SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9BPX7

- CG025_HUMAN

UniProt

Q9BPX7 - CG025_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
UPF0415 protein C7orf25
Gene
C7orf25
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 2 out of 5 - Experimental evidence at protein leveli

Names & Taxonomyi

Protein namesi
Recommended name:
UPF0415 protein C7orf25
Gene namesi
Name:C7orf25
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 7

Organism-specific databases

HGNCiHGNC:21703. C7orf25.

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134976499.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 421421UPF0415 protein C7orf25
PRO_0000279529Add
BLAST

Proteomic databases

MaxQBiQ9BPX7.
PaxDbiQ9BPX7.
PRIDEiQ9BPX7.

PTM databases

PhosphoSiteiQ9BPX7.

Expressioni

Gene expression databases

BgeeiQ9BPX7.
CleanExiHS_C7orf25.
GenevestigatoriQ9BPX7.

Organism-specific databases

HPAiHPA020120.

Interactioni

Protein-protein interaction databases

BioGridi122489. 16 interactions.
IntActiQ9BPX7. 18 interactions.
MINTiMINT-6780908.

Structurei

3D structure databases

ProteinModelPortaliQ9BPX7.

Family & Domainsi

Sequence similaritiesi

Belongs to the UPF0415 family.

Phylogenomic databases

eggNOGiNOG248806.
HOGENOMiHOG000043090.
HOVERGENiHBG081122.
InParanoidiQ9BPX7.
OMAiHNIWQGR.
OrthoDBiEOG78SQJG.
PhylomeDBiQ9BPX7.
TreeFamiTF105980.

Family and domain databases

InterProiIPR010733. DUF1308.
[Graphical view]
PANTHERiPTHR13379. PTHR13379. 1 hit.
PfamiPF07000. DUF1308. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9BPX7-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MSAHSMLCER IAIAKELIKR AESLSRSRKG GIEGGAKLCS KLKAELKFLQ    50
KVEAGKVAIK ESHLQSTNLT HLRAIVESAE NLEEVVSVLH VFGYTDTLGE 100
KQTLVVDVVA NGGHTWVKAI GRKAEALHNI WLGRGQYGDK SIIEQAEDFL 150
QASHQQPVQY SNPHIIFAFY NSVSSPMAEK LKEMGISVRG DIVAVNALLD 200
HPEELQPSES ESDDEGPELL QVTRVDRENI LASVAFPTEI KVDVCKRVNL 250
DITTLITYVS ALSYGGCHFI FKEKVLTEQA EQERKEQVLP QLEAFMKDKE 300
LFACESAVKD FQSILDTLGG PGERERATVL IKRINVVPDQ PSERALRLVA 350
SSKINSRSLT IFGTGDTLKA ITMTANSGFV RAANNQGVKF SVFIHQPRAL 400
TESKEALATP LPKDYTTDSE H 421
Length:421
Mass (Da):46,451
Last modified:June 1, 2001 - v1
Checksum:iD7C421DC4CA80E9C
GO
Isoform 2 (identifier: Q9BPX7-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MQEVPEAAGLARVEPPRRSSGVGAARLRFPGGSRPLRARACVLALAVLALPERNNADSM

Show »
Length:479
Mass (Da):52,512
Checksum:i630A064E280E4A7D
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti265 – 2651G → E.
Corresponds to variant rs3735471 [ dbSNP | Ensembl ].
VAR_053848

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 11M → MQEVPEAAGLARVEPPRRSS GVGAARLRFPGGSRPLRARA CVLALAVLALPERNNADSM in isoform 2.
VSP_047243

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti131 – 1311W → R in BAB15019. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK024820 mRNA. Translation: BAB15019.1.
AC010132 Genomic DNA. No translation available.
CH236951 Genomic DNA. Translation: EAL24004.1.
BC000769 mRNA. Translation: AAH00769.1.
BC001845 mRNA. Translation: AAH01845.1.
CCDSiCCDS47576.1. [Q9BPX7-2]
CCDS5466.1. [Q9BPX7-1]
RefSeqiNP_001093328.1. NM_001099858.1. [Q9BPX7-2]
NP_076959.2. NM_024054.2. [Q9BPX7-1]
XP_005249901.1. XM_005249844.2. [Q9BPX7-1]
UniGeneiHs.698120.

Genome annotation databases

EnsembliENST00000350427; ENSP00000343364; ENSG00000136197. [Q9BPX7-1]
ENST00000431882; ENSP00000416290; ENSG00000136197. [Q9BPX7-2]
ENST00000438029; ENSP00000396597; ENSG00000136197. [Q9BPX7-1]
ENST00000447342; ENSP00000413029; ENSG00000136197. [Q9BPX7-1]
GeneIDi79020.
KEGGihsa:79020.
UCSCiuc010kxq.3. human. [Q9BPX7-1]

Polymorphism databases

DMDMi74732797.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK024820 mRNA. Translation: BAB15019.1 .
AC010132 Genomic DNA. No translation available.
CH236951 Genomic DNA. Translation: EAL24004.1 .
BC000769 mRNA. Translation: AAH00769.1 .
BC001845 mRNA. Translation: AAH01845.1 .
CCDSi CCDS47576.1. [Q9BPX7-2 ]
CCDS5466.1. [Q9BPX7-1 ]
RefSeqi NP_001093328.1. NM_001099858.1. [Q9BPX7-2 ]
NP_076959.2. NM_024054.2. [Q9BPX7-1 ]
XP_005249901.1. XM_005249844.2. [Q9BPX7-1 ]
UniGenei Hs.698120.

3D structure databases

ProteinModelPortali Q9BPX7.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 122489. 16 interactions.
IntActi Q9BPX7. 18 interactions.
MINTi MINT-6780908.

