Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9BQ16

- TICN3_HUMAN

UniProt

Q9BQ16 - TICN3_HUMAN

Protein

Testican-3

Gene

SPOCK3

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 131 (01 Oct 2014)
      Sequence version 2 (10 May 2005)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    May participate in diverse steps of neurogenesis. Inhibits the processing of pro-matrix metalloproteinase 2 (MMP-2) by MT1-MMP and MT3-MMP. May interfere with tumor invasion.

    GO - Molecular functioni

    1. calcium ion binding Source: InterPro
    2. glycosaminoglycan binding Source: Ensembl
    3. metalloendopeptidase inhibitor activity Source: UniProtKB

    GO - Biological processi

    1. negative regulation of endopeptidase activity Source: UniProtKB
    2. peptide cross-linking via chondroitin 4-sulfate glycosaminoglycan Source: Ensembl
    3. signal transduction Source: InterPro

    Keywords - Molecular functioni

    Metalloenzyme inhibitor, Metalloprotease inhibitor, Protease inhibitor

    Keywords - Ligandi

    Calcium

    Protein family/group databases

    MEROPSiI01.980.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Testican-3
    Alternative name(s):
    SPARC/osteonectin, CWCV, and Kazal-like domains proteoglycan 3
    Gene namesi
    Name:SPOCK3
    Synonyms:TICN3
    ORF Names:UNQ409/PRO771
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 4

    Organism-specific databases

    HGNCiHGNC:13565. SPOCK3.

    Subcellular locationi

    GO - Cellular componenti

    1. extracellular matrix Source: UniProtKB
    2. extracellular space Source: UniProtKB
    3. proteinaceous extracellular matrix Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Extracellular matrix, Secreted

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA134977377.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 2121Sequence AnalysisAdd
    BLAST
    Chaini22 – 436415Testican-3PRO_0000026703Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Disulfide bondi90 ↔ 101By similarity
    Disulfide bondi95 ↔ 111By similarity
    Disulfide bondi139 ↔ 169By similarity
    Disulfide bondi142 ↔ 162By similarity
    Disulfide bondi151 ↔ 183By similarity
    Disulfide bondi317 ↔ 341By similarity
    Disulfide bondi352 ↔ 359By similarity
    Disulfide bondi361 ↔ 380By similarity
    Glycosylationi387 – 3871O-linked (Xyl...) (glycosaminoglycan)Sequence Analysis
    Glycosylationi392 – 3921O-linked (Xyl...) (glycosaminoglycan)Sequence Analysis

    Post-translational modificationi

    Contains chondroitin sulfate and heparan sulfate O-linked oligosaccharides.By similarity

    Keywords - PTMi

    Disulfide bond, Glycoprotein, Heparan sulfate, Proteoglycan

    Proteomic databases

    PaxDbiQ9BQ16.
    PRIDEiQ9BQ16.

    PTM databases

    PhosphoSiteiQ9BQ16.

    Expressioni

    Tissue specificityi

    Expressed in brain.

    Gene expression databases

    ArrayExpressiQ9BQ16.
    BgeeiQ9BQ16.
    CleanExiHS_SPOCK3.
    GenevestigatoriQ9BQ16.

    Interactioni

    Protein-protein interaction databases

    BioGridi119160. 3 interactions.
    IntActiQ9BQ16. 2 interactions.
    MINTiMINT-4830490.
    STRINGi9606.ENSP00000350153.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9BQ16.
    SMRiQ9BQ16. Positions 89-313, 317-381.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini133 – 18553Kazal-likePROSITE-ProRule annotationAdd
    BLAST
    Domaini314 – 38067Thyroglobulin type-1PROSITE-ProRule annotationAdd
    BLAST

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi394 – 43643Asp-richAdd
    BLAST

    Sequence similaritiesi

    Contains 1 Kazal-like domain.PROSITE-ProRule annotation
    Contains 1 thyroglobulin type-1 domain.PROSITE-ProRule annotation

    Keywords - Domaini

    Signal

    Phylogenomic databases

    eggNOGiNOG244822.
    HOGENOMiHOG000293295.
    HOVERGENiHBG026595.
    InParanoidiQ9BQ16.
    KOiK08136.
    OMAiLTHSMKE.
    OrthoDBiEOG7ZPNJX.
    PhylomeDBiQ9BQ16.
    TreeFamiTF317779.

