Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9BQ16

- TICN3_HUMAN

UniProt

Q9BQ16 - TICN3_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Testican-3

Gene

SPOCK3

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

May participate in diverse steps of neurogenesis. Inhibits the processing of pro-matrix metalloproteinase 2 (MMP-2) by MT1-MMP and MT3-MMP. May interfere with tumor invasion.

GO - Molecular functioni

  1. calcium ion binding Source: InterPro
  2. glycosaminoglycan binding Source: Ensembl
  3. metalloendopeptidase inhibitor activity Source: UniProtKB

GO - Biological processi

  1. negative regulation of endopeptidase activity Source: UniProtKB
  2. peptide cross-linking via chondroitin 4-sulfate glycosaminoglycan Source: Ensembl
  3. signal transduction Source: InterPro
Complete GO annotation...

Keywords - Molecular functioni

Metalloenzyme inhibitor, Metalloprotease inhibitor, Protease inhibitor

Keywords - Ligandi

Calcium

Protein family/group databases

MEROPSiI01.980.

Names & Taxonomyi

Protein namesi
Recommended name:
Testican-3
Alternative name(s):
SPARC/osteonectin, CWCV, and Kazal-like domains proteoglycan 3
Gene namesi
Name:SPOCK3
Synonyms:TICN3
ORF Names:UNQ409/PRO771
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 4

Organism-specific databases

HGNCiHGNC:13565. SPOCK3.

Subcellular locationi

GO - Cellular componenti

  1. extracellular matrix Source: UniProtKB
  2. extracellular space Source: UniProtKB
  3. proteinaceous extracellular matrix Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Extracellular matrix, Secreted

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134977377.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2121Sequence AnalysisAdd
BLAST
Chaini22 – 436415Testican-3PRO_0000026703Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi90 ↔ 101By similarity
Disulfide bondi95 ↔ 111By similarity
Disulfide bondi139 ↔ 169By similarity
Disulfide bondi142 ↔ 162By similarity
Disulfide bondi151 ↔ 183By similarity
Disulfide bondi317 ↔ 341By similarity
Disulfide bondi352 ↔ 359By similarity
Disulfide bondi361 ↔ 380By similarity
Glycosylationi387 – 3871O-linked (Xyl...) (glycosaminoglycan)Sequence Analysis
Glycosylationi392 – 3921O-linked (Xyl...) (glycosaminoglycan)Sequence Analysis

Post-translational modificationi

Contains chondroitin sulfate and heparan sulfate O-linked oligosaccharides.By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein, Heparan sulfate, Proteoglycan

Proteomic databases

PaxDbiQ9BQ16.
PRIDEiQ9BQ16.

PTM databases

PhosphoSiteiQ9BQ16.

Expressioni

Tissue specificityi

Expressed in brain.

Gene expression databases

BgeeiQ9BQ16.
CleanExiHS_SPOCK3.
ExpressionAtlasiQ9BQ16. baseline and differential.
GenevestigatoriQ9BQ16.

Interactioni

Protein-protein interaction databases

BioGridi119160. 3 interactions.
IntActiQ9BQ16. 2 interactions.
MINTiMINT-4830490.
STRINGi9606.ENSP00000350153.

Structurei

3D structure databases

ProteinModelPortaliQ9BQ16.
SMRiQ9BQ16. Positions 89-313, 317-381.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini133 – 18553Kazal-likePROSITE-ProRule annotationAdd
BLAST
Domaini314 – 38067Thyroglobulin type-1PROSITE-ProRule annotationAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi394 – 43643Asp-richAdd
BLAST

Sequence similaritiesi

Contains 1 Kazal-like domain.PROSITE-ProRule annotation
Contains 1 thyroglobulin type-1 domain.PROSITE-ProRule annotation

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiNOG244822.
GeneTreeiENSGT00510000046429.
HOGENOMiHOG000293295.
HOVERGENiHBG026595.
InParanoidiQ9BQ16.
KOiK08136.
OMAiLTHSMKE.
OrthoDBiEOG7ZPNJX.
PhylomeDBiQ9BQ16.
TreeFamiTF317779.

