EKLILLLSLP GIDINVKDNA GWTPLHEACN
860 870 880 890 900
YGNTVCVQEI LQRCPEVDLL TQVDGVTPLH DALSNGHVEI GKLLLQHGGP
910 920 930 940 950
VLLQQRNAKG ELPLDYVVSP QIKEELFAIT KIEDTVENFH AQAEKHFHYQ
960 970 980 990 1000
QLEFGSFLLS RMLLNFCSIF DLSSEFILAS KGLTHLNELL MACKSHKETT
1010 1020 1030 1040 1050
SVHTDWLLDL YAGNIKTLQK LPHILKELPE NLKVCPGVHT EALMITLEMM

CRSVMEFS
Length:1,058
Mass (Da):121,050
Last modified:July 1, 2008 - v2
Checksum:iC624008C7CC25FE6
GO
Isoform 2 (identifier: Q9BQI6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     145-179: VLEAGKANVILPKSSPSGITHVIASNARIKAEKEK → KKFRMMKIPKPILFGLNIAMKKQTKISGKMQDFLK
     180-1058: Missing.

Note: No experimental confirmation available.
Show »
Length:179
Mass (Da):21,003
Checksum:i04B900457E943E18
GO

Sequence cautioni

The sequence AAH54885.2 differs from that shown.Contaminating sequence. Potential poly-A sequence.Curated
The sequence AAH54885.2 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence AAH70332.1 differs from that shown.Contaminating sequence. Potential poly-A sequence.Curated
The sequence AAH70332.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence AAI07572.1 differs from that shown. Reason: Erroneous initiation. Curated
The sequence CAB66495.1 differs from that shown. Reason: Erroneous initiation. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti24 – 241V → A in CAB43397 (PubMed:17974005).Curated
Sequence conflicti103 – 1031Q → R in CAB43397 (PubMed:17974005).Curated
Sequence conflicti182 – 1821F → S in AAH54885 (PubMed:15489334).Curated
Sequence conflicti221 – 2211T → A in CAB43397 (PubMed:17974005).Curated
Sequence conflicti328 – 3281H → Q in AAH70332 (PubMed:15489334).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti288 – 2881S → R.
Corresponds to variant rs6891545 [ dbSNP | Ensembl ].
VAR_059120

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei145 – 17935VLEAG…AEKEK → KKFRMMKIPKPILFGLNIAM KKQTKISGKMQDFLK in isoform 2. 1 PublicationVSP_056914Add
BLAST
Alternative sequencei180 – 1058879Missing in isoform 2. 1 PublicationVSP_056915Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK297452 mRNA. Translation: BAG59876.1.
AC008534 Genomic DNA. No translation available.
AC025766 Genomic DNA. No translation available.
BC054885 mRNA. Translation: AAH54885.2. Sequence problems.
BC070332 mRNA. Translation: AAH70332.1. Sequence problems.
BC107571 mRNA. Translation: AAI07572.1. Different initiation.
AL050298 mRNA. Translation: CAB43397.2.
AL136560 mRNA. Translation: CAB66495.1. Different initiation.
CR533539 mRNA. Translation: CAG38570.1.
CCDSiCCDS4071.2. [Q9BQI6-1]
PIRiT08704.
RefSeqiNP_115666.2. NM_032290.3. [Q9BQI6-1]
XP_005272170.1. XM_005272113.3. [Q9BQI6-1]
XP_011541984.1. XM_011543682.1. [Q9BQI6-1]
XP_011541985.1. XM_011543683.1. [Q9BQI6-1]
XP_011541986.1. XM_011543684.1. [Q9BQI6-1]
XP_011541987.1. XM_011543685.1. [Q9BQI6-1]
UniGeneiHs.657315.

Genome annotation databases

EnsembliENST00000265140; ENSP00000265140; ENSG00000133302. [Q9BQI6-1]
ENST00000508130; ENSP00000424232; ENSG00000133302. [Q9BQI6-2]
GeneIDi84250.
KEGGihsa:84250.
UCSCiuc003kkr.5. human. [Q9BQI6-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK297452 mRNA. Translation: BAG59876.1.
AC008534 Genomic DNA. No translation available.
AC025766 Genomic DNA. No translation available.
BC054885 mRNA. Translation: AAH54885.2. Sequence problems.
BC070332 mRNA. Translation: AAH70332.1. Sequence problems.
BC107571 mRNA. Translation: AAI07572.1. Different initiation.
AL050298 mRNA. Translation: CAB43397.2.
AL136560 mRNA. Translation: CAB66495.1. Different initiation.
CR533539 mRNA. Translation: CAG38570.1.
CCDSiCCDS4071.2. [Q9BQI6-1]
PIRiT08704.
RefSeqiNP_115666.2. NM_032290.3. [Q9BQI6-1]
XP_005272170.1. XM_005272113.3. [Q9BQI6-1]
XP_011541984.1. XM_011543682.1. [Q9BQI6-1]
XP_011541985.1. XM_011543683.1. [Q9BQI6-1]
XP_011541986.1. XM_011543684.1. [Q9BQI6-1]
XP_011541987.1. XM_011543685.1. [Q9BQI6-1]
UniGeneiHs.657315.

