Reviewed,
UniProtKB/Swiss-Prot Q9BPY8 (HOP_HUMAN)
Last modified
June 16, 2009.
Version 58.
History...
Clusters with 100%,
90%,
50% identity |
Documents (3) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Homeodomain-only protein Alternative name(s): Lung cancer-associated Y protein Odd homeobox protein 1 Not expressed in choriocarcinoma protein 1 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 73 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at transcript level. |
General annotation (Comments)
| Function | Atypical homeodomain protein which does not bind DNA and is required to modulate cardiac growth and development. Acts via its interaction with SRF, thereby modulating the expression of SRF-dependent cardiac-specific genes and cardiac development. Prevents SRF-dependent transcription either by inhibiting SRF binding to DNA or by recruiting histone deacetylase (HDAC) proteins that prevent transcription by SRF. Overexpression causes cardiac hypertrophy By similarity. May act as a tumor suppressor. |
| Subunit structure | Interacts with serum response factor (SRF). Component of a large complex containing histone deacetylases such as HDAC2 By similarity. |
| Subcellular location | Nucleus By similarity. |
| Tissue specificity | Widely expressed. Expressed in the heart, brain, placenta, lung, skeletal and smooth muscles, uterus, urinary bladder, kidney and spleen. Ref.2 Ref.3 |
| Involvement in disease | Defects in HOPX may be a cause of various types of cancer, such as lung cancer, choriocarcinoma, head and neck squamous cell carcinoma and oral squamous cell carcinoma. |
| Sequence similarities | Contains 1 homeobox DNA-binding domain. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Transcription Transcription regulation |
| Cellular component | Nucleus |
| Coding sequence diversity | Alternative splicing |
| Disease | Proto-oncogene |
| Domain | Homeobox |
| Molecular function | Developmental protein Repressor |
| Gene Ontology (GO) | |
| Biological process | negative regulation of cell differentiation Inferred from direct assay. Source: MGI transcriptionInferred from electronic annotation. Source: UniProtKB-KW trophectodermal cell differentiationInferred from direct assay. Source: MGI |
| Cellular component | nucleus Inferred from direct assay. Source: MGI |
| Molecular function | sequence-specific DNA binding Inferred from electronic annotation. Source: InterPro transcription factor activityInferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9BPY8-1) Also known as: A; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9BPY8-2) Also known as: B; The sequence of this isoform differs from the canonical sequence as follows: 49-72: KWFKQRLAKWRRSEGLPSECRSVT → GSDLISRSKIWHPESSPQREGYPHSLLCLAFDYFSLLPPQCKEMV |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 73 | 73 | Homeodomain-only protein | PRO_0000049129 | |||||
Regions | |||||||||
| DNA binding | 3 – 62 | 60 | Homeobox; atypical | ||||||
Natural variations | |||||||||
| Alternative sequence | 49 – 72 | 24 | KWFKQ…CRSVT → GSDLISRSKIWHPESSPQRE GYPHSLLCLAFDYFSLLPPQ CKEMV in isoform 2. | VSP_012659 | |||||
Experimental info | |||||||||
| Sequence conflict | 72 | 1 | T → I in AAH14225. Ref.5 | ||||||
Sequences
References
| « Hide 'large scale' references | |
| [1] | "Expression of mOb1, a novel atypical 73 amino acid K50-homeodomain protein, during mouse development." Adu J., Leong F.T., Smith N.R., Leek J.P., Markham A.F., Robinson P.A., Mighell A.J. Mech. Dev. 119:S43-S47(2002) [PubMed: 14516659] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2). Tissue: Heart. |