Family and domain databases

Gene3Di1.10.238.10. 1 hit.
4.10.800.10. 1 hit.
InterProiIPR011992. EF-hand-dom_pair.
IPR002350. Kazal_dom.
IPR019577. SPARC/Testican_Ca-bd-dom.
IPR000716. Thyroglobulin_1.
[Graphical view]
PfamiPF07648. Kazal_2. 1 hit.
PF10591. SPARC_Ca_bdg. 1 hit.
PF00086. Thyroglobulin_1. 1 hit.
[Graphical view]
SMARTiSM00280. KAZAL. 1 hit.
SM00211. TY. 1 hit.
[Graphical view]
SUPFAMiSSF57610. SSF57610. 1 hit.
PROSITEiPS51465. KAZAL_2. 1 hit.
PS00484. THYROGLOBULIN_1_1. 1 hit.
PS51162. THYROGLOBULIN_1_2. 1 hit.
[Graphical view]

Sequences (9)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 9 isoformsi produced by alternative splicing. Align

Isoform 3 (identifier: Q9BQ16-3) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MLKVSAVLCV CAAAWCSQSL AAAAAVAAAG GRSDGGNFLD DKQWLTTISQ
60 70 80 90 100
YDKEVGQWNK FRDEVEDDYF RTWSPGKPFD QALDPAKDPC LKMKCSRHKV
110 120 130 140 150
CIAQDSQTAV CISHRRLTHR MKEAGVDHRQ WRGPILSTCK QCPVVYPSPV
160 170 180 190 200
CGSDGHTYSF QCKLEYQACV LGKQISVKCE GHCPCPSDKP TSTSRNVKRA
210 220 230 240 250
CSDLEFREVA NRLRDWFKAL HESGSQNKKT KTLLRPERSR FDTSILPICK
260 270 280 290 300
DSLGWMFNRL DTNYDLLLDQ SELRSIYLDK NEQCTKAFFN SCDTYKDSLI
310 320 330 340 350
SNNEWCYCFQ RQQDPPCQTE LSNIQKRQGV KKLLGQYIPL CDEDGYYKPT
360 370 380 390 400
QCHGSVGQCW CVDRYGNEVM GSRINGVADC AIDFEISGDF ASGDFHEWTD
410 420 430
DEDDEDDIMN DEDEIEDDDE DEGDDDDGGD DHDVYI
Length:436
Mass (Da):49,429
Last modified:May 10, 2005 - v2
Checksum:iAAEDD1998C656FC0
GO
Isoform 1 (identifier: Q9BQ16-1) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     64-66: Missing.

Show »
Length:433
Mass (Da):49,072
Checksum:iB697CDE58F7028AF
GO
Isoform 2 (identifier: Q9BQ16-2) [UniParc]FASTAAdd to Basket

Also known as: N-tes

The sequence of this isoform differs from the canonical sequence as follows:
     314-316: DPP → GKR
     317-436: Missing.

Show »
Length:316
Mass (Da):35,950
Checksum:i6607E14FC72D4F44
GO
Isoform 4 (identifier: Q9BQ16-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-66: MLKVSAVLCV...QWNKFRDEVE → MITQDHIHMSSGLSQ

Note: No experimental confirmation available.

Show »
Length:385
Mass (Da):44,061
Checksum:i00E0842D266E4A83
GO
Isoform 5 (identifier: Q9BQ16-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     64-161: Missing.

Show »
Length:338
Mass (Da):38,282
Checksum:i2259AE11269F6627
GO
Isoform 6 (identifier: Q9BQ16-6) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-24: MLKVSAVLCVCAAAWCSQSLAAAA → MINNGSPQSLSMTRKSDSGTNSET
     25-120: Missing.

Note: No experimental confirmation available.

Show »
Length:340
Mass (Da):38,678
Checksum:i46149953687E2F86
GO
Isoform 7 (identifier: Q9BQ16-7) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-120: Missing.

Show »
Length:316
Mass (Da):36,153
Checksum:i8E585B9CAF41679D
GO
Isoform 8 (identifier: Q9BQ16-8) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     64-66: Missing.
     200-240: ACSDLEFREVANRLRDWFKALHESGSQNKKTKTLLRPERSR → G

Note: No experimental confirmation available.

Show »
Length:393
Mass (Da):44,272
Checksum:i6BAF82C67C0F0A0C
GO
Isoform 9 (identifier: Q9BQ16-9) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     64-66: Missing.
     314-316: DPP → GKR
     317-436: Missing.

Note: No experimental confirmation available.

