Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

UPF0415 protein C7orf25

Gene

C7orf25

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Names & Taxonomyi

Protein namesi
Recommended name:
UPF0415 protein C7orf25
Gene namesi
Name:C7orf25
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 7

Organism-specific databases

EuPathDBiHostDB:ENSG00000136197.12
HGNCiHGNC:21703 C7orf25
neXtProtiNX_Q9BPX7

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134976499

Polymorphism and mutation databases

BioMutaiC7orf25
DMDMi74732797

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002795291 – 421UPF0415 protein C7orf25Add BLAST421

Proteomic databases

EPDiQ9BPX7
MaxQBiQ9BPX7
PaxDbiQ9BPX7
PeptideAtlasiQ9BPX7
PRIDEiQ9BPX7

PTM databases

CarbonylDBiQ9BPX7
iPTMnetiQ9BPX7
PhosphoSitePlusiQ9BPX7

Expressioni

Gene expression databases

BgeeiENSG00000136197
CleanExiHS_C7orf25
ExpressionAtlasiQ9BPX7 baseline and differential
GenevisibleiQ9BPX7 HS

Organism-specific databases

HPAiHPA020120
HPA049635

Interactioni

Binary interactionsi

Show more details

Protein-protein interaction databases

BioGridi122489, 20 interactors
IntActiQ9BPX7, 21 interactors
MINTiQ9BPX7
STRINGi9606.ENSP00000416290

Structurei

3D structure databases

ProteinModelPortaliQ9BPX7
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the UPF0415 family.Curated

Phylogenomic databases

eggNOGiKOG4529 Eukaryota
ENOG410ZJ6F LUCA
GeneTreeiENSGT00390000014722
HOGENOMiHOG000043090
HOVERGENiHBG081122
InParanoidiQ9BPX7
OMAiCESAVKD
OrthoDBiEOG091G0EQR
PhylomeDBiQ9BPX7
TreeFamiTF105980

Family and domain databases

InterProiView protein in InterPro
IPR010733 DUF1308
PANTHERiPTHR13379 PTHR13379, 1 hit
PfamiView protein in Pfam
PF07000 DUF1308, 1 hit

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9BPX7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSAHSMLCER IAIAKELIKR AESLSRSRKG GIEGGAKLCS KLKAELKFLQ
60 70 80 90 100
KVEAGKVAIK ESHLQSTNLT HLRAIVESAE NLEEVVSVLH VFGYTDTLGE
110 120 130 140 150
KQTLVVDVVA NGGHTWVKAI GRKAEALHNI WLGRGQYGDK SIIEQAEDFL
160 170 180 190 200
QASHQQPVQY SNPHIIFAFY NSVSSPMAEK LKEMGISVRG DIVAVNALLD
210 220 230 240 250
HPEELQPSES ESDDEGPELL QVTRVDRENI LASVAFPTEI KVDVCKRVNL
260 270 280 290 300
DITTLITYVS ALSYGGCHFI FKEKVLTEQA EQERKEQVLP QLEAFMKDKE
310 320 330 340 350
LFACESAVKD FQSILDTLGG PGERERATVL IKRINVVPDQ PSERALRLVA
360 370 380 390 400
SSKINSRSLT IFGTGDTLKA ITMTANSGFV RAANNQGVKF SVFIHQPRAL
410 420
TESKEALATP LPKDYTTDSE H
Length:421
Mass (Da):46,451
Last modified:June 1, 2001 - v1
Checksum:iD7C421DC4CA80E9C
GO
Isoform 2 (identifier: Q9BPX7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MQEVPEAAGLARVEPPRRSSGVGAARLRFPGGSRPLRARACVLALAVLALPERNNADSM

Show »
Length:479
Mass (Da):52,512
Checksum:i630A064E280E4A7D
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti131W → R in BAB15019 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_053848265G → E. Corresponds to variant dbSNP:rs3735471Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0472431M → MQEVPEAAGLARVEPPRRSS GVGAARLRFPGGSRPLRARA CVLALAVLALPERNNADSM in isoform 2. Curated1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK024820 mRNA Translation: BAB15019.1
AC010132 Genomic DNA No translation available.
CH236951 Genomic DNA Translation: EAL24004.1
BC000769 mRNA Translation: AAH00769.1
BC001845 mRNA Translation: AAH01845.1
CCDSiCCDS47576.1 [Q9BPX7-2]
CCDS5466.1 [Q9BPX7-1]
RefSeqiNP_001093328.1, NM_001099858.1 [Q9BPX7-2]
NP_076959.2, NM_024054.2 [Q9BPX7-1]
XP_005249901.1, XM_005249844.3 [Q9BPX7-1]
XP_016868086.1, XM_017012597.1 [Q9BPX7-1]
UniGeneiHs.698120

Genome annotation databases

EnsembliENST00000350427; ENSP00000343364; ENSG00000136197 [Q9BPX7-1]
ENST00000431882; ENSP00000416290; ENSG00000136197 [Q9BPX7-2]
ENST00000438029; ENSP00000396597; ENSG00000136197 [Q9BPX7-1]
ENST00000447342; ENSP00000413029; ENSG00000136197 [Q9BPX7-2]
GeneIDi79020
KEGGihsa:79020
UCSCiuc003thx.5 human [Q9BPX7-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiCG025_HUMAN
AccessioniPrimary (citable) accession number: Q9BPX7
Secondary accession number(s): A4D1V2, J3KR36, Q9H779
Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 6, 2007
Last sequence update: June 1, 2001
Last modified: February 28, 2018
This is version 111 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Cookie policy

We would like to use anonymized google analytics cookies to gather statistics on how uniprot.org is used in aggregate. Learn more

UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health