Reviewed,
UniProtKB/Swiss-Prot Q9BQF6 (SENP7_HUMAN)
Last modified
June 16, 2009.
Version 63.
History...
Clusters with 100%,
90%,
50% identity |
Documents (6) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Sentrin-specific protease 7 EC=3.4.22.- Alternative name(s): Sentrin/SUMO-specific protease SENP7 SUMO-1-specific protease 2 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 984 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Protease that deconjugates SUMO2 and SUMO3 from targeted proteins, but not SUMO1. Catalyzes the deconjugation of poly-SUMO2 and poly-SUMO3 chains. Has very low efficiency in processing full-length SUMO proteins to their mature forms. Ref.7 |
| Sequence similarities | Belongs to the peptidase C48 family. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Ubl conjugation pathway |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Molecular function | Hydrolase Protease Thiol protease |
| PTM | Phosphoprotein |
| Technical term | 3D-structure |
| Gene Ontology (GO) | |
| Biological process | modification-dependent protein catabolic process Inferred from electronic annotation. Source: UniProtKB-KW protein sumoylationInferred from sequence or structural similarity. Source: UniProtKB |
| Cellular component | nucleus Inferred from sequence or structural similarity. Source: UniProtKB |
| Molecular function | cysteine-type peptidase activity Non-traceable author statement. Source: UniProtKB |
| Complete GO annotation... | |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] Note: Experimental confirmation may be lacking for some isoforms. | ||||||
| Isoform 1 (identifier: Q9BQF6-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9BQF6-2) The sequence of this isoform differs from the canonical sequence as follows: 1-33: Missing. 95-95: R → RQLKVMLTNVLWTDLGRKFRKTLPRNDANLCDANKVQSDSLPSTSVDSLETCQKLEPLRQSLNLSER | ||||||
| Isoform 3 (identifier: Q9BQF6-3) The sequence of this isoform differs from the canonical sequence as follows: 1-746: Missing. 747-761: TRKENNLTEDNPNLS → MKKFLYIKSVFHTLR | ||||||
| Isoform 4 (identifier: Q9BQF6-4) The sequence of this isoform differs from the canonical sequence as follows: 1-33: Missing. 94-158: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 984 | 984 | Sentrin-specific protease 7 | PRO_0000101726 | |||||
Regions | |||||||||
| Region | 694 – 984 | 291 | Protease | ||||||
Sites | |||||||||
| Active site | 794 | 1 | By similarity | ||||||
| Active site | 926 | 1 | By similarity | ||||||
Amino acid modifications | |||||||||
| Modified residue | 377 | 1 | Phosphoserine Ref.6 | ||||||
| Modified residue | 378 | 1 | Phosphoserine Ref.6 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 746 | 746 | Missing in isoform 3. | VSP_005277 | |||||
| Alternative sequence | 1 – 33 | 33 | Missing in isoform 2 and isoform 4. | VSP_005275 | |||||
| Alternative sequence | 94 – 158 | 65 | Missing in isoform 4. | VSP_021945 | |||||
| Alternative sequence | 95 | 1 | R → RQLKVMLTNVLWTDLGRKFR KTLPRNDANLCDANKVQSDS LPSTSVDSLETCQKLEPLRQ SLNLSER in isoform 2. | VSP_005276 | |||||
| Alternative sequence | 747 – 761 | 15 | TRKEN…NPNLS → MKKFLYIKSVFHTLR in isoform 3. | VSP_005278 | |||||
| Natural variant | 79 | 1 | K → Q: dbSNP rs6809436. | VAR_029651 | |||||
| Natural variant | 546 | 1 | Q → H: dbSNP rs2433031. Ref.5 | VAR_029652 | |||||
Experimental info | |||||||||
| Mutagenesis | 709 | 1 | F → W: Slightly increased deconjugation activity. Ref.7 | ||||||
| Mutagenesis | 713 | 1 | V → E: Reduces deconjugation activity. Ref.7 | ||||||
| Sequence conflict | 90 | 1 | K → R in CAB66534. Ref.3 | ||||||
| Sequence conflict | 275 | 1 | K → R in CAB66534. Ref.3 | ||||||
| Sequence conflict | 330 | 1 | N → Y in CAB66534. Ref.3 | ||||||
| Sequence conflict | 719 | 1 | L → H in AAL25651. Ref.1 | ||||||
| Sequence conflict | 828 | 1 | N → S in CAB66534. Ref.3 | ||||||
| Sequence conflict | 881 | 1 | Q → R in CAB66534. Ref.3 | ||||||