Show »
Length:313
Mass (Da):35,592
Checksum:i2C98BC69CACE0802
GO

Sequence cautioni

The sequence BAG58995.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti348 – 3481K → M in CAA04775. 1 PublicationCurated
Sequence conflicti405 – 4051E → G in BAG58265. (PubMed:14702039)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti112 – 1121I → V.
Corresponds to variant rs9685645 [ dbSNP | Ensembl ].
VAR_051562

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 120120Missing in isoform 7. 1 PublicationVSP_046686Add
BLAST
Alternative sequencei1 – 6666MLKVS…RDEVE → MITQDHIHMSSGLSQ in isoform 4. 1 PublicationVSP_043681Add
BLAST
Alternative sequencei1 – 2424MLKVS…LAAAA → MINNGSPQSLSMTRKSDSGT NSET in isoform 6. 1 PublicationVSP_045899Add
BLAST
Alternative sequencei25 – 12096Missing in isoform 6. 1 PublicationVSP_045900Add
BLAST
Alternative sequencei64 – 16198Missing in isoform 5. 1 PublicationVSP_045104Add
BLAST
Alternative sequencei64 – 663Missing in isoform 1, isoform 8 and isoform 9. 2 PublicationsVSP_013598
Alternative sequencei200 – 24041ACSDL…PERSR → G in isoform 8. 1 PublicationVSP_046687Add
BLAST
Alternative sequencei314 – 3163DPP → GKR in isoform 2 and isoform 9. 1 PublicationVSP_005334
Alternative sequencei317 – 436120Missing in isoform 2 and isoform 9. 1 PublicationVSP_005335Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AJ001454 mRNA. Translation: CAA04775.1.
AB056866 mRNA. Translation: BAB64908.1.
AY358973 mRNA. Translation: AAQ89332.1.
AK091078 mRNA. Translation: BAG52279.1.
AK295281 mRNA. Translation: BAG58265.1.
AK295407 mRNA. Translation: BAG58358.1.
AK294637 mRNA. Translation: BAG57816.1.
AK295015 mRNA. Translation: BAG58075.1.
AK296291 mRNA. Translation: BAG58995.1. Different initiation.
AK313042 mRNA. Translation: BAG35874.1.
AC010103 Genomic DNA. No translation available.
AC020599 Genomic DNA. No translation available.
AC023492 Genomic DNA. No translation available.
AC107210 Genomic DNA. No translation available.
CH471056 Genomic DNA. Translation: EAX04811.1.
BC000460 mRNA. Translation: AAH00460.1.
BC003017 mRNA. Translation: AAH03017.1.
BC013983 mRNA. Translation: AAH13983.1.
CCDSiCCDS34095.1. [Q9BQ16-1]
CCDS54817.1. [Q9BQ16-3]
CCDS56343.1. [Q9BQ16-7]
CCDS56344.1. [Q9BQ16-4]
CCDS56346.1. [Q9BQ16-8]
CCDS56347.1. [Q9BQ16-9]
CCDS58931.1. [Q9BQ16-5]
RefSeqiNP_001035249.1. NM_001040159.1. [Q9BQ16-1]
NP_001191281.1. NM_001204352.1. [Q9BQ16-4]
NP_001191282.1. NM_001204353.1. [Q9BQ16-7]
NP_001191283.1. NM_001204354.1.
NP_001191284.1. NM_001204355.1. [Q9BQ16-6]
NP_001191285.1. NM_001204356.1. [Q9BQ16-8]
NP_001191287.1. NM_001204358.1. [Q9BQ16-9]
NP_001238896.1. NM_001251967.1. [Q9BQ16-5]
NP_058646.2. NM_016950.2. [Q9BQ16-3]
UniGeneiHs.481133.

