Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9BQ16 (TICN3_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 127. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Testican-3
Alternative name(s):
SPARC/osteonectin, CWCV, and Kazal-like domains proteoglycan 3
Gene names
Name:SPOCK3
Synonyms:TICN3
ORF Names:UNQ409/PRO771
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length436 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

May participate in diverse steps of neurogenesis. Inhibits the processing of pro-matrix metalloproteinase 2 (MMP-2) by MT1-MMP and MT3-MMP. May interfere with tumor invasion.

Subcellular location

Secretedextracellular spaceextracellular matrix.

Tissue specificity

Expressed in brain.

Post-translational modification

Contains chondroitin sulfate and heparan sulfate O-linked oligosaccharides By similarity.

Sequence similarities

Contains 1 Kazal-like domain.

Contains 1 thyroglobulin type-1 domain.

Alternative products

This entry describes 9 isoforms produced by alternative splicing. [Align] [Select]
Isoform 3 (identifier: Q9BQ16-3)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 1 (identifier: Q9BQ16-1)

The sequence of this isoform differs from the canonical sequence as follows:
     64-66: Missing.
Isoform 2 (identifier: Q9BQ16-2)

Also known as: N-tes;

The sequence of this isoform differs from the canonical sequence as follows:
     314-316: DPP → GKR
     317-436: Missing.
Isoform 4 (identifier: Q9BQ16-4)

The sequence of this isoform differs from the canonical sequence as follows:
     1-66: MLKVSAVLCV...QWNKFRDEVE → MITQDHIHMSSGLSQ
Note: No experimental confirmation available.
Isoform 5 (identifier: Q9BQ16-5)

The sequence of this isoform differs from the canonical sequence as follows:
     64-161: Missing.
Isoform 6 (identifier: Q9BQ16-6)

The sequence of this isoform differs from the canonical sequence as follows:
     1-24: MLKVSAVLCVCAAAWCSQSLAAAA → MINNGSPQSLSMTRKSDSGTNSET
     25-120: Missing.
Note: No experimental confirmation available.
Isoform 7 (identifier: Q9BQ16-7)

The sequence of this isoform differs from the canonical sequence as follows:
     1-120: Missing.
Isoform 8 (identifier: Q9BQ16-8)

The sequence of this isoform differs from the canonical sequence as follows:
     64-66: Missing.
     200-240: ACSDLEFREVANRLRDWFKALHESGSQNKKTKTLLRPERSR → G
Note: No experimental confirmation available.
Isoform 9 (identifier: Q9BQ16-9)

The sequence of this isoform differs from the canonical sequence as follows:
     64-66: Missing.
     314-316: DPP → GKR
     317-436: Missing.
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Signal peptide1 – 2121 Potential
Chain22 – 436415Testican-3
PRO_0000026703

Regions

Domain133 – 18553Kazal-like
Domain314 – 38067Thyroglobulin type-1
Compositional bias394 – 43643Asp-rich

Amino acid modifications

Glycosylation3871O-linked (Xyl...) (glycosaminoglycan) Potential
Glycosylation3921O-linked (Xyl...) (glycosaminoglycan) Potential
Disulfide bond90 ↔ 101 By similarity
Disulfide bond95 ↔ 111 By similarity
Disulfide bond139 ↔ 169 By similarity
Disulfide bond142 ↔ 162 By similarity
Disulfide bond151 ↔ 183 By similarity
Disulfide bond317 ↔ 341 By similarity
Disulfide bond352 ↔ 359 By similarity
Disulfide bond361 ↔ 380 By similarity

Natural variations

Alternative sequence1 – 120120Missing in isoform 7.
VSP_046686
Alternative sequence1 – 6666MLKVS…RDEVE → MITQDHIHMSSGLSQ in isoform 4.
VSP_043681
Alternative sequence1 – 2424MLKVS…LAAAA → MINNGSPQSLSMTRKSDSGT NSET in isoform 6.
VSP_045899
Alternative sequence25 – 12096Missing in isoform 6.
VSP_045900
Alternative sequence64 – 16198Missing in isoform 5.
VSP_045104
Alternative sequence64 – 663Missing in isoform 1, isoform 8 and isoform 9.
VSP_013598
Alternative sequence200 – 24041ACSDL…PERSR → G in isoform 8.
VSP_046687
Alternative sequence314 – 3163DPP → GKR in isoform 2 and isoform 9.
VSP_005334
Alternative sequence317 – 436120Missing in isoform 2 and isoform 9.
VSP_005335
Natural variant1121I → V.
Corresponds to variant rs9685645 [ dbSNP | Ensembl ].
VAR_051562

Experimental info

Sequence conflict3481K → M in CAA04775. Ref.1
Sequence conflict4051E → G in BAG58265. Ref.4

Sequences

Sequence LengthMass (Da)Tools
Isoform 3 [UniParc].

