Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9BPX7

- CG025_HUMAN

UniProt

Q9BPX7 - CG025_HUMAN

Protein

UPF0415 protein C7orf25

Gene

C7orf25

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 2 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 88 (01 Oct 2014)
      Sequence version 1 (01 Jun 2001)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    UPF0415 protein C7orf25
    Gene namesi
    Name:C7orf25
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 7

    Organism-specific databases

    HGNCiHGNC:21703. C7orf25.

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA134976499.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 421421UPF0415 protein C7orf25PRO_0000279529Add
    BLAST

    Proteomic databases

    MaxQBiQ9BPX7.
    PaxDbiQ9BPX7.
    PRIDEiQ9BPX7.

    PTM databases

    PhosphoSiteiQ9BPX7.

    Expressioni

    Gene expression databases

    BgeeiQ9BPX7.
    CleanExiHS_C7orf25.
    GenevestigatoriQ9BPX7.

    Organism-specific databases

    HPAiHPA020120.

    Interactioni

    Protein-protein interaction databases

    BioGridi122489. 17 interactions.
    IntActiQ9BPX7. 18 interactions.
    MINTiMINT-6780908.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9BPX7.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the UPF0415 family.Curated

    Phylogenomic databases

    eggNOGiNOG248806.
    HOGENOMiHOG000043090.
    HOVERGENiHBG081122.
    InParanoidiQ9BPX7.
    OMAiHNIWQGR.
    OrthoDBiEOG78SQJG.
    PhylomeDBiQ9BPX7.
    TreeFamiTF105980.

    Family and domain databases

    InterProiIPR010733. DUF1308.
    [Graphical view]
    PANTHERiPTHR13379. PTHR13379. 1 hit.
    PfamiPF07000. DUF1308. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9BPX7-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MSAHSMLCER IAIAKELIKR AESLSRSRKG GIEGGAKLCS KLKAELKFLQ    50
    KVEAGKVAIK ESHLQSTNLT HLRAIVESAE NLEEVVSVLH VFGYTDTLGE 100
    KQTLVVDVVA NGGHTWVKAI GRKAEALHNI WLGRGQYGDK SIIEQAEDFL 150
    QASHQQPVQY SNPHIIFAFY NSVSSPMAEK LKEMGISVRG DIVAVNALLD 200
    HPEELQPSES ESDDEGPELL QVTRVDRENI LASVAFPTEI KVDVCKRVNL 250
    DITTLITYVS ALSYGGCHFI FKEKVLTEQA EQERKEQVLP QLEAFMKDKE 300
    LFACESAVKD FQSILDTLGG PGERERATVL IKRINVVPDQ PSERALRLVA 350
    SSKINSRSLT IFGTGDTLKA ITMTANSGFV RAANNQGVKF SVFIHQPRAL 400
    TESKEALATP LPKDYTTDSE H 421
    Length:421
    Mass (Da):46,451
    Last modified:June 1, 2001 - v1
    Checksum:iD7C421DC4CA80E9C
    GO
    Isoform 2 (identifier: Q9BPX7-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MQEVPEAAGLARVEPPRRSSGVGAARLRFPGGSRPLRARACVLALAVLALPERNNADSM

    Show »
    Length:479
    Mass (Da):52,512
    Checksum:i630A064E280E4A7D
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti131 – 1311W → R in BAB15019. (PubMed:14702039)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti265 – 2651G → E.
    Corresponds to variant rs3735471 [ dbSNP | Ensembl ].
    VAR_053848

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 11M → MQEVPEAAGLARVEPPRRSS GVGAARLRFPGGSRPLRARA CVLALAVLALPERNNADSM in isoform 2. CuratedVSP_047243

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK024820 mRNA. Translation: BAB15019.1.
    AC010132 Genomic DNA. No translation available.
    CH236951 Genomic DNA. Translation: EAL24004.1.
    BC000769 mRNA. Translation: AAH00769.1.
    BC001845 mRNA. Translation: AAH01845.1.
    CCDSiCCDS47576.1. [Q9BPX7-2]
    CCDS5466.1. [Q9BPX7-1]
    RefSeqiNP_001093328.1. NM_001099858.1. [Q9BPX7-2]
    NP_076959.2. NM_024054.2. [Q9BPX7-1]
    XP_005249901.1. XM_005249844.2. [Q9BPX7-1]
    UniGeneiHs.698120.

