Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9BPY8 (HOP_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 103. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (3) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Homeodomain-only protein
Alternative name(s):
Lung cancer-associated Y protein
Not expressed in choriocarcinoma protein 1
Odd homeobox protein 1
Gene names
Name:HOPX
Synonyms:HOD, HOP, LAGY, NECC1, OB1
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length73 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Atypical homeodomain protein which does not bind DNA and is required to modulate cardiac growth and development. Acts via its interaction with SRF, thereby modulating the expression of SRF-dependent cardiac-specific genes and cardiac development. Prevents SRF-dependent transcription either by inhibiting SRF binding to DNA or by recruiting histone deacetylase (HDAC) proteins that prevent transcription by SRF. Overexpression causes cardiac hypertrophy By similarity. May act as a tumor suppressor.

Subunit structure

Interacts with serum response factor (SRF). Component of a large complex containing histone deacetylases such as HDAC2 By similarity.

Subcellular location

Nucleus By similarity.

Tissue specificity

Widely expressed. Expressed in the heart, brain, placenta, lung, skeletal and smooth muscles, uterus, urinary bladder, kidney and spleen. Down-regulated in some types of cancer such as lung cancer, choriocarcinoma, head and neck squamous cell carcinoma and oral squamous cell carcinoma. Ref.2 Ref.3

Sequence similarities

Contains 1 homeobox DNA-binding domain.

Ontologies

Keywords
   Biological processTranscription
Transcription regulation
   Cellular componentNucleus
   Coding sequence diversityAlternative splicing
   DiseaseProto-oncogene
   DomainHomeobox
   Molecular functionDevelopmental protein
Repressor
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processheart development

Inferred from electronic annotation. Source: Ensembl

histone deacetylation

Inferred from electronic annotation. Source: Ensembl

lung alveolus development

Inferred from electronic annotation. Source: Ensembl

negative regulation of cell differentiation

Inferred from direct assay PubMed 17576768. Source: MGI

negative regulation of transcription from RNA polymerase II promoter

Inferred from electronic annotation. Source: Ensembl

positive regulation of skeletal muscle tissue regeneration

Inferred from electronic annotation. Source: Ensembl

positive regulation of striated muscle cell differentiation

Inferred from electronic annotation. Source: Ensembl

regulation of heart contraction

Inferred from electronic annotation. Source: Ensembl

regulation of protein binding

Inferred from electronic annotation. Source: Ensembl

transcription, DNA-templated

Inferred from electronic annotation. Source: UniProtKB-KW

trophectodermal cell differentiation

Inferred from direct assay PubMed 17576768. Source: MGI

   Cellular_componentnucleus

Inferred from direct assay PubMed 17192267. Source: MGI

   Molecular_functionsequence-specific DNA binding

Inferred from electronic annotation. Source: InterPro

sequence-specific DNA binding transcription factor activity

Inferred from electronic annotation. Source: InterPro

Complete GO annotation...

Alternative products

This entry describes 4 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q9BPY8-1)

Also known as: A;

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q9BPY8-2)

Also known as: B;

The sequence of this isoform differs from the canonical sequence as follows:
     49-73: KWFKQRLAKWRRSEGLPSECRSVTD → GSDLISRSKIWHPESSPQREGYPHDSLPCLAFDYFSLLPPQCKEMV
Isoform 3 (identifier: Q9BPY8-3)

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MLIFLGCYRRRLEERAGTM
Note: Gene prediction based on EST data.
Isoform 4 (identifier: Q9BPY8-4)

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MLIFLGCYRRRLEERAGTM
     49-73: KWFKQRLAKWRRSEGLPSECRSVTD → GSDLISRSKIWHPESSPQREGYPHDSLPCLAFDYFSLLPPQCKEMV
Note: Gene prediction based on EST data.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 7373Homeodomain-only protein
PRO_0000049129

Regions

DNA binding3 – 6260Homeobox; atypical

Natural variations

Alternative sequence11M → MLIFLGCYRRRLEERAGTM in isoform 3 and isoform 4.
VSP_047290
Alternative sequence49 – 7325KWFKQ…RSVTD → GSDLISRSKIWHPESSPQRE GYPHDSLPCLAFDYFSLLPP QCKEMV in isoform 2 and isoform 4.
VSP_012659

Experimental info

Sequence conflict721T → I in AAH14225. Ref.6
Isoform 2:
Sequence conflict761P → L in AAM46830. Ref.1
Sequence conflict761P → L in AAM46831. Ref.1

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 (A) [UniParc].

Last modified June 1, 2001. Version 1.
Checksum: CE65E4D2A8972022

FASTA738,260
        10         20         30         40         50         60 
MSAETASGPT EDQVEILEYN FNKVDKHPDS TTLCLIAAEA GLSEEETQKW FKQRLAKWRR 

        70 
SEGLPSECRS VTD 

« Hide

Isoform 2 (B) [UniParc].

Checksum: F7E5ACD6B4802FCA
Show »

FASTA9410,459
Isoform 3 [UniParc].

Checksum: 681B58491A5732B8
Show »

FASTA9110,427
Isoform 4 [UniParc].