Last modified May 10, 2005. Version 2.
Checksum: AAEDD1998C656FC0

FASTA43649,429
        10         20         30         40         50         60 
MLKVSAVLCV CAAAWCSQSL AAAAAVAAAG GRSDGGNFLD DKQWLTTISQ YDKEVGQWNK 

        70         80         90        100        110        120 
FRDEVEDDYF RTWSPGKPFD QALDPAKDPC LKMKCSRHKV CIAQDSQTAV CISHRRLTHR 

       130        140        150        160        170        180 
MKEAGVDHRQ WRGPILSTCK QCPVVYPSPV CGSDGHTYSF QCKLEYQACV LGKQISVKCE 

       190        200        210        220        230        240 
GHCPCPSDKP TSTSRNVKRA CSDLEFREVA NRLRDWFKAL HESGSQNKKT KTLLRPERSR 

       250        260        270        280        290        300 
FDTSILPICK DSLGWMFNRL DTNYDLLLDQ SELRSIYLDK NEQCTKAFFN SCDTYKDSLI 

       310        320        330        340        350        360 
SNNEWCYCFQ RQQDPPCQTE LSNIQKRQGV KKLLGQYIPL CDEDGYYKPT QCHGSVGQCW 

       370        380        390        400        410        420 
CVDRYGNEVM GSRINGVADC AIDFEISGDF ASGDFHEWTD DEDDEDDIMN DEDEIEDDDE 

       430 
DEGDDDDGGD DHDVYI 

« Hide

Isoform 1 [UniParc].

Checksum: B697CDE58F7028AF
Show »

FASTA43349,072
Isoform 2 (N-tes) [UniParc].

Checksum: 6607E14FC72D4F44
Show »

FASTA31635,950
Isoform 4 [UniParc].

Checksum: 00E0842D266E4A83
Show »

FASTA38544,061
Isoform 5 [UniParc].

Checksum: 2259AE11269F6627
Show »

FASTA33838,282
Isoform 6 [UniParc].

Checksum: 46149953687E2F86
Show »

FASTA34038,678
Isoform 7 [UniParc].

Checksum: 8E585B9CAF41679D
Show »

FASTA31636,153
Isoform 8 [UniParc].

Checksum: 6BAF82C67C0F0A0C
Show »

FASTA39344,272
Isoform 9 [UniParc].

Checksum: 2C98BC69CACE0802
Show »

FASTA31335,592

References

« Hide 'large scale' references
[1]"Cloning and expression of testican-3, a novel member of brain-specific, calcium-binding proteoglycans."
Vannahme C., Hartmann U., Goesling S., Kohfeldt E., Timpl R., Paulsson M., Maurer P.
Submitted (SEP-1997) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3).
Tissue: Brain.
[2]"Suppression of membrane-type 1 matrix metalloproteinase (MMP)-mediated MMP-2 activation and tumor invasion by testican 3 and its splicing variant gene product, N-Tes."
Nakada M., Yamada A., Takino T., Miyamori H., Takahashi T., Yamashita J., Sato H.
Cancer Res. 61:8896-8902(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), CHARACTERIZATION.
Tissue: Fetal kidney.
[3]"The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment."
Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P., Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E. expand/collapse author list , Heldens S., Huang A., Kim H.S., Klimowski L., Jin Y., Johnson S., Lee J., Lewis L., Liao D., Mark M.R., Robbie E., Sanchez C., Schoenfeld J., Seshagiri S., Simmons L., Singh J., Smith V., Stinson J., Vagts A., Vandlen R.L., Watanabe C., Wieand D., Woods K., Xie M.-H., Yansura D.G., Yi S., Yu G., Yuan J., Zhang M., Zhang Z., Goddard A.D., Wood W.I., Godowski P.J., Gray A.M.
Genome Res. 13:2265-2270(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
[4]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 3; 4; 5; 6 AND 7).
Tissue: Brain, Caudate nucleus and Corpus callosum.
[5]"Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. expand/collapse author list , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[6]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[7]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Lung and Muscle.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AJ001454 mRNA. Translation: CAA04775.1.
AB056866 mRNA. Translation: BAB64908.1.
AY358973 mRNA. Translation: AAQ89332.1.
AK091078 mRNA. Translation: BAG52279.1.
AK295281 mRNA. Translation: BAG58265.1.
AK295407 mRNA. Translation: BAG58358.1.
AK294637 mRNA. Translation: BAG57816.1.
AK295015 mRNA. Translation: BAG58075.1.
AK313042 mRNA. Translation: BAG35874.1.
AC010103 Genomic DNA. No translation available.
AC020599 Genomic DNA. No translation available.
AC023492 Genomic DNA. No translation available.
AC107210 Genomic DNA. No translation available.
CH471056 Genomic DNA. Translation: EAX04811.1.
BC000460 mRNA. Translation: AAH00460.1.
BC003017 mRNA. Translation: AAH03017.1.
BC013983 mRNA. Translation: AAH13983.1.
RefSeqNP_001035249.1. NM_001040159.1.
NP_001191281.1. NM_001204352.1.
NP_001191282.1. NM_001204353.1.
NP_001191283.1. NM_001204354.1.
NP_001191284.1. NM_001204355.1.
NP_001191287.1. NM_001204358.1.
NP_001238896.1. NM_001251967.1.
NP_058646.2. NM_016950.2.
UniGeneHs.481133.

