Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Testican-3

Gene

SPOCK3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

May participate in diverse steps of neurogenesis. Inhibits the processing of pro-matrix metalloproteinase 2 (MMP-2) by MT1-MMP and MT3-MMP. May interfere with tumor invasion.

GO - Molecular functioni

GO - Biological processi

  • negative regulation of cell motility Source: ParkinsonsUK-UCL
  • negative regulation of endopeptidase activity Source: UniProtKB
  • peptide cross-linking via chondroitin 4-sulfate glycosaminoglycan Source: Ensembl
  • signal transduction Source: InterPro
Complete GO annotation...

Keywords - Molecular functioni

Metalloenzyme inhibitor, Metalloprotease inhibitor, Protease inhibitor

Keywords - Ligandi

Calcium

Enzyme and pathway databases

BioCyciZFISH:G66-33924-MONOMER.
ReactomeiR-HSA-1592389. Activation of Matrix Metalloproteinases.

Protein family/group databases

MEROPSiI31.007.

Names & Taxonomyi

Protein namesi
Recommended name:
Testican-3
Alternative name(s):
SPARC/osteonectin, CWCV, and Kazal-like domains proteoglycan 3
Gene namesi
Name:SPOCK3
Synonyms:TICN3
ORF Names:UNQ409/PRO771
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 4

Organism-specific databases

HGNCiHGNC:13565. SPOCK3.

Subcellular locationi

GO - Cellular componenti

  • extracellular matrix Source: UniProtKB
  • extracellular space Source: UniProtKB
  • proteinaceous extracellular matrix Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Extracellular matrix, Secreted

Pathology & Biotechi

Organism-specific databases

DisGeNETi50859.
OpenTargetsiENSG00000196104.
PharmGKBiPA134977377.

Polymorphism and mutation databases

BioMutaiSPOCK3.
DMDMi67473703.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 21Sequence analysisAdd BLAST21
ChainiPRO_000002670322 – 436Testican-3Add BLAST415

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi90 ↔ 101By similarity
Disulfide bondi95 ↔ 111By similarity
Disulfide bondi139 ↔ 169By similarity
Disulfide bondi142 ↔ 162By similarity
Disulfide bondi151 ↔ 183By similarity
Disulfide bondi317 ↔ 341By similarity
Disulfide bondi352 ↔ 359By similarity
Disulfide bondi361 ↔ 380By similarity
Glycosylationi387O-linked (Xyl...) (glycosaminoglycan)Sequence analysis1
Glycosylationi392O-linked (Xyl...) (glycosaminoglycan)Sequence analysis1

Post-translational modificationi

Contains chondroitin sulfate and heparan sulfate O-linked oligosaccharides.By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein, Heparan sulfate, Proteoglycan

Proteomic databases

PaxDbiQ9BQ16.
PeptideAtlasiQ9BQ16.
PRIDEiQ9BQ16.
TopDownProteomicsiQ9BQ16-2. [Q9BQ16-2]
Q9BQ16-3. [Q9BQ16-3]
Q9BQ16-5. [Q9BQ16-5]

PTM databases

iPTMnetiQ9BQ16.
PhosphoSitePlusiQ9BQ16.

Expressioni

Tissue specificityi

Expressed in brain.

Gene expression databases

BgeeiENSG00000196104.
CleanExiHS_SPOCK3.
ExpressionAtlasiQ9BQ16. baseline and differential.
GenevisibleiQ9BQ16. HS.

Interactioni

Protein-protein interaction databases

BioGridi119160. 4 interactors.
IntActiQ9BQ16. 2 interactors.
MINTiMINT-4830490.
STRINGi9606.ENSP00000349677.

Structurei

3D structure databases

ProteinModelPortaliQ9BQ16.
SMRiQ9BQ16.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini133 – 185Kazal-likePROSITE-ProRule annotationAdd BLAST53
Domaini314 – 380Thyroglobulin type-1PROSITE-ProRule annotationAdd BLAST67

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi394 – 436Asp-richAdd BLAST43

Sequence similaritiesi

Contains 1 Kazal-like domain.PROSITE-ProRule annotation
Contains 1 thyroglobulin type-1 domain.PROSITE-ProRule annotation

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiKOG3555. Eukaryota.
ENOG410Y6A8. LUCA.
GeneTreeiENSGT00510000046429.
HOGENOMiHOG000293295.
HOVERGENiHBG026595.
InParanoidiQ9BQ16.
KOiK08136.
OMAiRLTHSMK.
OrthoDBiEOG091G086I.
PhylomeDBiQ9BQ16.
TreeFamiTF317779.