3D structure databases

ProteinModelPortaliQ9BQI6.
SMRiQ9BQI6. Positions 7-199, 762-928.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi123978. 7 interactions.
IntActiQ9BQI6. 5 interactions.
MINTiMINT-4711958.
STRINGi9606.ENSP00000265140.

PTM databases

iPTMnetiQ9BQI6.
PhosphoSiteiQ9BQI6.

Polymorphism and mutation databases

BioMutaiANKRD32.
DMDMi193806371.

Proteomic databases

MaxQBiQ9BQI6.
PaxDbiQ9BQI6.
PRIDEiQ9BQI6.

Protocols and materials databases

DNASUi84250.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000265140; ENSP00000265140; ENSG00000133302. [Q9BQI6-1]
ENST00000508130; ENSP00000424232; ENSG00000133302. [Q9BQI6-2]
GeneIDi84250.
KEGGihsa:84250.
UCSCiuc003kkr.5. human. [Q9BQI6-1]

Organism-specific databases

CTDi84250.
GeneCardsiANKRD32.
HGNCiHGNC:25408. SLF1.
HPAiHPA040793.
HPA054213.
neXtProtiNX_Q9BQI6.
PharmGKBiPA134911523.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0504. Eukaryota.
KOG1929. Eukaryota.
ENOG410XPFH. LUCA.
GeneTreeiENSGT00760000119090.
HOGENOMiHOG000033961.
HOVERGENiHBG103143.
InParanoidiQ9BQI6.
OMAiYLELFQC.
OrthoDBiEOG79PJNF.
PhylomeDBiQ9BQI6.
TreeFamiTF329705.

Miscellaneous databases

ChiTaRSiANKRD32. human.
GenomeRNAii84250.
NextBioi35473320.
PROiQ9BQI6.

Gene expression databases

BgeeiQ9BQI6.
CleanExiHS_ANKRD32.
ExpressionAtlasiQ9BQI6. baseline and differential.
GenevisibleiQ9BQI6. HS.

Family and domain databases

Gene3Di1.25.40.20. 1 hit.
3.40.50.10190. 1 hit.
InterProiIPR002110. Ankyrin_rpt.
IPR020683. Ankyrin_rpt-contain_dom.
IPR001357. BRCT_dom.
[Graphical view]
PfamiPF12796. Ank_2. 1 hit.
PF16770. RTT107_BRCT_5. 1 hit.
[Graphical view]
SMARTiSM00248. ANK. 3 hits.
SM00292. BRCT. 2 hits.
[Graphical view]
SUPFAMiSSF48403. SSF48403. 1 hit.
SSF52113. SSF52113. 1 hit.
PROSITEiPS50297. ANK_REP_REGION. 1 hit.
PS50088. ANK_REPEAT. 3 hits.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Brain.
  2. "The DNA sequence and comparative analysis of human chromosome 5."
    Schmutz J., Martin J., Terry A., Couronne O., Grimwood J., Lowry S., Gordon L.A., Scott D., Xie G., Huang W., Hellsten U., Tran-Gyamfi M., She X., Prabhakar S., Aerts A., Altherr M., Bajorek E., Black S.
    , Branscomb E., Caoile C., Challacombe J.F., Chan Y.M., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Lopez F., Lou Y., Martinez D., Medina C., Morgan J., Nandkeshwar R., Noonan J.P., Pitluck S., Pollard M., Predki P., Priest J., Ramirez L., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wheeler J., Wu K., Yang J., Dickson M., Cheng J.-F., Eichler E.E., Olsen A., Pennacchio L.A., Rokhsar D.S., Richardson P., Lucas S.M., Myers R.M., Rubin E.M.
    Nature 431:268-274(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-328 (ISOFORM 1).
    Tissue: Testis.
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-267 (ISOFORM 1).
    Tissue: Brain.
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 631-1058 (ISOFORM 1).
    Tissue: Amygdala.
  6. "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)."
    Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
    Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 637-1058 (ISOFORM 1).
  7. "Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis."
    Cantin G.T., Yi W., Lu B., Park S.K., Xu T., Lee J.-D., Yates J.R. III
    J. Proteome Res. 7:1346-1351(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  8. "DNA repair. Proteomics reveals dynamic assembly of repair complexes during bypass of DNA cross-links."
    Raeschle M., Smeenk G., Hansen R.K., Temu T., Oka Y., Hein M.Y., Nagaraj N., Long D.T., Walter J.C., Hofmann K., Storchova Z., Cox J., Bekker-Jensen S., Mailand N., Mann M.
    Science 348:1253671-1253671(2015) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, INTERACTION WITH RAD18; SLF2 AND SMC6, SUBCELLULAR LOCATION, IDENTIFICATION BY MASS SPECTROMETRY.

Entry informationi

Entry nameiSLF1_HUMAN
AccessioniPrimary (citable) accession number: Q9BQI6
Secondary accession number(s): B4DMG4
, Q3B7K4, Q6NSA5, Q6PHW9, Q9Y402
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 27, 2006
Last sequence update: July 1, 2008
Last modified: May 11, 2016
This is version 113 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.