| Sequence conflict | 940 | 1 | D → N in AAL25651. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Towards a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs." Wiemann S., Weil B., Wellenreuther R., Gassenhuber J., Glassl S., Ansorge W., Boecher M., Bloecker H., Bauersachs S., Blum H., Lauber J., Duesterhoeft A., Beyer A., Koehrer K., Strack N., Mewes H.-W., Ottenwaelder B., Obermaier B. Poustka A.Genome Res. 11:422-435(2001) [PubMed: 11230166] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain. |
| [2] | Choi S.J., Jeon Y.-J., Kim K.I., Nishimori S., Suzuki T., Uchida S., Shimbara N., Tanaka K., Chung C.H. Submitted (OCT-1999) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). |
| [3] | "SENP7, a novel human sentrin-specific protease." Gong L., Yeh E.T.H. Submitted (DEC-1999) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3). Tissue: Placenta. |
| [4] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Blocker H., Heubner D., Hoerlein A., Michel G., Wedler H., Kohrer K., Ottenwalder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed: 17974005] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4). Tissue: Fetal kidney. |
| [5] | "Prediction of the coding sequences of unidentified human genes. XIX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro." Nagase T., Kikuno R., Hattori A., Kondo Y., Okumura K., Ohara O. DNA Res. 7:347-355(2000) [PubMed: 11214970] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 229-984 (ISOFORM 1), VARIANT HIS-546. Tissue: Brain. |
| [6] | "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M. Cell 127:635-648(2006) [PubMed: 17081983] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-377 AND SER-378, MASS SPECTROMETRY. Tissue: Epithelium. |
| [7] | "Structure of the human SENP7 catalytic domain and poly-SUMO deconjugation activities for SENP6 and SENP7." Lima C.D., Reverter D. J. Biol. Chem. 283:32045-32055(2008) [PubMed: 18799455] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.4 ANGSTROMS) OF 662-984, FUNCTION, MUTAGENESIS OF PHE-709 AND VAL-713. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| AF199458 mRNA. Translation: AAL25651.1. AF217504 mRNA. Translation: AAG09703.1. AL136599 mRNA. Translation: CAB66534.1. BX537943 mRNA. Translation: CAD97911.1. AB051494 mRNA. Translation: BAB21798.1. | |||||||||||||
| IPI | IPI00218776. IPI00218777. IPI00296449. IPI00816671. | ||||||||||||
| RefSeq | NP_001070671.1. NP_065705.3. | ||||||||||||
| UniGene | Hs.529551 | ||||||||||||
3D structure databases | |||||||||||||
| |||||||||||||
| ModBase | Search... | ||||||||||||
Protein family/group databases | |||||||||||||
| MEROPS | C48.009. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | Q9BQF6. | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENSG00000138468. Homo sapiens. [Contig view] | ||||||||||||
| GeneID | 57337. | ||||||||||||
| KEGG | hsa:57337. | ||||||||||||
| NMPDR | fig|9606.3.peg.22897. | ||||||||||||
Organism-specific databases | |||||||||||||
| GeneCards | GC03M102525. | ||||||||||||
| H-InvDB | HIX0003507. | ||||||||||||
| HGNC | HGNC:30402. SENP7. | ||||||||||||
| PharmGKB | PA134925171. | ||||||||||||
| HUGE | Search... | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| HOVERGEN | Q9BQF6. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | Q9BQF6. | ||||||||||||
| Bgee | Q9BQF6. | ||||||||||||
| CleanEx | HS_SENP7. | ||||||||||||
| GermOnline | ENSG00000138468. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| InterPro | IPR003653. Peptidase_C48. [Graphical view] | ||||||||||||
| Pfam | PF02902. Peptidase_C48. 1 hit. [Graphical view] | ||||||||||||
| PROSITE | PS50600. ULP_PROTEASE. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other Resources | |||||||||||||
| NextBio | 63454. | ||||||||||||
Entry information
| Entry name | SENP7_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9BQF6 Secondary accession number(s): Q7Z3F4 Q9HBT5 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| Human chromosome 3 Human chromosome 3: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| Peptidase families Classification of peptidase families and list of entries |
| SIMILARITY comments Index of protein domains and families |

Clusters with