Family and domain databases

Gene3Di1.10.238.10. 1 hit.
4.10.800.10. 1 hit.
InterProiIPR011992. EF-hand-dom_pair.
IPR002350. Kazal_dom.
IPR019577. SPARC/Testican_Ca-bd-dom.
IPR000716. Thyroglobulin_1.
[Graphical view]
PfamiPF07648. Kazal_2. 1 hit.
PF10591. SPARC_Ca_bdg. 1 hit.
PF00086. Thyroglobulin_1. 1 hit.
[Graphical view]
SMARTiSM00280. KAZAL. 1 hit.
SM00211. TY. 1 hit.
[Graphical view]
SUPFAMiSSF47473. SSF47473. 1 hit.
SSF57610. SSF57610. 1 hit.
PROSITEiPS51465. KAZAL_2. 1 hit.
PS00484. THYROGLOBULIN_1_1. 1 hit.
PS51162. THYROGLOBULIN_1_2. 1 hit.
[Graphical view]

Sequences (9)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 9 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 3 (identifier: Q9BQ16-3) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MLKVSAVLCV CAAAWCSQSL AAAAAVAAAG GRSDGGNFLD DKQWLTTISQ
60 70 80 90 100
YDKEVGQWNK FRDEVEDDYF RTWSPGKPFD QALDPAKDPC LKMKCSRHKV
110 120 130 140 150
CIAQDSQTAV CISHRRLTHR MKEAGVDHRQ WRGPILSTCK QCPVVYPSPV
160 170 180 190 200
CGSDGHTYSF QCKLEYQACV LGKQISVKCE GHCPCPSDKP TSTSRNVKRA
210 220 230 240 250
CSDLEFREVA NRLRDWFKAL HESGSQNKKT KTLLRPERSR FDTSILPICK
260 270 280 290 300
DSLGWMFNRL DTNYDLLLDQ SELRSIYLDK NEQCTKAFFN SCDTYKDSLI
310 320 330 340 350
SNNEWCYCFQ RQQDPPCQTE LSNIQKRQGV KKLLGQYIPL CDEDGYYKPT
360 370 380 390 400
QCHGSVGQCW CVDRYGNEVM GSRINGVADC AIDFEISGDF ASGDFHEWTD
410 420 430
DEDDEDDIMN DEDEIEDDDE DEGDDDDGGD DHDVYI
Length:436
Mass (Da):49,429
Last modified:May 10, 2005 - v2
Checksum:iAAEDD1998C656FC0
GO
Isoform 1 (identifier: Q9BQ16-1) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     64-66: Missing.

Show »
Length:433
Mass (Da):49,072
Checksum:iB697CDE58F7028AF
GO
Isoform 2 (identifier: Q9BQ16-2) [UniParc]FASTAAdd to basket
Also known as: N-tes

The sequence of this isoform differs from the canonical sequence as follows:
     314-316: DPP → GKR
     317-436: Missing.

Show »
Length:316
Mass (Da):35,950
Checksum:i6607E14FC72D4F44
GO
Isoform 4 (identifier: Q9BQ16-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-66: MLKVSAVLCV...QWNKFRDEVE → MITQDHIHMSSGLSQ

Note: No experimental confirmation available.
Show »
Length:385
Mass (Da):44,061
Checksum:i00E0842D266E4A83
GO
Isoform 5 (identifier: Q9BQ16-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     64-161: Missing.

Show »
Length:338
Mass (Da):38,282
Checksum:i2259AE11269F6627
GO
Isoform 6 (identifier: Q9BQ16-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-24: MLKVSAVLCVCAAAWCSQSLAAAA → MINNGSPQSLSMTRKSDSGTNSET
     25-120: Missing.

Note: No experimental confirmation available.
Show »
Length:340
Mass (Da):38,678
Checksum:i46149953687E2F86
GO
Isoform 7 (identifier: Q9BQ16-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-120: Missing.