Checksum: 6CD4F04C488F915D
Show »

FASTA11212,625

References

« Hide 'large scale' references
[1]"Expression of mOb1, a novel atypical 73 amino acid K50-homeodomain protein, during mouse development."
Adu J., Leong F.T., Smith N.R., Leek J.P., Markham A.F., Robinson P.A., Mighell A.J.
Mech. Dev. 119:S43-S47(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2).
Tissue: Heart.
[2]"NECC1, a candidate choriocarcinoma suppressor gene that encodes a homeodomain consensus motif."
Asanoma K., Matsuda T., Kondo H., Kato K., Kishino T., Niikawa N., Wake N., Kato H.
Genomics 81:15-25(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY, POSSIBLE INVOLVEMENT IN CHORIOCARCINOMA.
[3]"Identification of a novel homeobox-containing gene, LAGY, which is downregulated in lung cancer."
Chen Y., Petersen S., Pacyna-Gengelbach M., Pietas A., Petersen I.
Oncology 64:450-458(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY, POSSIBLE INVOLVEMENT IN LUNG CANCER.
[4]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Brain.
[5]"Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. expand/collapse author list , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[6]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: B-cell.
[7]"Loss of HOP tumour suppressor expression in head and neck squamous cell carcinoma."
Lemaire F., Millon R., Muller D., Rabouel Y., Bracco L., Abecassis J., Wasylyk B.
Br. J. Cancer 91:258-261(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: INVOLVEMENT IN HEAD AND NECK SQUAMOUS CELL CARCINOMA.
[8]"Association between gene expression profile and tumor invasion in oral squamous cell carcinoma."
Toruner G.A., Ulger C., Alkan M., Galante A.T., Rinaggio J., Wilk R., Tian B., Soteropoulos P., Hameed M.R., Schwalb M.N., Dermody J.J.
Cancer Genet. Cytogenet. 154:27-35(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: INVOLVEMENT IN ORAL SQUAMOUS CELL CARCINOMA.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF492675 mRNA. Translation: AAM46827.1.
AF492676 mRNA. Translation: AAM46828.1.
AF492677 mRNA. Translation: AAM46829.1.
AF492678 mRNA. Translation: AAM46830.1.
AF492679 mRNA. Translation: AAM46831.1.
AF492680 mRNA. Translation: AAM46832.1.
AF492681 mRNA. Translation: AAM46833.1.
AB059408 mRNA. Translation: BAB40926.1.
AB059409 mRNA. Translation: BAB40927.1.
AB059410 mRNA. Translation: BAB40928.1.
AF454763 mRNA. Translation: AAL56613.1.
AK289707 mRNA. Translation: BAF82396.1.
AC108215 Genomic DNA. No translation available.
BC014225 mRNA. Translation: AAH14225.1.
RefSeqNP_001138931.1. NM_001145459.1.
NP_001138932.1. NM_001145460.1.
NP_115884.4. NM_032495.5.
NP_631957.1. NM_139211.4.
NP_631958.1. NM_139212.3.
UniGeneHs.619396.

3D structure databases

ProteinModelPortalQ9BPY8.
SMRQ9BPY8. Positions 1-73.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid124117. 8 interactions.
MINTMINT-4534265.
STRING9606.ENSP00000370656.

Polymorphism databases

DMDM60392394.

Proteomic databases

PaxDbQ9BPY8.
PRIDEQ9BPY8.

Protocols and materials databases

DNASU84525.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000317745; ENSP00000315198; ENSG00000171476. [Q9BPY8-1]
ENST00000337881; ENSP00000337330; ENSG00000171476. [Q9BPY8-1]
ENST00000381255; ENSP00000370654; ENSG00000171476. [Q9BPY8-1]
ENST00000381260; ENSP00000370659; ENSG00000171476. [Q9BPY8-2]
ENST00000420433; ENSP00000396275; ENSG00000171476. [Q9BPY8-3]
ENST00000503639; ENSP00000424101; ENSG00000171476. [Q9BPY8-1]
ENST00000508121; ENSP00000422175; ENSG00000171476. [Q9BPY8-3]
ENST00000553379; ENSP00000452340; ENSG00000171476. [Q9BPY8-1]
ENST00000554144; ENSP00000450527; ENSG00000171476. [Q9BPY8-4]
ENST00000555760; ENSP00000452098; ENSG00000171476. [Q9BPY8-1]
ENST00000556376; ENSP00000451794; ENSG00000171476. [Q9BPY8-1]
ENST00000556614; ENSP00000452003; ENSG00000171476. [Q9BPY8-1]
GeneID84525.
KEGGhsa:84525.
UCSCuc003hbz.2. human. [Q9BPY8-1]

Organism-specific databases

CTD84525.
GeneCardsGC04M057514.
HGNCHGNC:24961. HOPX.
HPACAB018632.
HPA030180.
MIM607275. gene.
neXtProtNX_Q9BPY8.
PharmGKBPA162391564.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG319963.
HOGENOMHOG000112932.
HOVERGENHBG051921.
OMAFKLRNAQ.
OrthoDBEOG780RQF.
PhylomeDBQ9BPY8.

Gene expression databases

ArrayExpressQ9BPY8.
BgeeQ9BPY8.
CleanExHS_HOPX.
GenevestigatorQ9BPY8.

Family and domain databases

Gene3D1.10.10.60. 1 hit.
InterProIPR001356. Homeobox_dom.
IPR009057. Homeodomain-like.
[Graphical view]
PfamPF00046. Homeobox. 1 hit.
[Graphical view]
SMARTSM00389. HOX. 1 hit.
[Graphical view]
SUPFAMSSF46689. SSF46689. 1 hit.
PROSITEPS50071. HOMEOBOX_2. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSHOPX. human.
GeneWikiHOPX.
GenomeRNAi84525.
NextBio74351.
PROQ9BPY8.
SOURCESearch...

Entry information

Entry nameHOP_HUMAN
AccessionPrimary (citable) accession number: Q9BPY8
Secondary accession number(s): A8K0Z2 expand/collapse secondary AC list , E9PB55, G3V294, Q8N0V6, Q96CI1
Entry history
Integrated into UniProtKB/Swiss-Prot: February 1, 2005
Last sequence update: June 1, 2001
Last modified: April 16, 2014
This is version 103 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human chromosome 4

Human chromosome 4: entries, gene names and cross-references to MIM