3D structure databases

ProteinModelPortalQ9BQ16.
SMRQ9BQ16. Positions 89-313, 317-381.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid119160. 3 interactions.
IntActQ9BQ16. 2 interactions.
MINTMINT-4830490.
STRING9606.ENSP00000350153.

Protein family/group databases

MEROPSI01.980.

PTM databases

PhosphoSiteQ9BQ16.

Polymorphism databases

DMDM67473703.

Proteomic databases

PaxDbQ9BQ16.
PRIDEQ9BQ16.

Protocols and materials databases

DNASU50859.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000357154; ENSP00000349677; ENSG00000196104. [Q9BQ16-3]
ENST00000357545; ENSP00000350153; ENSG00000196104. [Q9BQ16-1]
ENST00000421836; ENSP00000411344; ENSG00000196104. [Q9BQ16-4]
ENST00000502330; ENSP00000423606; ENSG00000196104. [Q9BQ16-3]
ENST00000504953; ENSP00000425570; ENSG00000196104. [Q9BQ16-1]
ENST00000506886; ENSP00000420920; ENSG00000196104. [Q9BQ16-3]
ENST00000510741; ENSP00000426716; ENSG00000196104. [Q9BQ16-8]
ENST00000511269; ENSP00000425502; ENSG00000196104. [Q9BQ16-1]
ENST00000511531; ENSP00000423421; ENSG00000196104. [Q9BQ16-3]
ENST00000512648; ENSP00000426177; ENSG00000196104. [Q9BQ16-9]
ENST00000512681; ENSP00000426318; ENSG00000196104. [Q9BQ16-5]
ENST00000534949; ENSP00000438142; ENSG00000196104. [Q9BQ16-6]
ENST00000541354; ENSP00000444789; ENSG00000196104. [Q9BQ16-7]
ENST00000541637; ENSP00000445430; ENSG00000196104. [Q9BQ16-5]
GeneID50859.
KEGGhsa:50859.
UCSCuc003iri.1. human. [Q9BQ16-3]
uc003irj.1. human. [Q9BQ16-1]
uc011cjs.1. human. [Q9BQ16-4]
uc011cjv.1. human.

Organism-specific databases

CTD50859.
GeneCardsGC04M167654.
HGNCHGNC:13565. SPOCK3.
MIM607989. gene.
neXtProtNX_Q9BQ16.
PharmGKBPA134977377.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG244822.
HOGENOMHOG000293295.
HOVERGENHBG026595.
InParanoidQ9BQ16.
KOK08136.
OMARLTHSMK.
OrthoDBEOG7ZPNJX.
PhylomeDBQ9BQ16.
TreeFamTF317779.

Gene expression databases

ArrayExpressQ9BQ16.
BgeeQ9BQ16.
CleanExHS_SPOCK3.
GenevestigatorQ9BQ16.

Family and domain databases

Gene3D1.10.238.10. 1 hit.
4.10.800.10. 1 hit.
InterProIPR011992. EF-hand-dom_pair.
IPR002350. Kazal_dom.
IPR019577. SPARC/Testican_Ca-bd-dom.
IPR000716. Thyroglobulin_1.
[Graphical view]
PfamPF07648. Kazal_2. 1 hit.
PF10591. SPARC_Ca_bdg. 1 hit.
PF00086. Thyroglobulin_1. 1 hit.
[Graphical view]
SMARTSM00280. KAZAL. 1 hit.
SM00211. TY. 1 hit.
[Graphical view]
SUPFAMSSF57610. SSF57610. 1 hit.
PROSITEPS51465. KAZAL_2. 1 hit.
PS00484. THYROGLOBULIN_1_1. 1 hit.
PS51162. THYROGLOBULIN_1_2. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSSPOCK3. human.
GenomeRNAi50859.
NextBio53356.
PROQ9BQ16.
SOURCESearch...

Entry information

Entry nameTICN3_HUMAN
AccessionPrimary (citable) accession number: Q9BQ16
Secondary accession number(s): B2R7M7 expand/collapse secondary AC list , B3KR67, B4DGK5, B4DHB4, B4DHV3, B4DI46, E7EP61, F5H099, O75705, Q6UW53, Q96Q26
Entry history
Integrated into UniProtKB/Swiss-Prot: October 19, 2002
Last sequence update: May 10, 2005
Last modified: April 16, 2014
This is version 127 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 4

Human chromosome 4: entries, gene names and cross-references to MIM