    Genome annotation databases

    EnsembliENST00000350427; ENSP00000343364; ENSG00000136197. [Q9BPX7-1]
    ENST00000431882; ENSP00000416290; ENSG00000136197. [Q9BPX7-2]
    ENST00000438029; ENSP00000396597; ENSG00000136197. [Q9BPX7-1]
    ENST00000447342; ENSP00000413029; ENSG00000136197. [Q9BPX7-1]
    GeneIDi79020.
    KEGGihsa:79020.
    UCSCiuc010kxq.3. human. [Q9BPX7-1]

    Polymorphism databases

    DMDMi74732797.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK024820 mRNA. Translation: BAB15019.1 .
    AC010132 Genomic DNA. No translation available.
    CH236951 Genomic DNA. Translation: EAL24004.1 .
    BC000769 mRNA. Translation: AAH00769.1 .
    BC001845 mRNA. Translation: AAH01845.1 .
    CCDSi CCDS47576.1. [Q9BPX7-2 ]
    CCDS5466.1. [Q9BPX7-1 ]
    RefSeqi NP_001093328.1. NM_001099858.1. [Q9BPX7-2 ]
    NP_076959.2. NM_024054.2. [Q9BPX7-1 ]
    XP_005249901.1. XM_005249844.2. [Q9BPX7-1 ]
    UniGenei Hs.698120.

    3D structure databases

    ProteinModelPortali Q9BPX7.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 122489. 17 interactions.
    IntActi Q9BPX7. 18 interactions.
    MINTi MINT-6780908.

    PTM databases

    PhosphoSitei Q9BPX7.

    Polymorphism databases

    DMDMi 74732797.

    Proteomic databases

    MaxQBi Q9BPX7.
    PaxDbi Q9BPX7.
    PRIDEi Q9BPX7.

    Protocols and materials databases

    DNASUi 79020.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000350427 ; ENSP00000343364 ; ENSG00000136197 . [Q9BPX7-1 ]
    ENST00000431882 ; ENSP00000416290 ; ENSG00000136197 . [Q9BPX7-2 ]
    ENST00000438029 ; ENSP00000396597 ; ENSG00000136197 . [Q9BPX7-1 ]
    ENST00000447342 ; ENSP00000413029 ; ENSG00000136197 . [Q9BPX7-1 ]
    GeneIDi 79020.
    KEGGi hsa:79020.
    UCSCi uc010kxq.3. human. [Q9BPX7-1 ]

    Organism-specific databases

    CTDi 79020.
    GeneCardsi GC07M042948.
    H-InvDB HIX0201127.
    HGNCi HGNC:21703. C7orf25.
    HPAi HPA020120.
    neXtProti NX_Q9BPX7.
    PharmGKBi PA134976499.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG248806.
    HOGENOMi HOG000043090.
    HOVERGENi HBG081122.
    InParanoidi Q9BPX7.
    OMAi HNIWQGR.
    OrthoDBi EOG78SQJG.
    PhylomeDBi Q9BPX7.
    TreeFami TF105980.

    Miscellaneous databases

    ChiTaRSi C7orf25. human.
    GenomeRNAii 79020.
    NextBioi 35535469.

    Gene expression databases

    Bgeei Q9BPX7.
    CleanExi HS_C7orf25.
    Genevestigatori Q9BPX7.