Show »
Length:316
Mass (Da):36,153
Checksum:i8E585B9CAF41679D
GO
Isoform 8 (identifier: Q9BQ16-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     64-66: Missing.
     200-240: ACSDLEFREVANRLRDWFKALHESGSQNKKTKTLLRPERSR → G

Note: No experimental confirmation available.
Show »
Length:393
Mass (Da):44,272
Checksum:i6BAF82C67C0F0A0C
GO
Isoform 9 (identifier: Q9BQ16-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     64-66: Missing.
     314-316: DPP → GKR
     317-436: Missing.

Note: No experimental confirmation available.
Show »
Length:313
Mass (Da):35,592
Checksum:i2C98BC69CACE0802
GO

Sequence cautioni

The sequence BAG58995 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti348K → M in CAA04775 (Ref. 1) Curated1
Sequence conflicti405E → G in BAG58265 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_051562112I → V.Corresponds to variant rs9685645dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0466861 – 120Missing in isoform 7. 1 PublicationAdd BLAST120
Alternative sequenceiVSP_0436811 – 66MLKVS…RDEVE → MITQDHIHMSSGLSQ in isoform 4. 1 PublicationAdd BLAST66
Alternative sequenceiVSP_0458991 – 24MLKVS…LAAAA → MINNGSPQSLSMTRKSDSGT NSET in isoform 6. 1 PublicationAdd BLAST24
Alternative sequenceiVSP_04590025 – 120Missing in isoform 6. 1 PublicationAdd BLAST96
Alternative sequenceiVSP_04510464 – 161Missing in isoform 5. 1 PublicationAdd BLAST98
Alternative sequenceiVSP_01359864 – 66Missing in isoform 1, isoform 8 and isoform 9. 2 Publications3
Alternative sequenceiVSP_046687200 – 240ACSDL…PERSR → G in isoform 8. 1 PublicationAdd BLAST41
Alternative sequenceiVSP_005334314 – 316DPP → GKR in isoform 2 and isoform 9. 1 Publication3
Alternative sequenceiVSP_005335317 – 436Missing in isoform 2 and isoform 9. 1 PublicationAdd BLAST120

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ001454 mRNA. Translation: CAA04775.1.
AB056866 mRNA. Translation: BAB64908.1.
AY358973 mRNA. Translation: AAQ89332.1.
AK091078 mRNA. Translation: BAG52279.1.
AK295281 mRNA. Translation: BAG58265.1.
AK295407 mRNA. Translation: BAG58358.1.
AK294637 mRNA. Translation: BAG57816.1.
AK295015 mRNA. Translation: BAG58075.1.
AK296291 mRNA. Translation: BAG58995.1. Different initiation.
AK313042 mRNA. Translation: BAG35874.1.
AC010103 Genomic DNA. No translation available.
AC020599 Genomic DNA. No translation available.
AC023492 Genomic DNA. No translation available.
AC107210 Genomic DNA. No translation available.
CH471056 Genomic DNA. Translation: EAX04811.1.
BC000460 mRNA. Translation: AAH00460.1.
BC003017 mRNA. Translation: AAH03017.1.
BC013983 mRNA. Translation: AAH13983.1.
CCDSiCCDS34095.1. [Q9BQ16-1]
CCDS54817.1. [Q9BQ16-3]
CCDS56343.1. [Q9BQ16-7]
CCDS56344.1. [Q9BQ16-4]
CCDS56346.1. [Q9BQ16-8]
CCDS56347.1. [Q9BQ16-9]
CCDS58931.1. [Q9BQ16-5]
RefSeqiNP_001035249.1. NM_001040159.1. [Q9BQ16-1]
NP_001191281.1. NM_001204352.1. [Q9BQ16-4]
NP_001191282.1. NM_001204353.1. [Q9BQ16-7]
NP_001191283.1. NM_001204354.1.
NP_001191284.1. NM_001204355.1. [Q9BQ16-6]
NP_001191285.1. NM_001204356.1. [Q9BQ16-8]
NP_001191287.1. NM_001204358.1. [Q9BQ16-9]
NP_001238896.1. NM_001251967.1. [Q9BQ16-5]
NP_058646.2. NM_016950.2. [Q9BQ16-3]
XP_011530320.1. XM_011532018.1. [Q9BQ16-3]
XP_016863747.1. XM_017008258.1. [Q9BQ16-1]
UniGeneiHs.481133.

