Q9BQ95 (ECSIT_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 69.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Evolutionarily conserved signaling intermediate in Toll pathway, mitochondrial Alternative name(s): Protein SITPEC | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 431 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Adapter protein of the Toll-like and IL-1 receptor signaling pathway that is involved in the activation of NF-kappa-B via MAP3K1. Promotes proteolytic activation of MAP3K1. Involved in the BMP signaling pathway. Required for normal embryonic development By similarity. Required for efficient assembly of mitochondrial NADH:ubiquinone oxidoreductase. |
| Subunit structure | Interacts with MAP3K1, SMAD4 and TRAF6. Interacts with SMAD1 only after BMP4-treatment By similarity. Interacts with NDUFAF1. Ref.4 |
| Subcellular location | |
| Sequence similarities | Belongs to the ECSIT family. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Immunity Innate immunity |
| Cellular component | Cytoplasm Mitochondrion Nucleus |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Transit peptide |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological process | innate immune response Inferred from electronic annotation. Source: UniProtKB-KW regulation of oxidoreductase activityInferred from direct assay Ref.4. Source: UniProtKB |
| Cellular component | mitochondrion Inferred from direct assay Ref.4. Source: UniProtKB |
| Molecular function | oxidoreductase activity, acting on NADH or NADPH Inferred from direct assay Ref.4. Source: UniProtKB protein bindingInferred from physical interaction Ref.4. Source: UniProtKB |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| APOE | P02649 | 4 | EBI-712452,EBI-1222467 | |
| FARSA | Q9Y285 | 2 | EBI-712452,EBI-725361 | |
| PSEN1 | P49768 | 4 | EBI-712452,EBI-297277 | |
| PSEN2 | P49810 | 4 | EBI-712452,EBI-2010251 |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9BQ95-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9BQ95-2) The sequence of this isoform differs from the canonical sequence as follows: 267-296: IQSPDQQAALARHNPARPVFVEGPFSLWLR → SGRDAGGVEPLLPDAAGPGVCEEWLGQLRV 297-431: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Transit peptide | 1 – 48 | 48 | Mitochondrion Potential | ||||||
| Chain | 49 – 431 | 383 | Evolutionarily conserved signaling intermediate in Toll pathway, mitochondrial | PRO_0000291985 | |||||
Natural variations | |||||||||
| Alternative sequence | 267 – 296 | 30 | IQSPD…SLWLR → SGRDAGGVEPLLPDAAGPGV CEEWLGQLRV in isoform 2. | VSP_026345 | |||||
| Alternative sequence | 297 – 431 | 135 | Missing in isoform 2. | VSP_026346 | |||||
| Natural variant | 278 | 1 | R → C. Ref.1 Corresponds to variant rs34803265 [ dbSNP | Ensembl ]. | VAR_032907 | |||||
| Natural variant | 406 | 1 | G → R. Corresponds to variant rs2302971 [ dbSNP | Ensembl ]. | VAR_032908 | |||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Nucleotide sequence of the human ECSIT cDNA." Fitzgerald S.N., Brady K.J., Moynagh P.N. Submitted (MAR-2000) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT CYS-278. |
| [2] | "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)." Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Tissue: Eye, Lung and Pancreas. |
| [4] | "Cytosolic signaling protein Ecsit also localizes to mitochondria where it interacts with chaperone NDUFAF1 and functions in complex I assembly." Vogel R.O., Janssen R.J.R.J., van den Brand M.A.M., Dieteren C.E.J., Verkaart S., Koopman W.J.H., Willems P.H.G.M., Pluk W., van den Heuvel L.P.W.J., Smeitink J.A.M., Nijtmans L.G.J. Genes Dev. 21:615-624(2007) [PubMed: 17344420] [Abstract] Cited for: SUBCELLULAR LOCATION, MASS SPECTROMETRY, INTERACTION WITH NDUFAF1. |
| [5] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed: 21269460] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF243044 mRNA. Translation: AAF62100.1. CR457204 mRNA. Translation: CAG33485.1. BC000193 mRNA. Translation: AAH00193.1. BC005119 mRNA. Translation: AAH05119.1. BC008279 mRNA. Translation: AAH08279.1. |
| IPI | IPI00063188. IPI00106506. |
| RefSeq | NP_001135936.1. NM_001142464.2. NP_057665.2. NM_016581.4. |
| UniGene | Hs.515146. |
3D structure databases | |
| ProteinModelPortal | Q9BQ95. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q9BQ95. 32 interactions. |
| STRING | Q9BQ95. |
Polymorphism databases | |
| DMDM | 74752234. |
Proteomic databases | |
| PeptideAtlas | Q9BQ95. |
| PRIDE | Q9BQ95. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000270517; ENSP00000270517; ENSG00000130159. |
| GeneID | 51295. |
| KEGG | hsa:51295. |
| UCSC | uc002msb.1. human. uc010dyd.1. human. |
Organism-specific databases | |
| CTD | 51295. |
| GeneCards | GC19M011616. |
| H-InvDB | HIX0014773. |
| HGNC | HGNC:29548. ECSIT. |
| HPA | HPA042979. |
| MIM | 608388. gene. |
| neXtProt | NX_Q9BQ95. |
| PharmGKB | PA147358104. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG10835. |
| GeneTree | ENSGT00390000005147. |
| HOGENOM | HBG446729. |
| HOVERGEN | HBG059532. |
| InParanoid | Q9BQ95. |
| OMA | MPEFGVE. |
| PhylomeDB | Q9BQ95. |
Gene expression databases | |
| ArrayExpress | Q9BQ95. |
| Bgee | Q9BQ95. |
| CleanEx | HS_ECSIT. |
| Genevestigator | Q9BQ95. |
Family and domain databases | |
| InterPro | IPR010418. ECSIT. [Graphical view] |
| KO | K04405. |
| PANTHER | PTHR13113. ECSIT. 1 hit. |
| Pfam | PF06239. ECSIT. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 54573. |
| SOURCE | Search... |
Entry information
| Entry name | ECSIT_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9BQ95 Secondary accession number(s): Q96HQ7, Q9NYI1 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 19 Human chromosome 19: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with