    Family and domain databases

    InterProi IPR010733. DUF1308.
    [Graphical view ]
    PANTHERi PTHR13379. PTHR13379. 1 hit.
    Pfami PF07000. DUF1308. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    2. "The DNA sequence of human chromosome 7."
      Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L.
      , Nash W.E., Cordes M., Du H., Sun H., Edwards J., Bradshaw-Cordum H., Ali J., Andrews S., Isak A., Vanbrunt A., Nguyen C., Du F., Lamar B., Courtney L., Kalicki J., Ozersky P., Bielicki L., Scott K., Holmes A., Harkins R., Harris A., Strong C.M., Hou S., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Leonard S., Rohlfing T., Rock S.M., Tin-Wollam A.-M., Abbott A., Minx P., Maupin R., Strowmatt C., Latreille P., Miller N., Johnson D., Murray J., Woessner J.P., Wendl M.C., Yang S.-P., Schultz B.R., Wallis J.W., Spieth J., Bieri T.A., Nelson J.O., Berkowicz N., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Bedell J.A., Mardis E.R., Clifton S.W., Chissoe S.L., Marra M.A., Raymond C., Haugen E., Gillett W., Zhou Y., James R., Phelps K., Iadanoto S., Bubb K., Simms E., Levy R., Clendenning J., Kaul R., Kent W.J., Furey T.S., Baertsch R.A., Brent M.R., Keibler E., Flicek P., Bork P., Suyama M., Bailey J.A., Portnoy M.E., Torrents D., Chinwalla A.T., Gish W.R., Eddy S.R., McPherson J.D., Olson M.V., Eichler E.E., Green E.D., Waterston R.H., Wilson R.K.
      Nature 424:157-164(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    3. "Human chromosome 7: DNA sequence and biology."
      Scherer S.W., Cheung J., MacDonald J.R., Osborne L.R., Nakabayashi K., Herbrick J.-A., Carson A.R., Parker-Katiraee L., Skaug J., Khaja R., Zhang J., Hudek A.K., Li M., Haddad M., Duggan G.E., Fernandez B.A., Kanematsu E., Gentles S.
      , Christopoulos C.C., Choufani S., Kwasnicka D., Zheng X.H., Lai Z., Nusskern D.R., Zhang Q., Gu Z., Lu F., Zeesman S., Nowaczyk M.J., Teshima I., Chitayat D., Shuman C., Weksberg R., Zackai E.H., Grebe T.A., Cox S.R., Kirkpatrick S.J., Rahman N., Friedman J.M., Heng H.H.Q., Pelicci P.G., Lo-Coco F., Belloni E., Shaffer L.G., Pober B., Morton C.C., Gusella J.F., Bruns G.A.P., Korf B.R., Quade B.J., Ligon A.H., Ferguson H., Higgins A.W., Leach N.T., Herrick S.R., Lemyre E., Farra C.G., Kim H.-G., Summers A.M., Gripp K.W., Roberts W., Szatmari P., Winsor E.J.T., Grzeschik K.-H., Teebi A., Minassian B.A., Kere J., Armengol L., Pujana M.A., Estivill X., Wilson M.D., Koop B.F., Tosi S., Moore G.E., Boright A.P., Zlotorynski E., Kerem B., Kroisel P.M., Petek E., Oscier D.G., Mould S.J., Doehner H., Doehner K., Rommens J.M., Vincent J.B., Venter J.C., Li P.W., Mural R.J., Adams M.D., Tsui L.-C.
      Science 300:767-772(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA].
      Tissue: Muscle.
    5. "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks."
      Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M.
      Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.

    Entry informationi

    Entry nameiCG025_HUMAN
    AccessioniPrimary (citable) accession number: Q9BPX7
    Secondary accession number(s): A4D1V2, J3KR36, Q9H779
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: March 6, 2007
    Last sequence update: June 1, 2001
    Last modified: October 1, 2014
    This is version 88 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 7
      Human chromosome 7: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. SIMILARITY comments
      Index of protein domains and families
    5. Uncharacterized protein families (UPF)
      List of uncharacterized protein family (UPF) entries

    External Data

    Dasty 3