Genome annotation databases

EnsembliENST00000357154; ENSP00000349677; ENSG00000196104. [Q9BQ16-3]
ENST00000357545; ENSP00000350153; ENSG00000196104. [Q9BQ16-1]
ENST00000421836; ENSP00000411344; ENSG00000196104. [Q9BQ16-4]
ENST00000502330; ENSP00000423606; ENSG00000196104. [Q9BQ16-3]
ENST00000504953; ENSP00000425570; ENSG00000196104. [Q9BQ16-1]
ENST00000506886; ENSP00000420920; ENSG00000196104. [Q9BQ16-3]
ENST00000510741; ENSP00000426716; ENSG00000196104. [Q9BQ16-8]
ENST00000511269; ENSP00000425502; ENSG00000196104. [Q9BQ16-1]
ENST00000511531; ENSP00000423421; ENSG00000196104. [Q9BQ16-3]
ENST00000512648; ENSP00000426177; ENSG00000196104. [Q9BQ16-9]
ENST00000512681; ENSP00000426318; ENSG00000196104. [Q9BQ16-5]
ENST00000541354; ENSP00000444789; ENSG00000196104. [Q9BQ16-7]
GeneIDi50859.
KEGGihsa:50859.
UCSCiuc003iri.2. human. [Q9BQ16-3]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ001454 mRNA. Translation: CAA04775.1.
AB056866 mRNA. Translation: BAB64908.1.
AY358973 mRNA. Translation: AAQ89332.1.
AK091078 mRNA. Translation: BAG52279.1.
AK295281 mRNA. Translation: BAG58265.1.
AK295407 mRNA. Translation: BAG58358.1.
AK294637 mRNA. Translation: BAG57816.1.
AK295015 mRNA. Translation: BAG58075.1.
AK296291 mRNA. Translation: BAG58995.1. Different initiation.
AK313042 mRNA. Translation: BAG35874.1.
AC010103 Genomic DNA. No translation available.
AC020599 Genomic DNA. No translation available.
AC023492 Genomic DNA. No translation available.
AC107210 Genomic DNA. No translation available.
CH471056 Genomic DNA. Translation: EAX04811.1.
BC000460 mRNA. Translation: AAH00460.1.
BC003017 mRNA. Translation: AAH03017.1.
BC013983 mRNA. Translation: AAH13983.1.
CCDSiCCDS34095.1. [Q9BQ16-1]
CCDS54817.1. [Q9BQ16-3]
CCDS56343.1. [Q9BQ16-7]
CCDS56344.1. [Q9BQ16-4]
CCDS56346.1. [Q9BQ16-8]
CCDS56347.1. [Q9BQ16-9]
CCDS58931.1. [Q9BQ16-5]
RefSeqiNP_001035249.1. NM_001040159.1. [Q9BQ16-1]
NP_001191281.1. NM_001204352.1. [Q9BQ16-4]
NP_001191282.1. NM_001204353.1. [Q9BQ16-7]
NP_001191283.1. NM_001204354.1.
NP_001191284.1. NM_001204355.1. [Q9BQ16-6]
NP_001191285.1. NM_001204356.1. [Q9BQ16-8]
NP_001191287.1. NM_001204358.1. [Q9BQ16-9]
NP_001238896.1. NM_001251967.1. [Q9BQ16-5]
NP_058646.2. NM_016950.2. [Q9BQ16-3]
XP_011530320.1. XM_011532018.1. [Q9BQ16-3]
XP_016863747.1. XM_017008258.1. [Q9BQ16-1]
UniGeneiHs.481133.

3D structure databases

ProteinModelPortaliQ9BQ16.
SMRiQ9BQ16.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi119160. 4 interactors.
IntActiQ9BQ16. 2 interactors.
MINTiMINT-4830490.
STRINGi9606.ENSP00000349677.

Protein family/group databases

MEROPSiI31.007.

PTM databases

iPTMnetiQ9BQ16.
PhosphoSitePlusiQ9BQ16.

Polymorphism and mutation databases

BioMutaiSPOCK3.
DMDMi67473703.