PTM databases

PhosphoSitei Q9BPX7.

Polymorphism databases

DMDMi 74732797.

Proteomic databases

MaxQBi Q9BPX7.
PaxDbi Q9BPX7.
PRIDEi Q9BPX7.

Protocols and materials databases

DNASUi 79020.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000350427 ; ENSP00000343364 ; ENSG00000136197 . [Q9BPX7-1 ]
ENST00000431882 ; ENSP00000416290 ; ENSG00000136197 . [Q9BPX7-2 ]
ENST00000438029 ; ENSP00000396597 ; ENSG00000136197 . [Q9BPX7-1 ]
ENST00000447342 ; ENSP00000413029 ; ENSG00000136197 . [Q9BPX7-1 ]
GeneIDi 79020.
KEGGi hsa:79020.
UCSCi uc010kxq.3. human. [Q9BPX7-1 ]

Organism-specific databases

CTDi 79020.
GeneCardsi GC07M042948.
H-InvDB HIX0201127.
HGNCi HGNC:21703. C7orf25.
HPAi HPA020120.
neXtProti NX_Q9BPX7.
PharmGKBi PA134976499.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG248806.
HOGENOMi HOG000043090.
HOVERGENi HBG081122.
InParanoidi Q9BPX7.
OMAi HNIWQGR.
OrthoDBi EOG78SQJG.
PhylomeDBi Q9BPX7.
TreeFami TF105980.

Miscellaneous databases

ChiTaRSi C7orf25. human.
GenomeRNAii 79020.
NextBioi 35535469.

Gene expression databases

Bgeei Q9BPX7.
CleanExi HS_C7orf25.
Genevestigatori Q9BPX7.

Family and domain databases

InterProi IPR010733. DUF1308.
[Graphical view ]
PANTHERi PTHR13379. PTHR13379. 1 hit.
Pfami PF07000. DUF1308. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  2. "The DNA sequence of human chromosome 7."
    Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L.
    , Nash W.E., Cordes M., Du H., Sun H., Edwards J., Bradshaw-Cordum H., Ali J., Andrews S., Isak A., Vanbrunt A., Nguyen C., Du F., Lamar B., Courtney L., Kalicki J., Ozersky P., Bielicki L., Scott K., Holmes A., Harkins R., Harris A., Strong C.M., Hou S., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Leonard S., Rohlfing T., Rock S.M., Tin-Wollam A.-M., Abbott A., Minx P., Maupin R., Strowmatt C., Latreille P., Miller N., Johnson D., Murray J., Woessner J.P., Wendl M.C., Yang S.-P., Schultz B.R., Wallis J.W., Spieth J., Bieri T.A., Nelson J.O., Berkowicz N., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Bedell J.A., Mardis E.R., Clifton S.W., Chissoe S.L., Marra M.A., Raymond C., Haugen E., Gillett W., Zhou Y., James R., Phelps K., Iadanoto S., Bubb K., Simms E., Levy R., Clendenning J., Kaul R., Kent W.J., Furey T.S., Baertsch R.A., Brent M.R., Keibler E., Flicek P., Bork P., Suyama M., Bailey J.A., Portnoy M.E., Torrents D., Chinwalla A.T., Gish W.R., Eddy S.R., McPherson J.D., Olson M.V., Eichler E.E., Green E.D., Waterston R.H., Wilson R.K.
    Nature 424:157-164(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "Human chromosome 7: DNA sequence and biology."
    Scherer S.W., Cheung J., MacDonald J.R., Osborne L.R., Nakabayashi K., Herbrick J.-A., Carson A.R., Parker-Katiraee L., Skaug J., Khaja R., Zhang J., Hudek A.K., Li M., Haddad M., Duggan G.E., Fernandez B.A., Kanematsu E., Gentles S.
    , Christopoulos C.C., Choufani S., Kwasnicka D., Zheng X.H., Lai Z., Nusskern D.R., Zhang Q., Gu Z., Lu F., Zeesman S., Nowaczyk M.J., Teshima I., Chitayat D., Shuman C., Weksberg R., Zackai E.H., Grebe T.A., Cox S.R., Kirkpatrick S.J., Rahman N., Friedman J.M., Heng H.H.Q., Pelicci P.G., Lo-Coco F., Belloni E., Shaffer L.G., Pober B., Morton C.C., Gusella J.F., Bruns G.A.P., Korf B.R., Quade B.J., Ligon A.H., Ferguson H., Higgins A.W., Leach N.T., Herrick S.R., Lemyre E., Farra C.G., Kim H.-G., Summers A.M., Gripp K.W., Roberts W., Szatmari P., Winsor E.J.T., Grzeschik K.-H., Teebi A., Minassian B.A., Kere J., Armengol L., Pujana M.A., Estivill X., Wilson M.D., Koop B.F., Tosi S., Moore G.E., Boright A.P., Zlotorynski E., Kerem B., Kroisel P.M., Petek E., Oscier D.G., Mould S.J., Doehner H., Doehner K., Rommens J.M., Vincent J.B., Venter J.C., Li P.W., Mural R.J., Adams M.D., Tsui L.-C.
    Science 300:767-772(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA].
    Tissue: Muscle.
  5. "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks."
    Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M.
    Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.

Entry informationi

Entry nameiCG025_HUMAN
AccessioniPrimary (citable) accession number: Q9BPX7
Secondary accession number(s): A4D1V2, J3KR36, Q9H779
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 6, 2007
Last sequence update: June 1, 2001
Last modified: July 9, 2014
This is version 87 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families
  5. Uncharacterized protein families (UPF)
    List of uncharacterized protein family (UPF) entries

External Data

Dasty 3

Similar proteinsi