Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

UPF0415 protein C7orf25

Gene

C7orf25

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 2 out of 5-Experimental evidence at protein leveli

Names & Taxonomyi

Protein namesi
Recommended name:
UPF0415 protein C7orf25
Gene namesi
Name:C7orf25
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640 Componenti: Chromosome 7

Organism-specific databases

HGNCiHGNC:21703. C7orf25.

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134976499.

Polymorphism and mutation databases

BioMutaiC7orf25.
DMDMi74732797.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 421421UPF0415 protein C7orf25PRO_0000279529Add
BLAST

Proteomic databases

MaxQBiQ9BPX7.
PaxDbiQ9BPX7.
PRIDEiQ9BPX7.

PTM databases

PhosphoSiteiQ9BPX7.

Expressioni

Gene expression databases

BgeeiQ9BPX7.
CleanExiHS_C7orf25.
ExpressionAtlasiQ9BPX7. baseline.
GenevisibleiQ9BPX7. HS.

Organism-specific databases

HPAiHPA020120.
HPA049635.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
B2RDX53EBI-718586,EBI-10173104
TARSP266393EBI-718586,EBI-1042683

Protein-protein interaction databases

BioGridi122489. 20 interactions.
IntActiQ9BPX7. 20 interactions.
MINTiMINT-6780908.
STRINGi9606.ENSP00000416290.

Structurei

3D structure databases

ProteinModelPortaliQ9BPX7.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the UPF0415 family.Curated

Phylogenomic databases

eggNOGiNOG248806.
GeneTreeiENSGT00390000014722.
HOGENOMiHOG000043090.
HOVERGENiHBG081122.
InParanoidiQ9BPX7.
OMAiGKEWRAT.
OrthoDBiEOG78SQJG.
PhylomeDBiQ9BPX7.
TreeFamiTF105980.

Family and domain databases

InterProiIPR010733. DUF1308.
[Graphical view]
PANTHERiPTHR13379. PTHR13379. 1 hit.
PfamiPF07000. DUF1308. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9BPX7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSAHSMLCER IAIAKELIKR AESLSRSRKG GIEGGAKLCS KLKAELKFLQ
60 70 80 90 100
KVEAGKVAIK ESHLQSTNLT HLRAIVESAE NLEEVVSVLH VFGYTDTLGE
110 120 130 140 150
KQTLVVDVVA NGGHTWVKAI GRKAEALHNI WLGRGQYGDK SIIEQAEDFL
160 170 180 190 200
QASHQQPVQY SNPHIIFAFY NSVSSPMAEK LKEMGISVRG DIVAVNALLD
210 220 230 240 250
HPEELQPSES ESDDEGPELL QVTRVDRENI LASVAFPTEI KVDVCKRVNL
260 270 280 290 300
DITTLITYVS ALSYGGCHFI FKEKVLTEQA EQERKEQVLP QLEAFMKDKE
310 320 330 340 350
LFACESAVKD FQSILDTLGG PGERERATVL IKRINVVPDQ PSERALRLVA
360 370 380 390 400
SSKINSRSLT IFGTGDTLKA ITMTANSGFV RAANNQGVKF SVFIHQPRAL
410 420
TESKEALATP LPKDYTTDSE H
Length:421
Mass (Da):46,451
Last modified:June 1, 2001 - v1
Checksum:iD7C421DC4CA80E9C
GO
Isoform 2 (identifier: Q9BPX7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MQEVPEAAGLARVEPPRRSSGVGAARLRFPGGSRPLRARACVLALAVLALPERNNADSM

Show »
Length:479
Mass (Da):52,512
Checksum:i630A064E280E4A7D
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti131 – 1311W → R in BAB15019 (PubMed:14702039).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti265 – 2651G → E.
Corresponds to variant rs3735471 [ dbSNP | Ensembl ].
VAR_053848

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 11M → MQEVPEAAGLARVEPPRRSS GVGAARLRFPGGSRPLRARA CVLALAVLALPERNNADSM in isoform 2. CuratedVSP_047243