Proteomic databases

PaxDbiQ9BQ16.
PeptideAtlasiQ9BQ16.
PRIDEiQ9BQ16.
TopDownProteomicsiQ9BQ16-2. [Q9BQ16-2]
Q9BQ16-3. [Q9BQ16-3]
Q9BQ16-5. [Q9BQ16-5]

Protocols and materials databases

DNASUi50859.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000357154; ENSP00000349677; ENSG00000196104. [Q9BQ16-3]
ENST00000357545; ENSP00000350153; ENSG00000196104. [Q9BQ16-1]
ENST00000421836; ENSP00000411344; ENSG00000196104. [Q9BQ16-4]
ENST00000502330; ENSP00000423606; ENSG00000196104. [Q9BQ16-3]
ENST00000504953; ENSP00000425570; ENSG00000196104. [Q9BQ16-1]
ENST00000506886; ENSP00000420920; ENSG00000196104. [Q9BQ16-3]
ENST00000510741; ENSP00000426716; ENSG00000196104. [Q9BQ16-8]
ENST00000511269; ENSP00000425502; ENSG00000196104. [Q9BQ16-1]
ENST00000511531; ENSP00000423421; ENSG00000196104. [Q9BQ16-3]
ENST00000512648; ENSP00000426177; ENSG00000196104. [Q9BQ16-9]
ENST00000512681; ENSP00000426318; ENSG00000196104. [Q9BQ16-5]
ENST00000541354; ENSP00000444789; ENSG00000196104. [Q9BQ16-7]
GeneIDi50859.
KEGGihsa:50859.
UCSCiuc003iri.2. human. [Q9BQ16-3]

Organism-specific databases

CTDi50859.
DisGeNETi50859.
GeneCardsiSPOCK3.
HGNCiHGNC:13565. SPOCK3.
MIMi607989. gene.
neXtProtiNX_Q9BQ16.
OpenTargetsiENSG00000196104.
PharmGKBiPA134977377.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3555. Eukaryota.
ENOG410Y6A8. LUCA.
GeneTreeiENSGT00510000046429.
HOGENOMiHOG000293295.
HOVERGENiHBG026595.
InParanoidiQ9BQ16.
KOiK08136.
OMAiRLTHSMK.
OrthoDBiEOG091G086I.
PhylomeDBiQ9BQ16.
TreeFamiTF317779.

Enzyme and pathway databases

BioCyciZFISH:G66-33924-MONOMER.
ReactomeiR-HSA-1592389. Activation of Matrix Metalloproteinases.

Miscellaneous databases

ChiTaRSiSPOCK3. human.
GenomeRNAii50859.
PROiQ9BQ16.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000196104.
CleanExiHS_SPOCK3.
ExpressionAtlasiQ9BQ16. baseline and differential.
GenevisibleiQ9BQ16. HS.

Family and domain databases

Gene3Di1.10.238.10. 1 hit.
4.10.800.10. 1 hit.
InterProiIPR011992. EF-hand-dom_pair.
IPR002350. Kazal_dom.
IPR019577. SPARC/Testican_Ca-bd-dom.
IPR000716. Thyroglobulin_1.
[Graphical view]
PfamiPF07648. Kazal_2. 1 hit.
PF10591. SPARC_Ca_bdg. 1 hit.
PF00086. Thyroglobulin_1. 1 hit.
[Graphical view]
SMARTiSM00280. KAZAL. 1 hit.
SM00211. TY. 1 hit.
[Graphical view]
SUPFAMiSSF47473. SSF47473. 1 hit.
SSF57610. SSF57610. 1 hit.
PROSITEiPS51465. KAZAL_2. 1 hit.
PS00484. THYROGLOBULIN_1_1. 1 hit.
PS51162. THYROGLOBULIN_1_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiTICN3_HUMAN
AccessioniPrimary (citable) accession number: Q9BQ16
Secondary accession number(s): B2R7M7
, B3KR67, B4DGK5, B4DHB4, B4DHV3, B4DI46, B4DJY3, E7EP61, F5H099, O75705, Q6UW53, Q96Q26
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 19, 2002
Last sequence update: May 10, 2005
Last modified: November 2, 2016
This is version 149 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.