Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9BPY8

- HOP_HUMAN

UniProt

Q9BPY8 - HOP_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Homeodomain-only protein

Gene

HOPX

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Atypical homeodomain protein which does not bind DNA and is required to modulate cardiac growth and development. Acts via its interaction with SRF, thereby modulating the expression of SRF-dependent cardiac-specific genes and cardiac development. Prevents SRF-dependent transcription either by inhibiting SRF binding to DNA or by recruiting histone deacetylase (HDAC) proteins that prevent transcription by SRF. Overexpression causes cardiac hypertrophy (By similarity). May act as a tumor suppressor.By similarity

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
DNA bindingi3 – 6260Homeobox; atypicalPROSITE-ProRule annotationAdd
BLAST

GO - Molecular functioni

  1. DNA binding Source: UniProtKB-KW

GO - Biological processi

  1. heart development Source: Ensembl
  2. histone deacetylation Source: Ensembl
  3. lung alveolus development Source: Ensembl
  4. negative regulation of cell differentiation Source: MGI
  5. negative regulation of transcription from RNA polymerase II promoter Source: Ensembl
  6. positive regulation of skeletal muscle tissue regeneration Source: Ensembl
  7. positive regulation of striated muscle cell differentiation Source: Ensembl
  8. regulation of heart contraction Source: Ensembl
  9. regulation of protein binding Source: Ensembl
  10. transcription, DNA-templated Source: UniProtKB-KW
  11. trophectodermal cell differentiation Source: MGI
Complete GO annotation...

Keywords - Molecular functioni

Developmental protein, Repressor

Keywords - Biological processi

Transcription, Transcription regulation

Names & Taxonomyi

Protein namesi
Recommended name:
Homeodomain-only protein
Alternative name(s):
Lung cancer-associated Y protein
Not expressed in choriocarcinoma protein 1
Odd homeobox protein 1
Gene namesi
Name:HOPX
Synonyms:HOD, HOP, LAGY, NECC1, OB1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 4

Organism-specific databases

HGNCiHGNC:24961. HOPX.

Subcellular locationi

Nucleus PROSITE-ProRule annotation

GO - Cellular componenti

  1. nucleus Source: MGI
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Keywords - Diseasei

Proto-oncogene

Organism-specific databases

PharmGKBiPA162391564.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 7373Homeodomain-only proteinPRO_0000049129Add
BLAST

Proteomic databases

PaxDbiQ9BPY8.
PRIDEiQ9BPY8.

Expressioni

Tissue specificityi

Widely expressed. Expressed in the heart, brain, placenta, lung, skeletal and smooth muscles, uterus, urinary bladder, kidney and spleen. Down-regulated in some types of cancer such as lung cancer, choriocarcinoma, head and neck squamous cell carcinoma and oral squamous cell carcinoma.2 Publications

Gene expression databases

BgeeiQ9BPY8.
CleanExiHS_HOPX.
ExpressionAtlasiQ9BPY8. baseline and differential.
GenevestigatoriQ9BPY8.

Organism-specific databases

HPAiCAB018632.
HPA030180.

Interactioni

Subunit structurei

Interacts with serum response factor (SRF). Component of a large complex containing histone deacetylases such as HDAC2 (By similarity).By similarity

Protein-protein interaction databases

BioGridi124117. 8 interactions.
MINTiMINT-4534265.
STRINGi9606.ENSP00000370656.

Structurei

3D structure databases

ProteinModelPortaliQ9BPY8.
SMRiQ9BPY8. Positions 1-73.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Contains 1 homeobox DNA-binding domain.PROSITE-ProRule annotation

Keywords - Domaini

Homeobox

Phylogenomic databases

eggNOGiNOG319963.
GeneTreeiENSGT00390000017143.
HOGENOMiHOG000112932.
HOVERGENiHBG051921.
InParanoidiQ9BPY8.
OMAiFKLRNAQ.
OrthoDBiEOG780RQF.
PhylomeDBiQ9BPY8.

