Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Homeodomain-only protein

Gene

HOPX

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Atypical homeodomain protein which does not bind DNA and is required to modulate cardiac growth and development. Acts via its interaction with SRF, thereby modulating the expression of SRF-dependent cardiac-specific genes and cardiac development. Prevents SRF-dependent transcription either by inhibiting SRF binding to DNA or by recruiting histone deacetylase (HDAC) proteins that prevent transcription by SRF. Overexpression causes cardiac hypertrophy (By similarity). May act as a tumor suppressor.By similarity

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
DNA bindingi3 – 62Homeobox; atypicalPROSITE-ProRule annotationAdd BLAST60

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Developmental protein, Repressor

Keywords - Biological processi

Transcription, Transcription regulation

Enzyme and pathway databases

BioCyciZFISH:ENSG00000171476-MONOMER.

Names & Taxonomyi

Protein namesi
Recommended name:
Homeodomain-only protein
Alternative name(s):
Lung cancer-associated Y protein
Not expressed in choriocarcinoma protein 1
Odd homeobox protein 1
Gene namesi
Name:HOPX
Synonyms:HOD, HOP, LAGY, NECC1, OB1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 4

Organism-specific databases

HGNCiHGNC:24961. HOPX.

Subcellular locationi

  • Nucleus By similarity
  • Cytoplasm By similarity

GO - Cellular componenti

  • cytoplasm Source: UniProtKB-SubCell
  • nucleus Source: MGI
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Keywords - Diseasei

Proto-oncogene

Organism-specific databases

DisGeNETi84525.
OpenTargetsiENSG00000171476.
PharmGKBiPA162391564.

Polymorphism and mutation databases

BioMutaiHOPX.
DMDMi60392394.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000491291 – 73Homeodomain-only proteinAdd BLAST73

Proteomic databases

PaxDbiQ9BPY8.
PeptideAtlasiQ9BPY8.
PRIDEiQ9BPY8.

PTM databases

PhosphoSitePlusiQ9BPY8.

Expressioni

Tissue specificityi

Widely expressed. Expressed in the heart, brain, placenta, lung, skeletal and smooth muscles, uterus, urinary bladder, kidney and spleen. Down-regulated in some types of cancer such as lung cancer, choriocarcinoma, head and neck squamous cell carcinoma and oral squamous cell carcinoma.2 Publications

Gene expression databases

BgeeiENSG00000171476.
CleanExiHS_HOPX.
GenevisibleiQ9BPY8. HS.

Organism-specific databases

HPAiCAB018632.
HPA030180.

Interactioni

Subunit structurei

Interacts with serum response factor (SRF). Component of a large complex containing histone deacetylases such as HDAC2 (By similarity).By similarity

Binary interactionsi

WithEntry#Exp.IntActNotes
TCF12Q990813EBI-10295883,EBI-722877

Protein-protein interaction databases

BioGridi124117. 10 interactors.
IntActiQ9BPY8. 2 interactors.
MINTiMINT-4534265.
STRINGi9606.ENSP00000450527.

Structurei

3D structure databases

ProteinModelPortaliQ9BPY8.
SMRiQ9BPY8.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Contains 1 homeobox DNA-binding domain.PROSITE-ProRule annotation

Keywords - Domaini

Homeobox

Phylogenomic databases

eggNOGiKOG0490. Eukaryota.
ENOG410YIJ3. LUCA.
GeneTreeiENSGT00390000017143.
HOGENOMiHOG000112932.
HOVERGENiHBG051921.
InParanoidiQ9BPY8.
OMAiKVSKHPD.
OrthoDBiEOG091G1BXE.
PhylomeDBiQ9BPY8.

Family and domain databases

Gene3Di1.10.10.60. 1 hit.
InterProiIPR001356. Homeobox_dom.
IPR009057. Homeodomain-like.
[Graphical view]
PfamiPF00046. Homeobox. 1 hit.
[Graphical view]
SMARTiSM00389. HOX. 1 hit.
[Graphical view]
SUPFAMiSSF46689. SSF46689. 1 hit.
PROSITEiPS50071. HOMEOBOX_2. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9BPY8-1) [UniParc]FASTAAdd to basket
Also known as: A

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSAETASGPT EDQVEILEYN FNKVDKHPDS TTLCLIAAEA GLSEEETQKW
60 70
FKQRLAKWRR SEGLPSECRS VTD
Length:73
Mass (Da):8,260
Last modified:June 1, 2001 - v1
Checksum:iCE65E4D2A8972022
GO
Isoform 2 (identifier: Q9BPY8-2) [UniParc]FASTAAdd to basket
Also known as: B

The sequence of this isoform differs from the canonical sequence as follows:
     49-73: KWFKQRLAKWRRSEGLPSECRSVTD → GSDLISRSKIWHPESSPQREGYPHDSLPCLAFDYFSLLPPQCKEMV

