Q9BQ52 (RNZ2_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 109.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Zinc phosphodiesterase ELAC protein 2 EC=3.1.26.11 Alternative name(s): ElaC homolog protein 2 Heredity prostate cancer protein 2 Ribonuclease Z 2 Short name=RNase Z 2 tRNA 3 endonuclease 2 tRNase Z 2 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 826 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Zinc phosphodiesterase, which displays some tRNA 3'-processing endonuclease activity. Probably involved in tRNA maturation, by removing a 3'-trailer from precursor tRNA. |
| Catalytic activity | Endonucleolytic cleavage of RNA, removing extra 3' nucleotides from tRNA precursor, generating 3' termini of tRNAs. A 3'-hydroxy group is left at the tRNA terminus and a 5'-phosphoryl group is left at the trailer molecule. Ref.6 |
| Cofactor | Zinc Probable. |
| Subunit structure | Homodimer By similarity. Interacts with PTCD1. Ref.9 |
| Subcellular location | Nucleus Probable. |
| Tissue specificity | Widely expressed. Highly expressed in heart, placenta, liver, skeletal muscle, kidney, pancreas, testis and ovary. Weakly expressed in brain, lung, spleen, thymus, prostate, small intestine, colon and leukocytes. Ref.1 |
| Involvement in disease | Prostate cancer, hereditary, 2 (HPC2) [MIM:614731]: A condition associated with familial predisposition to cancer of the prostate. Most prostate cancers are adenocarcinomas that develop in the acini of the prostatic ducts. Other rare histopathologic types of prostate cancer that occur in approximately 5% of patients include small cell carcinoma, mucinous carcinoma, prostatic ductal carcinoma, transitional cell carcinoma, squamous cell carcinoma, basal cell carcinoma, adenoid cystic carcinoma (basaloid), signet-ring cell carcinoma and neuroendocrine carcinoma. |
| Sequence similarities | Belongs to the RNase Z family. |
Ontologies
| Keywords | |
|---|---|
| Biological process | tRNA processing |
| Cellular component | Nucleus |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Disease | Disease mutation Proto-oncogene |
| Ligand | Metal-binding Zinc |
| Molecular function | Endonuclease Hydrolase Nuclease |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | nucleic acid phosphodiester bond hydrolysis Inferred from electronic annotation. Source: GOC tRNA processingInferred from electronic annotation. Source: UniProtKB-KW |
| Cellular_component | mitochondrion Inferred from electronic annotation. Source: Compara nucleusInferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular_function | endonuclease activity Inferred from electronic annotation. Source: UniProtKB-KW metal ion bindingInferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| PUF60 | Q9UHX1 | 1 | EBI-718223,EBI-1053259 |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9BQ52-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9BQ52-2) The sequence of this isoform differs from the canonical sequence as follows: 1-94: Missing. 554-595: GLPSILLQRE...AWLQQYHNQC → VSVGLDHKAG...CPELLLLISG 596-826: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q9BQ52-3) The sequence of this isoform differs from the canonical sequence as follows: 1-372: Missing. 373-406: NCASVHNLRSHKIQTQLNLIHPDIFPLLTSFRCK → MRTVPQFTTFAATRFKPSSTSSTRTSSPCSPVSA | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 4 (identifier: Q9BQ52-4) The sequence of this isoform differs from the canonical sequence as follows: 188-227: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 826 | 826 | Zinc phosphodiesterase ELAC protein 2 | PRO_0000155828 | |||||
Amino acid modifications | |||||||||
| Modified residue | 199 | 1 | Phosphoserine Ref.7 | ||||||
| Modified residue | 208 | 1 | Phosphoserine By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 372 | 372 | Missing in isoform 3. | VSP_009168 | |||||
| Alternative sequence | 1 – 94 | 94 | Missing in isoform 2. | VSP_009169 | |||||
| Alternative sequence | 188 – 227 | 40 | Missing in isoform 4. | VSP_043449 | |||||
| Alternative sequence | 373 – 406 | 34 | NCASV…SFRCK → MRTVPQFTTFAATRFKPSST SSTRTSSPCSPVSA in isoform 3. | VSP_009170 | |||||
| Alternative sequence | 554 – 595 | 42 | GLPSI…YHNQC → VSVGLDHKAGAWRRHCHVEL ALWLRLFLRFQTCPELLLLI SG in isoform 2. | VSP_009171 | |||||
| Alternative sequence | 596 – 826 | 231 | Missing in isoform 2. | VSP_009172 | |||||