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK024820 mRNA. Translation: BAB15019.1.
AC010132 Genomic DNA. No translation available.
CH236951 Genomic DNA. Translation: EAL24004.1.
BC000769 mRNA. Translation: AAH00769.1.
BC001845 mRNA. Translation: AAH01845.1.
CCDSiCCDS47576.1. [Q9BPX7-2]
CCDS5466.1. [Q9BPX7-1]
RefSeqiNP_001093328.1. NM_001099858.1. [Q9BPX7-2]
NP_076959.2. NM_024054.2. [Q9BPX7-1]
XP_005249901.1. XM_005249844.3. [Q9BPX7-1]
UniGeneiHs.698120.

Genome annotation databases

EnsembliENST00000350427; ENSP00000343364; ENSG00000136197. [Q9BPX7-1]
ENST00000431882; ENSP00000416290; ENSG00000136197. [Q9BPX7-2]
ENST00000438029; ENSP00000396597; ENSG00000136197. [Q9BPX7-1]
ENST00000447342; ENSP00000413029; ENSG00000136197. [Q9BPX7-2]
GeneIDi79020.
KEGGihsa:79020.
UCSCiuc010kxq.3. human. [Q9BPX7-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK024820 mRNA. Translation: BAB15019.1.
AC010132 Genomic DNA. No translation available.
CH236951 Genomic DNA. Translation: EAL24004.1.
BC000769 mRNA. Translation: AAH00769.1.
BC001845 mRNA. Translation: AAH01845.1.
CCDSiCCDS47576.1. [Q9BPX7-2]
CCDS5466.1. [Q9BPX7-1]
RefSeqiNP_001093328.1. NM_001099858.1. [Q9BPX7-2]
NP_076959.2. NM_024054.2. [Q9BPX7-1]
XP_005249901.1. XM_005249844.3. [Q9BPX7-1]
UniGeneiHs.698120.

3D structure databases

ProteinModelPortaliQ9BPX7.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi122489. 20 interactions.
IntActiQ9BPX7. 20 interactions.
MINTiMINT-6780908.
STRINGi9606.ENSP00000416290.

PTM databases

PhosphoSiteiQ9BPX7.

Polymorphism and mutation databases

BioMutaiC7orf25.
DMDMi74732797.

Proteomic databases

MaxQBiQ9BPX7.
PaxDbiQ9BPX7.
PRIDEiQ9BPX7.

Protocols and materials databases

DNASUi79020.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000350427; ENSP00000343364; ENSG00000136197. [Q9BPX7-1]
ENST00000431882; ENSP00000416290; ENSG00000136197. [Q9BPX7-2]
ENST00000438029; ENSP00000396597; ENSG00000136197. [Q9BPX7-1]
ENST00000447342; ENSP00000413029; ENSG00000136197. [Q9BPX7-2]
GeneIDi79020.
KEGGihsa:79020.
UCSCiuc010kxq.3. human. [Q9BPX7-1]

Organism-specific databases

CTDi79020.
GeneCardsiGC07M042948.
H-InvDBHIX0201127.
HGNCiHGNC:21703. C7orf25.
HPAiHPA020120.
HPA049635.
neXtProtiNX_Q9BPX7.
PharmGKBiPA134976499.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiNOG248806.
GeneTreeiENSGT00390000014722.
HOGENOMiHOG000043090.
HOVERGENiHBG081122.
InParanoidiQ9BPX7.
OMAiGKEWRAT.
OrthoDBiEOG78SQJG.
PhylomeDBiQ9BPX7.
TreeFamiTF105980.

Miscellaneous databases

ChiTaRSiC7orf25. human.
GenomeRNAii79020.
NextBioi35535469.
PROiQ9BPX7.

Gene expression databases

BgeeiQ9BPX7.
CleanExiHS_C7orf25.
ExpressionAtlasiQ9BPX7. baseline.
GenevisibleiQ9BPX7. HS.