    Family and domain databases

    Gene3Di1.10.238.10. 1 hit.
    4.10.800.10. 1 hit.
    InterProiIPR011992. EF-hand-dom_pair.
    IPR002350. Kazal_dom.
    IPR019577. SPARC/Testican_Ca-bd-dom.
    IPR000716. Thyroglobulin_1.
    [Graphical view]
    PfamiPF07648. Kazal_2. 1 hit.
    PF10591. SPARC_Ca_bdg. 1 hit.
    PF00086. Thyroglobulin_1. 1 hit.
    [Graphical view]
    SMARTiSM00280. KAZAL. 1 hit.
    SM00211. TY. 1 hit.
    [Graphical view]
    SUPFAMiSSF57610. SSF57610. 1 hit.
    PROSITEiPS51465. KAZAL_2. 1 hit.
    PS00484. THYROGLOBULIN_1_1. 1 hit.
    PS51162. THYROGLOBULIN_1_2. 1 hit.
    [Graphical view]

    Sequences (9)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 9 isoformsi produced by alternative splicing. Align

    Isoform 3 (identifier: Q9BQ16-3) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MLKVSAVLCV CAAAWCSQSL AAAAAVAAAG GRSDGGNFLD DKQWLTTISQ    50
    YDKEVGQWNK FRDEVEDDYF RTWSPGKPFD QALDPAKDPC LKMKCSRHKV 100
    CIAQDSQTAV CISHRRLTHR MKEAGVDHRQ WRGPILSTCK QCPVVYPSPV 150
    CGSDGHTYSF QCKLEYQACV LGKQISVKCE GHCPCPSDKP TSTSRNVKRA 200
    CSDLEFREVA NRLRDWFKAL HESGSQNKKT KTLLRPERSR FDTSILPICK 250
    DSLGWMFNRL DTNYDLLLDQ SELRSIYLDK NEQCTKAFFN SCDTYKDSLI 300
    SNNEWCYCFQ RQQDPPCQTE LSNIQKRQGV KKLLGQYIPL CDEDGYYKPT 350
    QCHGSVGQCW CVDRYGNEVM GSRINGVADC AIDFEISGDF ASGDFHEWTD 400
    DEDDEDDIMN DEDEIEDDDE DEGDDDDGGD DHDVYI 436
    Length:436
    Mass (Da):49,429
    Last modified:May 10, 2005 - v2
    Checksum:iAAEDD1998C656FC0
    GO
    Isoform 1 (identifier: Q9BQ16-1) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         64-66: Missing.

    Show »
    Length:433
    Mass (Da):49,072
    Checksum:iB697CDE58F7028AF
    GO
    Isoform 2 (identifier: Q9BQ16-2) [UniParc]FASTAAdd to Basket

    Also known as: N-tes

    The sequence of this isoform differs from the canonical sequence as follows:
         314-316: DPP → GKR
         317-436: Missing.

    Show »
    Length:316
    Mass (Da):35,950
    Checksum:i6607E14FC72D4F44
    GO
    Isoform 4 (identifier: Q9BQ16-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-66: MLKVSAVLCV...QWNKFRDEVE → MITQDHIHMSSGLSQ

    Note: No experimental confirmation available.

    Show »
    Length:385
    Mass (Da):44,061
    Checksum:i00E0842D266E4A83
    GO
    Isoform 5 (identifier: Q9BQ16-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         64-161: Missing.

    Show »
    Length:338
    Mass (Da):38,282
    Checksum:i2259AE11269F6627
    GO
    Isoform 6 (identifier: Q9BQ16-6) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-24: MLKVSAVLCVCAAAWCSQSLAAAA → MINNGSPQSLSMTRKSDSGTNSET
         25-120: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:340
    Mass (Da):38,678
    Checksum:i46149953687E2F86
    GO
    Isoform 7 (identifier: Q9BQ16-7) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-120: Missing.

    Show »
    Length:316
    Mass (Da):36,153
    Checksum:i8E585B9CAF41679D
    GO
    Isoform 8 (identifier: Q9BQ16-8) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         64-66: Missing.
         200-240: ACSDLEFREVANRLRDWFKALHESGSQNKKTKTLLRPERSR → G

    Note: No experimental confirmation available.