Family and domain databases

Gene3Di1.10.10.60. 1 hit.
InterProiIPR001356. Homeobox_dom.
IPR009057. Homeodomain-like.
[Graphical view]
PfamiPF00046. Homeobox. 1 hit.
[Graphical view]
SMARTiSM00389. HOX. 1 hit.
[Graphical view]
SUPFAMiSSF46689. SSF46689. 1 hit.
PROSITEiPS50071. HOMEOBOX_2. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9BPY8-1) [UniParc]FASTAAdd to Basket

Also known as: A

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSAETASGPT EDQVEILEYN FNKVDKHPDS TTLCLIAAEA GLSEEETQKW
60 70
FKQRLAKWRR SEGLPSECRS VTD
Length:73
Mass (Da):8,260
Last modified:June 1, 2001 - v1
Checksum:iCE65E4D2A8972022
GO
Isoform 2 (identifier: Q9BPY8-2) [UniParc]FASTAAdd to Basket

Also known as: B

The sequence of this isoform differs from the canonical sequence as follows:
     49-73: KWFKQRLAKWRRSEGLPSECRSVTD → GSDLISRSKIWHPESSPQREGYPHDSLPCLAFDYFSLLPPQCKEMV

Show »
Length:94
Mass (Da):10,459
Checksum:iF7E5ACD6B4802FCA
GO
Isoform 3 (identifier: Q9BPY8-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MLIFLGCYRRRLEERAGTM

Note: Gene prediction based on EST data.

Show »
Length:91
Mass (Da):10,427
Checksum:i681B58491A5732B8
GO
Isoform 4 (identifier: Q9BPY8-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MLIFLGCYRRRLEERAGTM
     49-73: KWFKQRLAKWRRSEGLPSECRSVTD → GSDLISRSKIWHPESSPQREGYPHDSLPCLAFDYFSLLPPQCKEMV

Note: Gene prediction based on EST data.

Show »
Length:112
Mass (Da):12,625
Checksum:i6CD4F04C488F915D
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti72 – 721T → I in AAH14225. (PubMed:15489334)Curated
Isoform 2 (identifier: Q9BPY8-2)
Sequence conflicti76 – 761P → L in AAM46830. (PubMed:14516659)Curated
Sequence conflicti76 – 761P → L in AAM46831. (PubMed:14516659)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 11M → MLIFLGCYRRRLEERAGTM in isoform 3 and isoform 4. CuratedVSP_047290
Alternative sequencei49 – 7325KWFKQ…RSVTD → GSDLISRSKIWHPESSPQRE GYPHDSLPCLAFDYFSLLPP QCKEMV in isoform 2 and isoform 4. 1 PublicationVSP_012659Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF492675 mRNA. Translation: AAM46827.1.
AF492676 mRNA. Translation: AAM46828.1.
AF492677 mRNA. Translation: AAM46829.1.
AF492678 mRNA. Translation: AAM46830.1.
AF492679 mRNA. Translation: AAM46831.1.
AF492680 mRNA. Translation: AAM46832.1.
AF492681 mRNA. Translation: AAM46833.1.
AB059408 mRNA. Translation: BAB40926.1.
AB059409 mRNA. Translation: BAB40927.1.
AB059410 mRNA. Translation: BAB40928.1.
AF454763 mRNA. Translation: AAL56613.1.
AK289707 mRNA. Translation: BAF82396.1.
AC108215 Genomic DNA. No translation available.
BC014225 mRNA. Translation: AAH14225.1.
CCDSiCCDS3507.1. [Q9BPY8-1]
CCDS47062.1. [Q9BPY8-3]
CCDS54767.1. [Q9BPY8-4]
RefSeqiNP_001138931.1. NM_001145459.1. [Q9BPY8-1]
NP_001138932.1. NM_001145460.1. [Q9BPY8-4]
NP_115884.4. NM_032495.5. [Q9BPY8-3]
NP_631957.1. NM_139211.4. [Q9BPY8-1]
NP_631958.1. NM_139212.3. [Q9BPY8-1]
UniGeneiHs.619396.