| [2] | "NECC1, a candidate choriocarcinoma suppressor gene that encodes a homeodomain consensus motif." Asanoma K., Matsuda T., Kondo H., Kato K., Kishino T., Niikawa N., Wake N., Kato H. Genomics 81:15-25(2003) [PubMed: 12573257] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY, POSSIBLE INVOLVEMENT IN CHORIOCARCINOMA. |
| [3] | "Identification of a novel homeobox-containing gene, LAGY, which is downregulated in lung cancer." Chen Y., Petersen S., Pacyna-Gengelbach M., Pietas A., Petersen I. Oncology 64:450-458(2003) [PubMed: 12759545] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY, POSSIBLE INVOLVEMENT IN LUNG CANCER. |
| [4] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: B-cell. |
| [6] | "Loss of HOP tumour suppressor expression in head and neck squamous cell carcinoma." Lemaire F., Millon R., Muller D., Rabouel Y., Bracco L., Abecassis J., Wasylyk B. Br. J. Cancer 91:258-261(2004) [PubMed: 15213722] [Abstract] Cited for: INVOLVEMENT IN HEAD AND NECK SQUAMOUS CELL CARCINOMA. |
| [7] | "Association between gene expression profile and tumor invasion in oral squamous cell carcinoma." Toruner G.A., Ulger C., Alkan M., Galante A.T., Rinaggio J., Wilk R., Tian B., Soteropoulos P., Hameed M.R., Schwalb M.N., Dermody J.J. Cancer Genet. Cytogenet. 154:27-35(2004) [PubMed: 15381369] [Abstract] Cited for: INVOLVEMENT IN ORAL SQUAMOUS CELL CARCINOMA. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| AF492675 mRNA. Translation: AAM46827.1. AF492676 mRNA. Translation: AAM46828.1. AF492677 mRNA. Translation: AAM46829.1. AF492678 mRNA. Translation: AAM46830.1. AF492679 mRNA. Translation: AAM46831.1. AF492680 mRNA. Translation: AAM46832.1. AF492681 mRNA. Translation: AAM46833.1. AB059408 mRNA. Translation: BAB40926.1. AB059409 mRNA. Translation: BAB40927.1. AB059410 mRNA. Translation: BAB40928.1. AF454763 mRNA. Translation: AAL56613.1. AK289707 mRNA. Translation: BAF82396.1. BC014225 mRNA. Translation: AAH14225.1. | |
| IPI | IPI00386436. IPI00876964. |
| RefSeq | NP_001138931.1. NP_001138932.1. NP_115884.4. NP_631957.1. NP_631958.1. |
| UniGene | Hs.654864 |
3D structure databases | |
| SMR | Q9BPY8. Positions 1-73. |
| ModBase | Search... |
Proteomic databases | |
| PRIDE | Q9BPY8. |
Genome annotation databases | |
| Ensembl | ENSG00000171476. Homo sapiens. [Contig view] |
| GeneID | 84525. |
| KEGG | hsa:84525. |
Organism-specific databases | |
| GeneCards | GC04M057210. |
| H-InvDB | HIX0004237. |
| HGNC | HGNC:24961. HOPX. |
| MIM | 607275. gene. |
| GenAtlas | Search... |
Phylogenomic databases | |
| HOGENOM | Q9BPY8. |
| HOVERGEN | Q9BPY8. |
Gene expression databases | |
| ArrayExpress | Q9BPY8. |
| Bgee | Q9BPY8. |
| CleanEx | HS_HOPX. |
| GermOnline | ENSG00000171476. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR001356. Homeobox. IPR017970. Homeobox_CS. IPR012287. Homeodomain-rel. [Graphical view] |
| Gene3D | G3DSA:1.10.10.60. Homeodomain-rel. 1 hit. |
| Pfam | PF00046. Homeobox. 1 hit. [Graphical view] |
| ProDom | PD000010. Homeobox. 1 hit. [Graphical view] [Entries sharing at least one domain] |
| SMART | SM00389. HOX. 1 hit. [Graphical view] |
| PROSITE | PS00027. HOMEOBOX_1. False negative. PS50071. HOMEOBOX_2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 74351. |
| SOURCE | Search... |
Entry information
| Entry name | HOP_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9BPY8 Secondary accession number(s): A8K0Z2, Q8N0V6, Q96CI1 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| Human chromosome 4 Human chromosome 4: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with