    Show »
    Length:393
    Mass (Da):44,272
    Checksum:i6BAF82C67C0F0A0C
    GO
    Isoform 9 (identifier: Q9BQ16-9) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         64-66: Missing.
         314-316: DPP → GKR
         317-436: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:313
    Mass (Da):35,592
    Checksum:i2C98BC69CACE0802
    GO

    Sequence cautioni

    The sequence BAG58995.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti348 – 3481K → M in CAA04775. 1 PublicationCurated
    Sequence conflicti405 – 4051E → G in BAG58265. (PubMed:14702039)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti112 – 1121I → V.
    Corresponds to variant rs9685645 [ dbSNP | Ensembl ].
    VAR_051562

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 120120Missing in isoform 7. 1 PublicationVSP_046686Add
    BLAST
    Alternative sequencei1 – 6666MLKVS…RDEVE → MITQDHIHMSSGLSQ in isoform 4. 1 PublicationVSP_043681Add
    BLAST
    Alternative sequencei1 – 2424MLKVS…LAAAA → MINNGSPQSLSMTRKSDSGT NSET in isoform 6. 1 PublicationVSP_045899Add
    BLAST
    Alternative sequencei25 – 12096Missing in isoform 6. 1 PublicationVSP_045900Add
    BLAST
    Alternative sequencei64 – 16198Missing in isoform 5. 1 PublicationVSP_045104Add
    BLAST
    Alternative sequencei64 – 663Missing in isoform 1, isoform 8 and isoform 9. 2 PublicationsVSP_013598
    Alternative sequencei200 – 24041ACSDL…PERSR → G in isoform 8. 1 PublicationVSP_046687Add
    BLAST
    Alternative sequencei314 – 3163DPP → GKR in isoform 2 and isoform 9. 1 PublicationVSP_005334
    Alternative sequencei317 – 436120Missing in isoform 2 and isoform 9. 1 PublicationVSP_005335Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AJ001454 mRNA. Translation: CAA04775.1.
    AB056866 mRNA. Translation: BAB64908.1.
    AY358973 mRNA. Translation: AAQ89332.1.
    AK091078 mRNA. Translation: BAG52279.1.
    AK295281 mRNA. Translation: BAG58265.1.
    AK295407 mRNA. Translation: BAG58358.1.
    AK294637 mRNA. Translation: BAG57816.1.
    AK295015 mRNA. Translation: BAG58075.1.
    AK296291 mRNA. Translation: BAG58995.1. Different initiation.
    AK313042 mRNA. Translation: BAG35874.1.
    AC010103 Genomic DNA. No translation available.
    AC020599 Genomic DNA. No translation available.
    AC023492 Genomic DNA. No translation available.
    AC107210 Genomic DNA. No translation available.
    CH471056 Genomic DNA. Translation: EAX04811.1.
    BC000460 mRNA. Translation: AAH00460.1.
    BC003017 mRNA. Translation: AAH03017.1.
    BC013983 mRNA. Translation: AAH13983.1.
    CCDSiCCDS34095.1. [Q9BQ16-1]
    CCDS54817.1. [Q9BQ16-3]
    CCDS56343.1. [Q9BQ16-7]
    CCDS56344.1. [Q9BQ16-4]
    CCDS56345.1. [Q9BQ16-6]
    CCDS56346.1. [Q9BQ16-8]
    CCDS56347.1. [Q9BQ16-9]
    CCDS58931.1. [Q9BQ16-5]
    RefSeqiNP_001035249.1. NM_001040159.1. [Q9BQ16-1]
    NP_001191281.1. NM_001204352.1. [Q9BQ16-4]
    NP_001191282.1. NM_001204353.1. [Q9BQ16-7]
    NP_001191283.1. NM_001204354.1.
    NP_001191284.1. NM_001204355.1. [Q9BQ16-6]
    NP_001191285.1. NM_001204356.1. [Q9BQ16-8]
    NP_001191287.1. NM_001204358.1. [Q9BQ16-9]
    NP_001238896.1. NM_001251967.1. [Q9BQ16-5]
    NP_058646.2. NM_016950.2. [Q9BQ16-3]
    UniGeneiHs.481133.