Family and domain databases

InterProiIPR010733. DUF1308.
[Graphical view]
PANTHERiPTHR13379. PTHR13379. 1 hit.
PfamiPF07000. DUF1308. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  2. "The DNA sequence of human chromosome 7."
    Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L.
    , Nash W.E., Cordes M., Du H., Sun H., Edwards J., Bradshaw-Cordum H., Ali J., Andrews S., Isak A., Vanbrunt A., Nguyen C., Du F., Lamar B., Courtney L., Kalicki J., Ozersky P., Bielicki L., Scott K., Holmes A., Harkins R., Harris A., Strong C.M., Hou S., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Leonard S., Rohlfing T., Rock S.M., Tin-Wollam A.-M., Abbott A., Minx P., Maupin R., Strowmatt C., Latreille P., Miller N., Johnson D., Murray J., Woessner J.P., Wendl M.C., Yang S.-P., Schultz B.R., Wallis J.W., Spieth J., Bieri T.A., Nelson J.O., Berkowicz N., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Bedell J.A., Mardis E.R., Clifton S.W., Chissoe S.L., Marra M.A., Raymond C., Haugen E., Gillett W., Zhou Y., James R., Phelps K., Iadanoto S., Bubb K., Simms E., Levy R., Clendenning J., Kaul R., Kent W.J., Furey T.S., Baertsch R.A., Brent M.R., Keibler E., Flicek P., Bork P., Suyama M., Bailey J.A., Portnoy M.E., Torrents D., Chinwalla A.T., Gish W.R., Eddy S.R., McPherson J.D., Olson M.V., Eichler E.E., Green E.D., Waterston R.H., Wilson R.K.
    Nature 424:157-164(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "Human chromosome 7: DNA sequence and biology."
    Scherer S.W., Cheung J., MacDonald J.R., Osborne L.R., Nakabayashi K., Herbrick J.-A., Carson A.R., Parker-Katiraee L., Skaug J., Khaja R., Zhang J., Hudek A.K., Li M., Haddad M., Duggan G.E., Fernandez B.A., Kanematsu E., Gentles S.
    , Christopoulos C.C., Choufani S., Kwasnicka D., Zheng X.H., Lai Z., Nusskern D.R., Zhang Q., Gu Z., Lu F., Zeesman S., Nowaczyk M.J., Teshima I., Chitayat D., Shuman C., Weksberg R., Zackai E.H., Grebe T.A., Cox S.R., Kirkpatrick S.J., Rahman N., Friedman J.M., Heng H.H.Q., Pelicci P.G., Lo-Coco F., Belloni E., Shaffer L.G., Pober B., Morton C.C., Gusella J.F., Bruns G.A.P., Korf B.R., Quade B.J., Ligon A.H., Ferguson H., Higgins A.W., Leach N.T., Herrick S.R., Lemyre E., Farra C.G., Kim H.-G., Summers A.M., Gripp K.W., Roberts W., Szatmari P., Winsor E.J.T., Grzeschik K.-H., Teebi A., Minassian B.A., Kere J., Armengol L., Pujana M.A., Estivill X., Wilson M.D., Koop B.F., Tosi S., Moore G.E., Boright A.P., Zlotorynski E., Kerem B., Kroisel P.M., Petek E., Oscier D.G., Mould S.J., Doehner H., Doehner K., Rommens J.M., Vincent J.B., Venter J.C., Li P.W., Mural R.J., Adams M.D., Tsui L.-C.
    Science 300:767-772(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA].
    Tissue: Muscle.
  5. "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks."
    Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M.
    Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.

Entry informationi

Entry nameiCG025_HUMAN
AccessioniPrimary (citable) accession number: Q9BPX7
Secondary accession number(s): A4D1V2, J3KR36, Q9H779
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 6, 2007
Last sequence update: June 1, 2001
Last modified: June 24, 2015
This is version 94 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families
  5. Uncharacterized protein families (UPF)
    List of uncharacterized protein family (UPF) entries

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.