Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9BPY8

- HOP_HUMAN

UniProt

Q9BPY8 - HOP_HUMAN

Protein

Homeodomain-only protein

Gene

HOPX

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
  1. Functioni

    Atypical homeodomain protein which does not bind DNA and is required to modulate cardiac growth and development. Acts via its interaction with SRF, thereby modulating the expression of SRF-dependent cardiac-specific genes and cardiac development. Prevents SRF-dependent transcription either by inhibiting SRF binding to DNA or by recruiting histone deacetylase (HDAC) proteins that prevent transcription by SRF. Overexpression causes cardiac hypertrophy By similarity. May act as a tumor suppressor.By similarity

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    DNA bindingi3 – 6260Homeobox; atypicalPROSITE-ProRule annotationAdd
    BLAST

    GO - Molecular functioni

    1. sequence-specific DNA binding Source: InterPro
    2. sequence-specific DNA binding transcription factor activity Source: InterPro

    GO - Biological processi

    1. heart development Source: Ensembl
    2. histone deacetylation Source: Ensembl
    3. lung alveolus development Source: Ensembl
    4. negative regulation of cell differentiation Source: MGI
    5. negative regulation of transcription from RNA polymerase II promoter Source: Ensembl
    6. positive regulation of skeletal muscle tissue regeneration Source: Ensembl
    7. positive regulation of striated muscle cell differentiation Source: Ensembl
    8. regulation of heart contraction Source: Ensembl
    9. regulation of protein binding Source: Ensembl
    10. transcription, DNA-templated Source: UniProtKB-KW
    11. trophectodermal cell differentiation Source: MGI

    Keywords - Molecular functioni

    Developmental protein, Repressor

    Keywords - Biological processi

    Transcription, Transcription regulation

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Homeodomain-only protein
    Alternative name(s):
    Lung cancer-associated Y protein
    Not expressed in choriocarcinoma protein 1
    Odd homeobox protein 1
    Gene namesi
    Name:HOPX
    Synonyms:HOD, HOP, LAGY, NECC1, OB1
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 4

    Organism-specific databases

    HGNCiHGNC:24961. HOPX.

    Subcellular locationi

    Nucleus PROSITE-ProRule annotation

    GO - Cellular componenti

    1. nucleus Source: MGI

    Keywords - Cellular componenti

    Nucleus

    Pathology & Biotechi

    Keywords - Diseasei

    Proto-oncogene

    Organism-specific databases

    PharmGKBiPA162391564.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 7373Homeodomain-only proteinPRO_0000049129Add
    BLAST

    Proteomic databases

    PaxDbiQ9BPY8.
    PRIDEiQ9BPY8.

    Expressioni

    Tissue specificityi

    Widely expressed. Expressed in the heart, brain, placenta, lung, skeletal and smooth muscles, uterus, urinary bladder, kidney and spleen. Down-regulated in some types of cancer such as lung cancer, choriocarcinoma, head and neck squamous cell carcinoma and oral squamous cell carcinoma.2 Publications

    Gene expression databases

    ArrayExpressiQ9BPY8.
    BgeeiQ9BPY8.
    CleanExiHS_HOPX.
    GenevestigatoriQ9BPY8.

    Organism-specific databases

    HPAiCAB018632.
    HPA030180.

    Interactioni

    Subunit structurei

    Interacts with serum response factor (SRF). Component of a large complex containing histone deacetylases such as HDAC2 By similarity.By similarity

    Protein-protein interaction databases

    BioGridi124117. 8 interactions.
    MINTiMINT-4534265.
    STRINGi9606.ENSP00000370656.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9BPY8.
    SMRiQ9BPY8. Positions 1-73.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Sequence similaritiesi

    Contains 1 homeobox DNA-binding domain.PROSITE-ProRule annotation

    Keywords - Domaini

    Homeobox

    Phylogenomic databases

    eggNOGiNOG319963.
    HOGENOMiHOG000112932.
    HOVERGENiHBG051921.
    OMAiFKLRNAQ.
    OrthoDBiEOG780RQF.
    PhylomeDBiQ9BPY8.