    Genome annotation databases

    EnsembliENST00000357154; ENSP00000349677; ENSG00000196104. [Q9BQ16-3]
    ENST00000357545; ENSP00000350153; ENSG00000196104. [Q9BQ16-1]
    ENST00000421836; ENSP00000411344; ENSG00000196104. [Q9BQ16-4]
    ENST00000502330; ENSP00000423606; ENSG00000196104. [Q9BQ16-3]
    ENST00000504953; ENSP00000425570; ENSG00000196104. [Q9BQ16-1]
    ENST00000506886; ENSP00000420920; ENSG00000196104. [Q9BQ16-3]
    ENST00000510741; ENSP00000426716; ENSG00000196104. [Q9BQ16-8]
    ENST00000511269; ENSP00000425502; ENSG00000196104. [Q9BQ16-1]
    ENST00000511531; ENSP00000423421; ENSG00000196104. [Q9BQ16-3]
    ENST00000512648; ENSP00000426177; ENSG00000196104. [Q9BQ16-9]
    ENST00000512681; ENSP00000426318; ENSG00000196104. [Q9BQ16-5]
    ENST00000535728; ENSP00000441396; ENSG00000196104.
    ENST00000541354; ENSP00000444789; ENSG00000196104. [Q9BQ16-7]
    GeneIDi50859.
    KEGGihsa:50859.
    UCSCiuc003iri.1. human. [Q9BQ16-3]
    uc003irj.1. human. [Q9BQ16-1]
    uc011cjs.1. human. [Q9BQ16-4]
    uc011cjv.1. human.

    Polymorphism databases

    DMDMi67473703.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AJ001454 mRNA. Translation: CAA04775.1 .
    AB056866 mRNA. Translation: BAB64908.1 .
    AY358973 mRNA. Translation: AAQ89332.1 .
    AK091078 mRNA. Translation: BAG52279.1 .
    AK295281 mRNA. Translation: BAG58265.1 .
    AK295407 mRNA. Translation: BAG58358.1 .
    AK294637 mRNA. Translation: BAG57816.1 .
    AK295015 mRNA. Translation: BAG58075.1 .
    AK296291 mRNA. Translation: BAG58995.1 . Different initiation.
    AK313042 mRNA. Translation: BAG35874.1 .
    AC010103 Genomic DNA. No translation available.
    AC020599 Genomic DNA. No translation available.
    AC023492 Genomic DNA. No translation available.
    AC107210 Genomic DNA. No translation available.
    CH471056 Genomic DNA. Translation: EAX04811.1 .
    BC000460 mRNA. Translation: AAH00460.1 .
    BC003017 mRNA. Translation: AAH03017.1 .
    BC013983 mRNA. Translation: AAH13983.1 .
    CCDSi CCDS34095.1. [Q9BQ16-1 ]
    CCDS54817.1. [Q9BQ16-3 ]
    CCDS56343.1. [Q9BQ16-7 ]
    CCDS56344.1. [Q9BQ16-4 ]
    CCDS56345.1. [Q9BQ16-6 ]
    CCDS56346.1. [Q9BQ16-8 ]
    CCDS56347.1. [Q9BQ16-9 ]
    CCDS58931.1. [Q9BQ16-5 ]
    RefSeqi NP_001035249.1. NM_001040159.1. [Q9BQ16-1 ]
    NP_001191281.1. NM_001204352.1. [Q9BQ16-4 ]
    NP_001191282.1. NM_001204353.1. [Q9BQ16-7 ]
    NP_001191283.1. NM_001204354.1.
    NP_001191284.1. NM_001204355.1. [Q9BQ16-6 ]
    NP_001191285.1. NM_001204356.1. [Q9BQ16-8 ]
    NP_001191287.1. NM_001204358.1. [Q9BQ16-9 ]
    NP_001238896.1. NM_001251967.1. [Q9BQ16-5 ]
    NP_058646.2. NM_016950.2. [Q9BQ16-3 ]
    UniGenei Hs.481133.

    3D structure databases

    ProteinModelPortali Q9BQ16.
    SMRi Q9BQ16. Positions 89-313, 317-381.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 119160. 3 interactions.
    IntActi Q9BQ16. 2 interactions.
    MINTi MINT-4830490.
    STRINGi 9606.ENSP00000350153.

    Protein family/group databases

    MEROPSi I01.980.

    PTM databases

    PhosphoSitei Q9BQ16.

    Polymorphism databases

    DMDMi 67473703.

    Proteomic databases

    PaxDbi Q9BQ16.
    PRIDEi Q9BQ16.