Genome annotation databases

EnsembliENST00000357154; ENSP00000349677; ENSG00000196104. [Q9BQ16-3]
ENST00000357545; ENSP00000350153; ENSG00000196104. [Q9BQ16-1]
ENST00000421836; ENSP00000411344; ENSG00000196104. [Q9BQ16-4]
ENST00000502330; ENSP00000423606; ENSG00000196104. [Q9BQ16-3]
ENST00000504953; ENSP00000425570; ENSG00000196104. [Q9BQ16-1]
ENST00000506886; ENSP00000420920; ENSG00000196104. [Q9BQ16-3]
ENST00000510741; ENSP00000426716; ENSG00000196104. [Q9BQ16-8]
ENST00000511269; ENSP00000425502; ENSG00000196104. [Q9BQ16-1]
ENST00000511531; ENSP00000423421; ENSG00000196104. [Q9BQ16-3]
ENST00000512648; ENSP00000426177; ENSG00000196104. [Q9BQ16-9]
ENST00000512681; ENSP00000426318; ENSG00000196104. [Q9BQ16-5]
ENST00000541354; ENSP00000444789; ENSG00000196104. [Q9BQ16-7]
GeneIDi50859.
KEGGihsa:50859.
UCSCiuc003iri.1. human. [Q9BQ16-3]
uc003irj.1. human. [Q9BQ16-1]
uc011cjs.1. human. [Q9BQ16-4]
uc011cjv.1. human.

Polymorphism databases

DMDMi67473703.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AJ001454 mRNA. Translation: CAA04775.1 .
AB056866 mRNA. Translation: BAB64908.1 .
AY358973 mRNA. Translation: AAQ89332.1 .
AK091078 mRNA. Translation: BAG52279.1 .
AK295281 mRNA. Translation: BAG58265.1 .
AK295407 mRNA. Translation: BAG58358.1 .
AK294637 mRNA. Translation: BAG57816.1 .
AK295015 mRNA. Translation: BAG58075.1 .
AK296291 mRNA. Translation: BAG58995.1 . Different initiation.
AK313042 mRNA. Translation: BAG35874.1 .
AC010103 Genomic DNA. No translation available.
AC020599 Genomic DNA. No translation available.
AC023492 Genomic DNA. No translation available.
AC107210 Genomic DNA. No translation available.
CH471056 Genomic DNA. Translation: EAX04811.1 .
BC000460 mRNA. Translation: AAH00460.1 .
BC003017 mRNA. Translation: AAH03017.1 .
BC013983 mRNA. Translation: AAH13983.1 .
CCDSi CCDS34095.1. [Q9BQ16-1 ]
CCDS54817.1. [Q9BQ16-3 ]
CCDS56343.1. [Q9BQ16-7 ]
CCDS56344.1. [Q9BQ16-4 ]
CCDS56346.1. [Q9BQ16-8 ]
CCDS56347.1. [Q9BQ16-9 ]
CCDS58931.1. [Q9BQ16-5 ]
RefSeqi NP_001035249.1. NM_001040159.1. [Q9BQ16-1 ]
NP_001191281.1. NM_001204352.1. [Q9BQ16-4 ]
NP_001191282.1. NM_001204353.1. [Q9BQ16-7 ]
NP_001191283.1. NM_001204354.1.
NP_001191284.1. NM_001204355.1. [Q9BQ16-6 ]
NP_001191285.1. NM_001204356.1. [Q9BQ16-8 ]
NP_001191287.1. NM_001204358.1. [Q9BQ16-9 ]
NP_001238896.1. NM_001251967.1. [Q9BQ16-5 ]
NP_058646.2. NM_016950.2. [Q9BQ16-3 ]
UniGenei Hs.481133.

3D structure databases

ProteinModelPortali Q9BQ16.
SMRi Q9BQ16. Positions 89-313, 317-381.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 119160. 3 interactions.
IntActi Q9BQ16. 2 interactions.
MINTi MINT-4830490.
STRINGi 9606.ENSP00000350153.

Protein family/group databases

MEROPSi I01.980.

PTM databases

PhosphoSitei Q9BQ16.

Polymorphism databases

DMDMi 67473703.

Proteomic databases

PaxDbi Q9BQ16.
PRIDEi Q9BQ16.