    Family and domain databases

    Gene3Di1.10.10.60. 1 hit.
    InterProiIPR001356. Homeobox_dom.
    IPR009057. Homeodomain-like.
    [Graphical view]
    PfamiPF00046. Homeobox. 1 hit.
    [Graphical view]
    SMARTiSM00389. HOX. 1 hit.
    [Graphical view]
    SUPFAMiSSF46689. SSF46689. 1 hit.
    PROSITEiPS50071. HOMEOBOX_2. 1 hit.
    [Graphical view]

    Sequences (4)i

    Sequence statusi: Complete.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9BPY8-1) [UniParc]FASTAAdd to Basket

    Also known as: A

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MSAETASGPT EDQVEILEYN FNKVDKHPDS TTLCLIAAEA GLSEEETQKW   50
    FKQRLAKWRR SEGLPSECRS VTD 73
    Length:73
    Mass (Da):8,260
    Last modified:June 1, 2001 - v1
    Checksum:iCE65E4D2A8972022
    GO
    Isoform 2 (identifier: Q9BPY8-2) [UniParc]FASTAAdd to Basket

    Also known as: B

    The sequence of this isoform differs from the canonical sequence as follows:
         49-73: KWFKQRLAKWRRSEGLPSECRSVTD → GSDLISRSKIWHPESSPQREGYPHDSLPCLAFDYFSLLPPQCKEMV

    Show »
    Length:94
    Mass (Da):10,459
    Checksum:iF7E5ACD6B4802FCA
    GO
    Isoform 3 (identifier: Q9BPY8-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MLIFLGCYRRRLEERAGTM

    Note: Gene prediction based on EST data.

    Show »
    Length:91
    Mass (Da):10,427
    Checksum:i681B58491A5732B8
    GO
    Isoform 4 (identifier: Q9BPY8-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MLIFLGCYRRRLEERAGTM
         49-73: KWFKQRLAKWRRSEGLPSECRSVTD → GSDLISRSKIWHPESSPQREGYPHDSLPCLAFDYFSLLPPQCKEMV

    Note: Gene prediction based on EST data.

    Show »
    Length:112
    Mass (Da):12,625
    Checksum:i6CD4F04C488F915D
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti72 – 721T → I in AAH14225. (PubMed:15489334)Curated
    Isoform 2 (identifier: Q9BPY8-2)
    Sequence conflicti76 – 761P → L in AAM46830. (PubMed:14516659)Curated
    Sequence conflicti76 – 761P → L in AAM46831. (PubMed:14516659)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 11M → MLIFLGCYRRRLEERAGTM in isoform 3 and isoform 4. CuratedVSP_047290
    Alternative sequencei49 – 7325KWFKQ…RSVTD → GSDLISRSKIWHPESSPQRE GYPHDSLPCLAFDYFSLLPP QCKEMV in isoform 2 and isoform 4. 1 PublicationVSP_012659Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF492675 mRNA. Translation: AAM46827.1.
    AF492676 mRNA. Translation: AAM46828.1.
    AF492677 mRNA. Translation: AAM46829.1.
    AF492678 mRNA. Translation: AAM46830.1.
    AF492679 mRNA. Translation: AAM46831.1.
    AF492680 mRNA. Translation: AAM46832.1.
    AF492681 mRNA. Translation: AAM46833.1.
    AB059408 mRNA. Translation: BAB40926.1.
    AB059409 mRNA. Translation: BAB40927.1.
    AB059410 mRNA. Translation: BAB40928.1.
    AF454763 mRNA. Translation: AAL56613.1.
    AK289707 mRNA. Translation: BAF82396.1.
    AC108215 Genomic DNA. No translation available.
    BC014225 mRNA. Translation: AAH14225.1.
    CCDSiCCDS3507.1. [Q9BPY8-1]
    CCDS47062.1. [Q9BPY8-3]
    CCDS54767.1. [Q9BPY8-4]
    RefSeqiNP_001138931.1. NM_001145459.1. [Q9BPY8-1]
    NP_001138932.1. NM_001145460.1. [Q9BPY8-4]
    NP_115884.4. NM_032495.5. [Q9BPY8-3]
    NP_631957.1. NM_139211.4. [Q9BPY8-1]
    NP_631958.1. NM_139212.3. [Q9BPY8-1]
    UniGeneiHs.619396.