    Protocols and materials databases

    DNASUi 50859.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000357154 ; ENSP00000349677 ; ENSG00000196104 . [Q9BQ16-3 ]
    ENST00000357545 ; ENSP00000350153 ; ENSG00000196104 . [Q9BQ16-1 ]
    ENST00000421836 ; ENSP00000411344 ; ENSG00000196104 . [Q9BQ16-4 ]
    ENST00000502330 ; ENSP00000423606 ; ENSG00000196104 . [Q9BQ16-3 ]
    ENST00000504953 ; ENSP00000425570 ; ENSG00000196104 . [Q9BQ16-1 ]
    ENST00000506886 ; ENSP00000420920 ; ENSG00000196104 . [Q9BQ16-3 ]
    ENST00000510741 ; ENSP00000426716 ; ENSG00000196104 . [Q9BQ16-8 ]
    ENST00000511269 ; ENSP00000425502 ; ENSG00000196104 . [Q9BQ16-1 ]
    ENST00000511531 ; ENSP00000423421 ; ENSG00000196104 . [Q9BQ16-3 ]
    ENST00000512648 ; ENSP00000426177 ; ENSG00000196104 . [Q9BQ16-9 ]
    ENST00000512681 ; ENSP00000426318 ; ENSG00000196104 . [Q9BQ16-5 ]
    ENST00000535728 ; ENSP00000441396 ; ENSG00000196104 .
    ENST00000541354 ; ENSP00000444789 ; ENSG00000196104 . [Q9BQ16-7 ]
    GeneIDi 50859.
    KEGGi hsa:50859.
    UCSCi uc003iri.1. human. [Q9BQ16-3 ]
    uc003irj.1. human. [Q9BQ16-1 ]
    uc011cjs.1. human. [Q9BQ16-4 ]
    uc011cjv.1. human.

    Organism-specific databases

    CTDi 50859.
    GeneCardsi GC04M167654.
    HGNCi HGNC:13565. SPOCK3.
    MIMi 607989. gene.
    neXtProti NX_Q9BQ16.
    PharmGKBi PA134977377.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG244822.
    HOGENOMi HOG000293295.
    HOVERGENi HBG026595.
    InParanoidi Q9BQ16.
    KOi K08136.
    OMAi LTHSMKE.
    OrthoDBi EOG7ZPNJX.
    PhylomeDBi Q9BQ16.
    TreeFami TF317779.

    Miscellaneous databases

    ChiTaRSi SPOCK3. human.
    GenomeRNAii 50859.
    NextBioi 53356.
    PROi Q9BQ16.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q9BQ16.
    Bgeei Q9BQ16.
    CleanExi HS_SPOCK3.
    Genevestigatori Q9BQ16.

    Family and domain databases

    Gene3Di 1.10.238.10. 1 hit.
    4.10.800.10. 1 hit.
    InterProi IPR011992. EF-hand-dom_pair.
    IPR002350. Kazal_dom.
    IPR019577. SPARC/Testican_Ca-bd-dom.
    IPR000716. Thyroglobulin_1.
    [Graphical view ]
    Pfami PF07648. Kazal_2. 1 hit.
    PF10591. SPARC_Ca_bdg. 1 hit.
    PF00086. Thyroglobulin_1. 1 hit.
    [Graphical view ]
    SMARTi SM00280. KAZAL. 1 hit.
    SM00211. TY. 1 hit.
    [Graphical view ]
    SUPFAMi SSF57610. SSF57610. 1 hit.
    PROSITEi PS51465. KAZAL_2. 1 hit.
    PS00484. THYROGLOBULIN_1_1. 1 hit.
    PS51162. THYROGLOBULIN_1_2. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Cloning and expression of testican-3, a novel member of brain-specific, calcium-binding proteoglycans."
      Vannahme C., Hartmann U., Goesling S., Kohfeldt E., Timpl R., Paulsson M., Maurer P.
      Submitted (SEP-1997) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3).
      Tissue: Brain.
    2. "Suppression of membrane-type 1 matrix metalloproteinase (MMP)-mediated MMP-2 activation and tumor invasion by testican 3 and its splicing variant gene product, N-Tes."
      Nakada M., Yamada A., Takino T., Miyamori H., Takahashi T., Yamashita J., Sato H.
      Cancer Res. 61:8896-8902(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), CHARACTERIZATION.
      Tissue: Fetal kidney.
    3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 3; 4; 5; 6 AND 7), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 38-356 (ISOFORM 8).
      Tissue: Brain, Caudate nucleus, Corpus callosum and Thalamus.
    5. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
      Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
      , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
      Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Lung and Muscle.

    Entry informationi

    Entry nameiTICN3_HUMAN
    AccessioniPrimary (citable) accession number: Q9BQ16
    Secondary accession number(s): B2R7M7
    , B3KR67, B4DGK5, B4DHB4, B4DHV3, B4DI46, B4DJY3, E7EP61, F5H099, O75705, Q6UW53, Q96Q26
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: October 19, 2002
    Last sequence update: May 10, 2005
    Last modified: October 1, 2014
    This is version 131 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 4
      Human chromosome 4: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3