Protocols and materials databases

DNASUi 50859.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000357154 ; ENSP00000349677 ; ENSG00000196104 . [Q9BQ16-3 ]
ENST00000357545 ; ENSP00000350153 ; ENSG00000196104 . [Q9BQ16-1 ]
ENST00000421836 ; ENSP00000411344 ; ENSG00000196104 . [Q9BQ16-4 ]
ENST00000502330 ; ENSP00000423606 ; ENSG00000196104 . [Q9BQ16-3 ]
ENST00000504953 ; ENSP00000425570 ; ENSG00000196104 . [Q9BQ16-1 ]
ENST00000506886 ; ENSP00000420920 ; ENSG00000196104 . [Q9BQ16-3 ]
ENST00000510741 ; ENSP00000426716 ; ENSG00000196104 . [Q9BQ16-8 ]
ENST00000511269 ; ENSP00000425502 ; ENSG00000196104 . [Q9BQ16-1 ]
ENST00000511531 ; ENSP00000423421 ; ENSG00000196104 . [Q9BQ16-3 ]
ENST00000512648 ; ENSP00000426177 ; ENSG00000196104 . [Q9BQ16-9 ]
ENST00000512681 ; ENSP00000426318 ; ENSG00000196104 . [Q9BQ16-5 ]
ENST00000541354 ; ENSP00000444789 ; ENSG00000196104 . [Q9BQ16-7 ]
GeneIDi 50859.
KEGGi hsa:50859.
UCSCi uc003iri.1. human. [Q9BQ16-3 ]
uc003irj.1. human. [Q9BQ16-1 ]
uc011cjs.1. human. [Q9BQ16-4 ]
uc011cjv.1. human.

Organism-specific databases

CTDi 50859.
GeneCardsi GC04M167654.
HGNCi HGNC:13565. SPOCK3.
MIMi 607989. gene.
neXtProti NX_Q9BQ16.
PharmGKBi PA134977377.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG244822.
GeneTreei ENSGT00510000046429.
HOGENOMi HOG000293295.
HOVERGENi HBG026595.
InParanoidi Q9BQ16.
KOi K08136.
OMAi LTHSMKE.
OrthoDBi EOG7ZPNJX.
PhylomeDBi Q9BQ16.
TreeFami TF317779.

Miscellaneous databases

ChiTaRSi SPOCK3. human.
GenomeRNAii 50859.
NextBioi 53356.
PROi Q9BQ16.
SOURCEi Search...

Gene expression databases

Bgeei Q9BQ16.
CleanExi HS_SPOCK3.
ExpressionAtlasi Q9BQ16. baseline and differential.
Genevestigatori Q9BQ16.

Family and domain databases

Gene3Di 1.10.238.10. 1 hit.
4.10.800.10. 1 hit.
InterProi IPR011992. EF-hand-dom_pair.
IPR002350. Kazal_dom.
IPR019577. SPARC/Testican_Ca-bd-dom.
IPR000716. Thyroglobulin_1.
[Graphical view ]
Pfami PF07648. Kazal_2. 1 hit.
PF10591. SPARC_Ca_bdg. 1 hit.
PF00086. Thyroglobulin_1. 1 hit.
[Graphical view ]
SMARTi SM00280. KAZAL. 1 hit.
SM00211. TY. 1 hit.
[Graphical view ]
SUPFAMi SSF57610. SSF57610. 1 hit.
PROSITEi PS51465. KAZAL_2. 1 hit.
PS00484. THYROGLOBULIN_1_1. 1 hit.
PS51162. THYROGLOBULIN_1_2. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Cloning and expression of testican-3, a novel member of brain-specific, calcium-binding proteoglycans."
    Vannahme C., Hartmann U., Goesling S., Kohfeldt E., Timpl R., Paulsson M., Maurer P.
    Submitted (SEP-1997) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3).
    Tissue: Brain.
  2. "Suppression of membrane-type 1 matrix metalloproteinase (MMP)-mediated MMP-2 activation and tumor invasion by testican 3 and its splicing variant gene product, N-Tes."
    Nakada M., Yamada A., Takino T., Miyamori H., Takahashi T., Yamashita J., Sato H.
    Cancer Res. 61:8896-8902(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), CHARACTERIZATION.
    Tissue: Fetal kidney.
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
  4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 3; 4; 5; 6 AND 7), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 38-356 (ISOFORM 8).
    Tissue: Brain, Caudate nucleus, Corpus callosum and Thalamus.
  5. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
    Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
    , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
    Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Lung and Muscle.

Entry informationi

Entry nameiTICN3_HUMAN
AccessioniPrimary (citable) accession number: Q9BQ16
Secondary accession number(s): B2R7M7
, B3KR67, B4DGK5, B4DHB4, B4DHV3, B4DI46, B4DJY3, E7EP61, F5H099, O75705, Q6UW53, Q96Q26
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 19, 2002
Last sequence update: May 10, 2005
Last modified: October 29, 2014
This is version 132 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3