    Genome annotation databases

    EnsembliENST00000317745; ENSP00000315198; ENSG00000171476. [Q9BPY8-1]
    ENST00000337881; ENSP00000337330; ENSG00000171476. [Q9BPY8-1]
    ENST00000381255; ENSP00000370654; ENSG00000171476. [Q9BPY8-1]
    ENST00000381260; ENSP00000370659; ENSG00000171476. [Q9BPY8-2]
    ENST00000420433; ENSP00000396275; ENSG00000171476. [Q9BPY8-3]
    ENST00000503639; ENSP00000424101; ENSG00000171476. [Q9BPY8-1]
    ENST00000508121; ENSP00000422175; ENSG00000171476. [Q9BPY8-3]
    ENST00000553379; ENSP00000452340; ENSG00000171476. [Q9BPY8-1]
    ENST00000554144; ENSP00000450527; ENSG00000171476. [Q9BPY8-4]
    ENST00000555760; ENSP00000452098; ENSG00000171476. [Q9BPY8-1]
    ENST00000556376; ENSP00000451794; ENSG00000171476. [Q9BPY8-1]
    ENST00000556614; ENSP00000452003; ENSG00000171476. [Q9BPY8-1]
    GeneIDi84525.
    KEGGihsa:84525.
    UCSCiuc003hbz.2. human. [Q9BPY8-1]

    Polymorphism databases

    DMDMi60392394.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF492675 mRNA. Translation: AAM46827.1 .
    AF492676 mRNA. Translation: AAM46828.1 .
    AF492677 mRNA. Translation: AAM46829.1 .
    AF492678 mRNA. Translation: AAM46830.1 .
    AF492679 mRNA. Translation: AAM46831.1 .
    AF492680 mRNA. Translation: AAM46832.1 .
    AF492681 mRNA. Translation: AAM46833.1 .
    AB059408 mRNA. Translation: BAB40926.1 .
    AB059409 mRNA. Translation: BAB40927.1 .
    AB059410 mRNA. Translation: BAB40928.1 .
    AF454763 mRNA. Translation: AAL56613.1 .
    AK289707 mRNA. Translation: BAF82396.1 .
    AC108215 Genomic DNA. No translation available.
    BC014225 mRNA. Translation: AAH14225.1 .
    CCDSi CCDS3507.1. [Q9BPY8-1 ]
    CCDS47062.1. [Q9BPY8-3 ]
    CCDS54767.1. [Q9BPY8-4 ]
    RefSeqi NP_001138931.1. NM_001145459.1. [Q9BPY8-1 ]
    NP_001138932.1. NM_001145460.1. [Q9BPY8-4 ]
    NP_115884.4. NM_032495.5. [Q9BPY8-3 ]
    NP_631957.1. NM_139211.4. [Q9BPY8-1 ]
    NP_631958.1. NM_139212.3. [Q9BPY8-1 ]
    UniGenei Hs.619396.

    3D structure databases

    ProteinModelPortali Q9BPY8.
    SMRi Q9BPY8. Positions 1-73.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 124117. 8 interactions.
    MINTi MINT-4534265.
    STRINGi 9606.ENSP00000370656.

    Polymorphism databases

    DMDMi 60392394.

    Proteomic databases

    PaxDbi Q9BPY8.
    PRIDEi Q9BPY8.

    Protocols and materials databases

    DNASUi 84525.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000317745 ; ENSP00000315198 ; ENSG00000171476 . [Q9BPY8-1 ]
    ENST00000337881 ; ENSP00000337330 ; ENSG00000171476 . [Q9BPY8-1 ]
    ENST00000381255 ; ENSP00000370654 ; ENSG00000171476 . [Q9BPY8-1 ]
    ENST00000381260 ; ENSP00000370659 ; ENSG00000171476 . [Q9BPY8-2 ]
    ENST00000420433 ; ENSP00000396275 ; ENSG00000171476 . [Q9BPY8-3 ]
    ENST00000503639 ; ENSP00000424101 ; ENSG00000171476 . [Q9BPY8-1 ]
    ENST00000508121 ; ENSP00000422175 ; ENSG00000171476 . [Q9BPY8-3 ]
    ENST00000553379 ; ENSP00000452340 ; ENSG00000171476 . [Q9BPY8-1 ]
    ENST00000554144 ; ENSP00000450527 ; ENSG00000171476 . [Q9BPY8-4 ]
    ENST00000555760 ; ENSP00000452098 ; ENSG00000171476 . [Q9BPY8-1 ]
    ENST00000556376 ; ENSP00000451794 ; ENSG00000171476 . [Q9BPY8-1 ]
    ENST00000556614 ; ENSP00000452003 ; ENSG00000171476 . [Q9BPY8-1 ]
    GeneIDi 84525.
    KEGGi hsa:84525.
    UCSCi uc003hbz.2. human. [Q9BPY8-1 ]