| Natural variant | 52 | 1 | S → F. Corresponds to variant rs9895963 [ dbSNP | Ensembl ]. | VAR_038210 | |||||
| Natural variant | 211 | 1 | R → Q in HPC2. Ref.13 | VAR_017425 | |||||
| Natural variant | 217 | 1 | S → L in HPC2; does not affect the enzymatic activity. Ref.1 Ref.3 Ref.5 Ref.6 Ref.11 Ref.13 Ref.14 Ref.15 Ref.17 Ref.18 Corresponds to variant rs4792311 [ dbSNP | Ensembl ]. | VAR_017426 | |||||
| Natural variant | 436 | 1 | D → N. Corresponds to variant rs3760317 [ dbSNP | Ensembl ]. | VAR_038211 | |||||
| Natural variant | 487 | 1 | G → R in HPC2. Ref.13 | VAR_017427 | |||||
| Natural variant | 541 | 1 | A → T in HPC2; does not affect the enzymatic activity. Ref.1 Ref.6 Ref.11 Ref.13 Ref.14 Ref.15 Ref.17 Corresponds to variant rs34152967 [ dbSNP | Ensembl ]. | VAR_017428 | |||||
| Natural variant | 622 | 1 | E → V in HPC2; higher frequency in prostate cancer cases. Ref.12 | VAR_017429 | |||||
| Natural variant | 627 | 1 | S → L. Ref.16 | VAR_017430 | |||||
| Natural variant | 781 | 1 | R → H in HPC2; does not affect the enzymatic activity. Ref.1 Ref.6 | VAR_017431 | |||||
| Natural variant | 806 | 1 | G → R in HPC2. Ref.13 | VAR_017432 | |||||
Experimental info | |||||||||
| Sequence conflict | 165 | 1 | V → M in AK001392. Ref.2 | ||||||
| Sequence conflict | 406 | 1 | Missing in AK001392. Ref.2 | ||||||
| Sequence conflict | 592 | 1 | H → Y in AK001392. Ref.2 | ||||||
| Sequence conflict | 754 | 1 | F → L in AK001392. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "A candidate prostate cancer susceptibility gene at chromosome 17p." Tavtigian S.V., Simard J., Teng D.H.F., Abtin V., Baumgard M., Beck A., Camp N.J., Carillo A.R., Chen Y., Dayananth P., Desrochers M., Dumont M., Farnham J.M., Frank D., Frye C., Ghaffari S., Gupte J.S., Hu R. Cannon-Albright L.A.Nat. Genet. 27:172-180(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY, VARIANTS HPC2 LEU-217; THR-541 AND HIS-781. |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2; 3 AND 4). Tissue: Hippocampus, Liver, Teratocarcinoma and Thalamus. |
| [3] | "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)." Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT HPC2 LEU-217. |
| [4] | "DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage." Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L. Nusbaum C.Nature 440:1045-1049(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT HPC2 LEU-217. Tissue: Lung. |
| [6] | "A candidate prostate cancer susceptibility gene encodes tRNA 3' processing endoribonuclease." Takaku H., Minagawa A., Takagi M., Nashimoto M. Nucleic Acids Res. 31:2272-2278(2003) [PubMed] [Europe PMC] [Abstract] Cited for: ENZYME ACTIVITY, CHARACTERIZATION OF VARIANTS HPC2 LEU-217; THR-541 AND HIS-781. |
| [7] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-199, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [8] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [9] | "RNA processing in human mitochondria." Sanchez M.I., Mercer T.R., Davies S.M., Shearwood A.M., Nygard K.K., Richman T.R., Mattick J.S., Rackham O., Filipovska A. Cell Cycle 10:2904-2916(2011) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH PTCD1. |
| [10] | "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation." Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B. Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [11] | "Association of HPC2/ELAC2 genotypes and prostate cancer." Rebbeck T.R., Walker A.H., Zeigler-Johnson C., Weisburg S., Martin A.-M., Nathanson K.L., Wein A.J., Malkowicz S.B. Am. J. Hum. Genet. 67:1014-1019(2000) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS HPC2 LEU-217 AND THR-541. |
| [12] | "ELAC2/HPC2 involvement in hereditary and sporadic prostate cancer." Roekman A., Ikonen T., Mononen N., Autio V., Matikainen M.P., Koivisto P.A., Tammela T.L.J., Kallioniemi O.-P., Schleutker J. Cancer Res. 61:6038-6041(2001) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT HPC2 VAL-622. |
| [13] | "Role of HPC2/ELAC2 in hereditary prostate cancer." Wang L., McDonnell S.K., Elkins D.A., Slager S.L., Christensen E., Marks A.F., Cunningham J.M., Peterson B.J., Jacobsen S.J., Cerhan J.R., Blute M.L., Schaid D.J., Thibodeau S.N. Cancer Res. 61:6494-6499(2001) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS HPC2 GLN-211; LEU-217; ARG-487; THR-541 AND ARG-806. |