Genome annotation databases

EnsembliENST00000317745; ENSP00000315198; ENSG00000171476. [Q9BPY8-1]
ENST00000337881; ENSP00000337330; ENSG00000171476. [Q9BPY8-1]
ENST00000381255; ENSP00000370654; ENSG00000171476. [Q9BPY8-1]
ENST00000381260; ENSP00000370659; ENSG00000171476. [Q9BPY8-2]
ENST00000420433; ENSP00000396275; ENSG00000171476. [Q9BPY8-3]
ENST00000503639; ENSP00000424101; ENSG00000171476. [Q9BPY8-1]
ENST00000508121; ENSP00000422175; ENSG00000171476. [Q9BPY8-1]
ENST00000553379; ENSP00000452340; ENSG00000171476. [Q9BPY8-1]
ENST00000554144; ENSP00000450527; ENSG00000171476. [Q9BPY8-4]
ENST00000555760; ENSP00000452098; ENSG00000171476. [Q9BPY8-1]
ENST00000556376; ENSP00000451794; ENSG00000171476. [Q9BPY8-1]
ENST00000556614; ENSP00000452003; ENSG00000171476. [Q9BPY8-1]
GeneIDi84525.
KEGGihsa:84525.
UCSCiuc003hbz.2. human. [Q9BPY8-1]

Polymorphism databases

DMDMi60392394.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF492675 mRNA. Translation: AAM46827.1 .
AF492676 mRNA. Translation: AAM46828.1 .
AF492677 mRNA. Translation: AAM46829.1 .
AF492678 mRNA. Translation: AAM46830.1 .
AF492679 mRNA. Translation: AAM46831.1 .
AF492680 mRNA. Translation: AAM46832.1 .
AF492681 mRNA. Translation: AAM46833.1 .
AB059408 mRNA. Translation: BAB40926.1 .
AB059409 mRNA. Translation: BAB40927.1 .
AB059410 mRNA. Translation: BAB40928.1 .
AF454763 mRNA. Translation: AAL56613.1 .
AK289707 mRNA. Translation: BAF82396.1 .
AC108215 Genomic DNA. No translation available.
BC014225 mRNA. Translation: AAH14225.1 .
CCDSi CCDS3507.1. [Q9BPY8-1 ]
CCDS47062.1. [Q9BPY8-3 ]
CCDS54767.1. [Q9BPY8-4 ]
RefSeqi NP_001138931.1. NM_001145459.1. [Q9BPY8-1 ]
NP_001138932.1. NM_001145460.1. [Q9BPY8-4 ]
NP_115884.4. NM_032495.5. [Q9BPY8-3 ]
NP_631957.1. NM_139211.4. [Q9BPY8-1 ]
NP_631958.1. NM_139212.3. [Q9BPY8-1 ]
UniGenei Hs.619396.

3D structure databases

ProteinModelPortali Q9BPY8.
SMRi Q9BPY8. Positions 1-73.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 124117. 8 interactions.
MINTi MINT-4534265.
STRINGi 9606.ENSP00000370656.

Polymorphism databases

DMDMi 60392394.

Proteomic databases

PaxDbi Q9BPY8.
PRIDEi Q9BPY8.

Protocols and materials databases

DNASUi 84525.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000317745 ; ENSP00000315198 ; ENSG00000171476 . [Q9BPY8-1 ]
ENST00000337881 ; ENSP00000337330 ; ENSG00000171476 . [Q9BPY8-1 ]
ENST00000381255 ; ENSP00000370654 ; ENSG00000171476 . [Q9BPY8-1 ]
ENST00000381260 ; ENSP00000370659 ; ENSG00000171476 . [Q9BPY8-2 ]
ENST00000420433 ; ENSP00000396275 ; ENSG00000171476 . [Q9BPY8-3 ]
ENST00000503639 ; ENSP00000424101 ; ENSG00000171476 . [Q9BPY8-1 ]
ENST00000508121 ; ENSP00000422175 ; ENSG00000171476 . [Q9BPY8-1 ]
ENST00000553379 ; ENSP00000452340 ; ENSG00000171476 . [Q9BPY8-1 ]
ENST00000554144 ; ENSP00000450527 ; ENSG00000171476 . [Q9BPY8-4 ]
ENST00000555760 ; ENSP00000452098 ; ENSG00000171476 . [Q9BPY8-1 ]
ENST00000556376 ; ENSP00000451794 ; ENSG00000171476 . [Q9BPY8-1 ]
ENST00000556614 ; ENSP00000452003 ; ENSG00000171476 . [Q9BPY8-1 ]
GeneIDi 84525.
KEGGi hsa:84525.
UCSCi uc003hbz.2. human. [Q9BPY8-1 ]