    Organism-specific databases

    CTDi 84525.
    GeneCardsi GC04M057514.
    HGNCi HGNC:24961. HOPX.
    HPAi CAB018632.
    HPA030180.
    MIMi 607275. gene.
    neXtProti NX_Q9BPY8.
    PharmGKBi PA162391564.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG319963.
    HOGENOMi HOG000112932.
    HOVERGENi HBG051921.
    OMAi FKLRNAQ.
    OrthoDBi EOG780RQF.
    PhylomeDBi Q9BPY8.

    Miscellaneous databases

    ChiTaRSi HOPX. human.
    GeneWikii HOPX.
    GenomeRNAii 84525.
    NextBioi 74351.
    PROi Q9BPY8.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q9BPY8.
    Bgeei Q9BPY8.
    CleanExi HS_HOPX.
    Genevestigatori Q9BPY8.

    Family and domain databases

    Gene3Di 1.10.10.60. 1 hit.
    InterProi IPR001356. Homeobox_dom.
    IPR009057. Homeodomain-like.
    [Graphical view ]
    Pfami PF00046. Homeobox. 1 hit.
    [Graphical view ]
    SMARTi SM00389. HOX. 1 hit.
    [Graphical view ]
    SUPFAMi SSF46689. SSF46689. 1 hit.
    PROSITEi PS50071. HOMEOBOX_2. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Expression of mOb1, a novel atypical 73 amino acid K50-homeodomain protein, during mouse development."
      Adu J., Leong F.T., Smith N.R., Leek J.P., Markham A.F., Robinson P.A., Mighell A.J.
      Mech. Dev. 119:S43-S47(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2).
      Tissue: Heart.
    2. "NECC1, a candidate choriocarcinoma suppressor gene that encodes a homeodomain consensus motif."
      Asanoma K., Matsuda T., Kondo H., Kato K., Kishino T., Niikawa N., Wake N., Kato H.
      Genomics 81:15-25(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY, POSSIBLE INVOLVEMENT IN CHORIOCARCINOMA.
    3. "Identification of a novel homeobox-containing gene, LAGY, which is downregulated in lung cancer."
      Chen Y., Petersen S., Pacyna-Gengelbach M., Pietas A., Petersen I.
      Oncology 64:450-458(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY, POSSIBLE INVOLVEMENT IN LUNG CANCER.
    4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Brain.
    5. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
      Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
      , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
      Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: B-cell.
    7. "Loss of HOP tumour suppressor expression in head and neck squamous cell carcinoma."
      Lemaire F., Millon R., Muller D., Rabouel Y., Bracco L., Abecassis J., Wasylyk B.
      Br. J. Cancer 91:258-261(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: INVOLVEMENT IN HEAD AND NECK SQUAMOUS CELL CARCINOMA.
    8. "Association between gene expression profile and tumor invasion in oral squamous cell carcinoma."
      Toruner G.A., Ulger C., Alkan M., Galante A.T., Rinaggio J., Wilk R., Tian B., Soteropoulos P., Hameed M.R., Schwalb M.N., Dermody J.J.
      Cancer Genet. Cytogenet. 154:27-35(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: INVOLVEMENT IN ORAL SQUAMOUS CELL CARCINOMA.

    Entry informationi

    Entry nameiHOP_HUMAN
    AccessioniPrimary (citable) accession number: Q9BPY8
    Secondary accession number(s): A8K0Z2
    , E9PB55, G3V294, Q8N0V6, Q96CI1
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: February 1, 2005
    Last sequence update: June 1, 2001
    Last modified: October 1, 2014
    This is version 106 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 4
      Human chromosome 4: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3