Show »
Length:94
Mass (Da):10,459
Checksum:iF7E5ACD6B4802FCA
GO
Isoform 3 (identifier: Q9BPY8-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MLIFLGCYRRRLEERAGTM

Note: Gene prediction based on EST data.
Show »
Length:91
Mass (Da):10,427
Checksum:i681B58491A5732B8
GO
Isoform 4 (identifier: Q9BPY8-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MLIFLGCYRRRLEERAGTM
     49-73: KWFKQRLAKWRRSEGLPSECRSVTD → GSDLISRSKIWHPESSPQREGYPHDSLPCLAFDYFSLLPPQCKEMV

Note: Gene prediction based on EST data.
Show »
Length:112
Mass (Da):12,625
Checksum:i6CD4F04C488F915D
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti72T → I in AAH14225 (PubMed:15489334).Curated1
Isoform 2 (identifier: Q9BPY8-2)
Sequence conflicti76P → L in AAM46830 (PubMed:14516659).Curated1
Sequence conflicti76P → L in AAM46831 (PubMed:14516659).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0472901M → MLIFLGCYRRRLEERAGTM in isoform 3 and isoform 4. Curated1
Alternative sequenceiVSP_01265949 – 73KWFKQ…RSVTD → GSDLISRSKIWHPESSPQRE GYPHDSLPCLAFDYFSLLPP QCKEMV in isoform 2 and isoform 4. 1 PublicationAdd BLAST25

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF492675 mRNA. Translation: AAM46827.1.
AF492676 mRNA. Translation: AAM46828.1.
AF492677 mRNA. Translation: AAM46829.1.
AF492678 mRNA. Translation: AAM46830.1.
AF492679 mRNA. Translation: AAM46831.1.
AF492680 mRNA. Translation: AAM46832.1.
AF492681 mRNA. Translation: AAM46833.1.
AB059408 mRNA. Translation: BAB40926.1.
AB059409 mRNA. Translation: BAB40927.1.
AB059410 mRNA. Translation: BAB40928.1.
AF454763 mRNA. Translation: AAL56613.1.
AK289707 mRNA. Translation: BAF82396.1.
AC108215 Genomic DNA. No translation available.
BC014225 mRNA. Translation: AAH14225.1.
CCDSiCCDS3507.1. [Q9BPY8-1]
CCDS47062.1. [Q9BPY8-3]
CCDS54767.1. [Q9BPY8-4]
RefSeqiNP_001138931.1. NM_001145459.1. [Q9BPY8-1]
NP_001138932.1. NM_001145460.1. [Q9BPY8-4]
NP_115884.4. NM_032495.5. [Q9BPY8-3]
NP_631957.1. NM_139211.4. [Q9BPY8-1]
NP_631958.1. NM_139212.3. [Q9BPY8-1]
XP_016864218.1. XM_017008729.1. [Q9BPY8-1]
XP_016864219.1. XM_017008730.1. [Q9BPY8-1]
XP_016864220.1. XM_017008731.1. [Q9BPY8-1]
XP_016864221.1. XM_017008732.1. [Q9BPY8-1]
XP_016864222.1. XM_017008733.1. [Q9BPY8-1]
XP_016864223.1. XM_017008734.1. [Q9BPY8-1]
UniGeneiHs.619396.

Genome annotation databases

EnsembliENST00000317745; ENSP00000315198; ENSG00000171476. [Q9BPY8-1]
ENST00000337881; ENSP00000337330; ENSG00000171476. [Q9BPY8-1]
ENST00000381255; ENSP00000370654; ENSG00000171476. [Q9BPY8-1]
ENST00000381260; ENSP00000370659; ENSG00000171476. [Q9BPY8-2]
ENST00000420433; ENSP00000396275; ENSG00000171476. [Q9BPY8-3]
ENST00000503639; ENSP00000424101; ENSG00000171476. [Q9BPY8-1]
ENST00000508121; ENSP00000422175; ENSG00000171476. [Q9BPY8-1]
ENST00000553379; ENSP00000452340; ENSG00000171476. [Q9BPY8-1]
ENST00000554144; ENSP00000450527; ENSG00000171476. [Q9BPY8-4]
ENST00000555760; ENSP00000452098; ENSG00000171476. [Q9BPY8-1]
ENST00000556376; ENSP00000451794; ENSG00000171476. [Q9BPY8-1]
ENST00000556614; ENSP00000452003; ENSG00000171476. [Q9BPY8-1]
GeneIDi84525.
KEGGihsa:84525.
UCSCiuc003hbz.3. human. [Q9BPY8-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF492675 mRNA. Translation: AAM46827.1.
AF492676 mRNA. Translation: AAM46828.1.
AF492677 mRNA. Translation: AAM46829.1.
AF492678 mRNA. Translation: AAM46830.1.
AF492679 mRNA. Translation: AAM46831.1.
AF492680 mRNA. Translation: AAM46832.1.
AF492681 mRNA. Translation: AAM46833.1.
AB059408 mRNA. Translation: BAB40926.1.
AB059409 mRNA. Translation: BAB40927.1.
AB059410 mRNA. Translation: BAB40928.1.
AF454763 mRNA. Translation: AAL56613.1.
AK289707 mRNA. Translation: BAF82396.1.
AC108215 Genomic DNA. No translation available.
BC014225 mRNA. Translation: AAH14225.1.
CCDSiCCDS3507.1. [Q9BPY8-1]
CCDS47062.1. [Q9BPY8-3]
CCDS54767.1. [Q9BPY8-4]
RefSeqiNP_001138931.1. NM_001145459.1. [Q9BPY8-1]
NP_001138932.1. NM_001145460.1. [Q9BPY8-4]
NP_115884.4. NM_032495.5. [Q9BPY8-3]
NP_631957.1. NM_139211.4. [Q9BPY8-1]
NP_631958.1. NM_139212.3. [Q9BPY8-1]
XP_016864218.1. XM_017008729.1. [Q9BPY8-1]
XP_016864219.1. XM_017008730.1. [Q9BPY8-1]
XP_016864220.1. XM_017008731.1. [Q9BPY8-1]
XP_016864221.1. XM_017008732.1. [Q9BPY8-1]
XP_016864222.1. XM_017008733.1. [Q9BPY8-1]
XP_016864223.1. XM_017008734.1. [Q9BPY8-1]
UniGeneiHs.619396.