| [14] | "Association of common missense changes in ELAC2 (HPC2) with prostate cancer in a Japanese case-control series." Fujiwara H., Emi M., Nagai H., Nishimura T., Konishi N., Kubota Y., Ichikawa T., Takahashi S., Shuin T., Habuchi T., Ogawa O., Inoue K., Skolnick M.H., Swensen J., Camp N.J., Tavtigian S.V. J. Hum. Genet. 47:641-648(2002) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS HPC2 LEU-217 AND THR-541. |
| [15] | "Meta-analysis of associations of the Ser217Leu and Ala541Thr variants in ELAC2 (HPC2) and prostate cancer." Camp N.J., Tavtigian S.V. Am. J. Hum. Genet. 71:1475-1478(2002) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS HPC2 LEU-217 AND THR-541. |
| [16] | "Ser217Leu polymorphism of the HPC2/ELAC2 gene associated with prostatic cancer risk in Japanese men." Takahashi H., Lu W., Watanabe M., Katoh T., Furusato M., Tsukino H., Nakao H., Sudo A., Suzuki H., Akakura K., Ikemoto I., Asano K., Ito T., Wakui S., Muto T., Hano H. Int. J. Cancer 107:224-228(2003) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT LEU-627. |
| [17] | "ELAC2/HPC2 polymorphisms, prostate-specific antigen levels, and prostate cancer." Severi G., Giles G.G., Southey M.C., Tesoriero A., Tilley W., Neufing P., Morris H., English D.R., McCredie M.R., Boyle P., Hopper J.L. J. Natl. Cancer Inst. 95:818-824(2003) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS HPC2 LEU-217 AND THR-541. |
| [18] | "DNA sequencing of a cytogenetically normal acute myeloid leukaemia genome." Ley T.J., Mardis E.R., Ding L., Fulton B., McLellan M.D., Chen K., Dooling D., Dunford-Shore B.H., McGrath S., Hickenbotham M., Cook L., Abbott R., Larson D.E., Koboldt D.C., Pohl C., Smith S., Hawkins A., Abbott S. Wilson R.K.Nature 456:66-72(2008) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT [LARGE SCALE ANALYSIS] HPC2 LEU-217. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF304369 Genomic DNA. Translation: AAG24440.1. AF304370 mRNA. Translation: AAG24441.1. AK001392 mRNA. No translation available. AK124838 mRNA. Translation: BAC85964.1. AK125030 mRNA. Translation: BAC86026.1. AK298397 mRNA. Translation: BAG60631.1. CR457261 mRNA. Translation: CAG33542.1. AC005277 Genomic DNA. No translation available. BC001939 mRNA. Translation: AAH01939.1. BC004158 mRNA. Translation: AAH04158.1. |
| IPI | IPI00396627. IPI00398822. IPI00398823. IPI00789842. |
| RefSeq | NP_001159434.1. NM_001165962.1. NP_060597.4. NM_018127.6. NP_776065.1. NM_173717.1. |
| UniGene | Hs.434232. |
3D structure databases | |
| ProteinModelPortal | Q9BQ52. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q9BQ52. 4 interactions. |
| MINT | MINT-1401619. |
| STRING | 9606.ENSP00000337445. |
PTM databases | |
| PhosphoSite | Q9BQ52. |
Polymorphism databases | |
| DMDM | 41017788. |
Proteomic databases | |
| PaxDb | Q9BQ52. |
| PRIDE | Q9BQ52. |
Protocols and materials databases | |
| DNASU | 60528. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000338034; ENSP00000337445; ENSG00000006744. ENST00000426905; ENSP00000405223; ENSG00000006744. |
| GeneID | 60528. |
| KEGG | hsa:60528. |
| UCSC | uc002gnv.4. human. uc002gnz.4. human. |
Organism-specific databases | |
| CTD | 60528. |
| GeneCards | GC17M012836. |
| HGNC | HGNC:14198. ELAC2. |
| HPA | HPA019535. |
| MIM | 176807. phenotype. 605367. gene. 614731. phenotype. |
| neXtProt | NX_Q9BQ52. |
| Orphanet | 1331. Familial prostate cancer. |
| PharmGKB | PA27739. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG1234. |
| HOGENOM | HOG000007499. |
| HOVERGEN | HBG050042. |
| InParanoid | Q9BQ52. |
| KO | K00784. |
| OMA | RAHTEEP. |
| OrthoDB | EOG4FTW05. |
Enzyme and pathway databases | |
| BRENDA | 3.1.26.11. 2681. |
Gene expression databases | |
| ArrayExpress | Q9BQ52. |
| Bgee | Q9BQ52. |
| CleanEx | HS_ELAC2. |
| Genevestigator | Q9BQ52. |
| GermOnline | ENSG00000006744. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR001279. Beta-lactamas-like. [Graphical view] |
| SMART | SM00849. Lactamase_B. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | ELAC2. human. |
| GenomeRNAi | 60528. |
| NextBio | 65429. |
| SOURCE | Search... |
Entry information
| Entry name | RNZ2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9BQ52 Secondary accession number(s): B4DPL9 Q9NVT1 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 17 Human chromosome 17: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