Organism-specific databases

CTDi 84525.
GeneCardsi GC04M057514.
HGNCi HGNC:24961. HOPX.
HPAi CAB018632.
HPA030180.
MIMi 607275. gene.
neXtProti NX_Q9BPY8.
PharmGKBi PA162391564.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG319963.
GeneTreei ENSGT00390000017143.
HOGENOMi HOG000112932.
HOVERGENi HBG051921.
InParanoidi Q9BPY8.
OMAi FKLRNAQ.
OrthoDBi EOG780RQF.
PhylomeDBi Q9BPY8.

Miscellaneous databases

ChiTaRSi HOPX. human.
GeneWikii HOPX.
GenomeRNAii 84525.
NextBioi 74351.
PROi Q9BPY8.
SOURCEi Search...

Gene expression databases

Bgeei Q9BPY8.
CleanExi HS_HOPX.
ExpressionAtlasi Q9BPY8. baseline and differential.
Genevestigatori Q9BPY8.

Family and domain databases

Gene3Di 1.10.10.60. 1 hit.
InterProi IPR001356. Homeobox_dom.
IPR009057. Homeodomain-like.
[Graphical view ]
Pfami PF00046. Homeobox. 1 hit.
[Graphical view ]
SMARTi SM00389. HOX. 1 hit.
[Graphical view ]
SUPFAMi SSF46689. SSF46689. 1 hit.
PROSITEi PS50071. HOMEOBOX_2. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Expression of mOb1, a novel atypical 73 amino acid K50-homeodomain protein, during mouse development."
    Adu J., Leong F.T., Smith N.R., Leek J.P., Markham A.F., Robinson P.A., Mighell A.J.
    Mech. Dev. 119:S43-S47(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2).
    Tissue: Heart.
  2. "NECC1, a candidate choriocarcinoma suppressor gene that encodes a homeodomain consensus motif."
    Asanoma K., Matsuda T., Kondo H., Kato K., Kishino T., Niikawa N., Wake N., Kato H.
    Genomics 81:15-25(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY, POSSIBLE INVOLVEMENT IN CHORIOCARCINOMA.
  3. "Identification of a novel homeobox-containing gene, LAGY, which is downregulated in lung cancer."
    Chen Y., Petersen S., Pacyna-Gengelbach M., Pietas A., Petersen I.
    Oncology 64:450-458(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY, POSSIBLE INVOLVEMENT IN LUNG CANCER.
  4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Brain.
  5. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
    Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
    , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
    Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: B-cell.
  7. "Loss of HOP tumour suppressor expression in head and neck squamous cell carcinoma."
    Lemaire F., Millon R., Muller D., Rabouel Y., Bracco L., Abecassis J., Wasylyk B.
    Br. J. Cancer 91:258-261(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: INVOLVEMENT IN HEAD AND NECK SQUAMOUS CELL CARCINOMA.
  8. "Association between gene expression profile and tumor invasion in oral squamous cell carcinoma."
    Toruner G.A., Ulger C., Alkan M., Galante A.T., Rinaggio J., Wilk R., Tian B., Soteropoulos P., Hameed M.R., Schwalb M.N., Dermody J.J.
    Cancer Genet. Cytogenet. 154:27-35(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: INVOLVEMENT IN ORAL SQUAMOUS CELL CARCINOMA.

Entry informationi

Entry nameiHOP_HUMAN
AccessioniPrimary (citable) accession number: Q9BPY8
Secondary accession number(s): A8K0Z2
, E9PB55, G3V294, Q8N0V6, Q96CI1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 1, 2005
Last sequence update: June 1, 2001
Last modified: October 29, 2014
This is version 107 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3