3D structure databases

ProteinModelPortaliQ9BPY8.
SMRiQ9BPY8.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi124117. 10 interactors.
IntActiQ9BPY8. 2 interactors.
MINTiMINT-4534265.
STRINGi9606.ENSP00000450527.

PTM databases

PhosphoSitePlusiQ9BPY8.

Polymorphism and mutation databases

BioMutaiHOPX.
DMDMi60392394.

Proteomic databases

PaxDbiQ9BPY8.
PeptideAtlasiQ9BPY8.
PRIDEiQ9BPY8.

Protocols and materials databases

DNASUi84525.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000317745; ENSP00000315198; ENSG00000171476. [Q9BPY8-1]
ENST00000337881; ENSP00000337330; ENSG00000171476. [Q9BPY8-1]
ENST00000381255; ENSP00000370654; ENSG00000171476. [Q9BPY8-1]
ENST00000381260; ENSP00000370659; ENSG00000171476. [Q9BPY8-2]
ENST00000420433; ENSP00000396275; ENSG00000171476. [Q9BPY8-3]
ENST00000503639; ENSP00000424101; ENSG00000171476. [Q9BPY8-1]
ENST00000508121; ENSP00000422175; ENSG00000171476. [Q9BPY8-1]
ENST00000553379; ENSP00000452340; ENSG00000171476. [Q9BPY8-1]
ENST00000554144; ENSP00000450527; ENSG00000171476. [Q9BPY8-4]
ENST00000555760; ENSP00000452098; ENSG00000171476. [Q9BPY8-1]
ENST00000556376; ENSP00000451794; ENSG00000171476. [Q9BPY8-1]
ENST00000556614; ENSP00000452003; ENSG00000171476. [Q9BPY8-1]
GeneIDi84525.
KEGGihsa:84525.
UCSCiuc003hbz.3. human. [Q9BPY8-1]

Organism-specific databases

CTDi84525.
DisGeNETi84525.
GeneCardsiHOPX.
HGNCiHGNC:24961. HOPX.
HPAiCAB018632.
HPA030180.
MIMi607275. gene.
neXtProtiNX_Q9BPY8.
OpenTargetsiENSG00000171476.
PharmGKBiPA162391564.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0490. Eukaryota.
ENOG410YIJ3. LUCA.
GeneTreeiENSGT00390000017143.
HOGENOMiHOG000112932.
HOVERGENiHBG051921.
InParanoidiQ9BPY8.
OMAiKVSKHPD.
OrthoDBiEOG091G1BXE.
PhylomeDBiQ9BPY8.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000171476-MONOMER.

Miscellaneous databases

ChiTaRSiHOPX. human.
GeneWikiiHOPX.
GenomeRNAii84525.
PROiQ9BPY8.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000171476.
CleanExiHS_HOPX.
GenevisibleiQ9BPY8. HS.

Family and domain databases

Gene3Di1.10.10.60. 1 hit.
InterProiIPR001356. Homeobox_dom.
IPR009057. Homeodomain-like.
[Graphical view]
PfamiPF00046. Homeobox. 1 hit.
[Graphical view]
SMARTiSM00389. HOX. 1 hit.
[Graphical view]
SUPFAMiSSF46689. SSF46689. 1 hit.
PROSITEiPS50071. HOMEOBOX_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiHOP_HUMAN
AccessioniPrimary (citable) accession number: Q9BPY8
Secondary accession number(s): A8K0Z2
, E9PB55, G3V294, Q8N0V6, Q96CI1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 1, 2005
Last sequence update: June 1, 2001
Last modified: November 30, 2016
This is version 124 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.