Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9BPX7 (CG025_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 85. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
UPF0415 protein C7orf25
Gene names
Name:C7orf25
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length421 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Sequence similarities

Belongs to the UPF0415 family.

Ontologies

Keywords
   Coding sequence diversityAlternative splicing
Polymorphism
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
None. [Check GOA]

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q9BPX7-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q9BPX7-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MQEVPEAAGLARVEPPRRSSGVGAARLRFPGGSRPLRARACVLALAVLALPERNNADSM

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 421421UPF0415 protein C7orf25
PRO_0000279529

Natural variations

Alternative sequence11M → MQEVPEAAGLARVEPPRRSS GVGAARLRFPGGSRPLRARA CVLALAVLALPERNNADSM in isoform 2.
VSP_047243
Natural variant2651G → E.
Corresponds to variant rs3735471 [ dbSNP | Ensembl ].
VAR_053848

Experimental info

Sequence conflict1311W → R in BAB15019. Ref.1

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified June 1, 2001. Version 1.
Checksum: D7C421DC4CA80E9C

FASTA42146,451
        10         20         30         40         50         60 
MSAHSMLCER IAIAKELIKR AESLSRSRKG GIEGGAKLCS KLKAELKFLQ KVEAGKVAIK 

        70         80         90        100        110        120 
ESHLQSTNLT HLRAIVESAE NLEEVVSVLH VFGYTDTLGE KQTLVVDVVA NGGHTWVKAI 

       130        140        150        160        170        180 
GRKAEALHNI WLGRGQYGDK SIIEQAEDFL QASHQQPVQY SNPHIIFAFY NSVSSPMAEK 

       190        200        210        220        230        240 
LKEMGISVRG DIVAVNALLD HPEELQPSES ESDDEGPELL QVTRVDRENI LASVAFPTEI 

       250        260        270        280        290        300 
KVDVCKRVNL DITTLITYVS ALSYGGCHFI FKEKVLTEQA EQERKEQVLP QLEAFMKDKE 

       310        320        330        340        350        360 
LFACESAVKD FQSILDTLGG PGERERATVL IKRINVVPDQ PSERALRLVA SSKINSRSLT 

       370        380        390        400        410        420 
IFGTGDTLKA ITMTANSGFV RAANNQGVKF SVFIHQPRAL TESKEALATP LPKDYTTDSE 


H 

« Hide

Isoform 2 [UniParc].

Checksum: 630A064E280E4A7D
Show »

FASTA47952,512

References

[1]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
[2]"The DNA sequence of human chromosome 7."
Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L. expand/collapse author list , Nash W.E., Cordes M., Du H., Sun H., Edwards J., Bradshaw-Cordum H., Ali J., Andrews S., Isak A., Vanbrunt A., Nguyen C., Du F., Lamar B., Courtney L., Kalicki J., Ozersky P., Bielicki L., Scott K., Holmes A., Harkins R., Harris A., Strong C.M., Hou S., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Leonard S., Rohlfing T., Rock S.M., Tin-Wollam A.-M., Abbott A., Minx P., Maupin R., Strowmatt C., Latreille P., Miller N., Johnson D., Murray J., Woessner J.P., Wendl M.C., Yang S.-P., Schultz B.R., Wallis J.W., Spieth J., Bieri T.A., Nelson J.O., Berkowicz N., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Bedell J.A., Mardis E.R., Clifton S.W., Chissoe S.L., Marra M.A., Raymond C., Haugen E., Gillett W., Zhou Y., James R., Phelps K., Iadanoto S., Bubb K., Simms E., Levy R., Clendenning J., Kaul R., Kent W.J., Furey T.S., Baertsch R.A., Brent M.R., Keibler E., Flicek P., Bork P., Suyama M., Bailey J.A., Portnoy M.E., Torrents D., Chinwalla A.T., Gish W.R., Eddy S.R., McPherson J.D., Olson M.V., Eichler E.E., Green E.D., Waterston R.H., Wilson R.K.
Nature 424:157-164(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[3]"Human chromosome 7: DNA sequence and biology."
Scherer S.W., Cheung J., MacDonald J.R., Osborne L.R., Nakabayashi K., Herbrick J.-A., Carson A.R., Parker-Katiraee L., Skaug J., Khaja R., Zhang J., Hudek A.K., Li M., Haddad M., Duggan G.E., Fernandez B.A., Kanematsu E., Gentles S. expand/collapse author list , Christopoulos C.C., Choufani S., Kwasnicka D., Zheng X.H., Lai Z., Nusskern D.R., Zhang Q., Gu Z., Lu F., Zeesman S., Nowaczyk M.J., Teshima I., Chitayat D., Shuman C., Weksberg R., Zackai E.H., Grebe T.A., Cox S.R., Kirkpatrick S.J., Rahman N., Friedman J.M., Heng H.H.Q., Pelicci P.G., Lo-Coco F., Belloni E., Shaffer L.G., Pober B., Morton C.C., Gusella J.F., Bruns G.A.P., Korf B.R., Quade B.J., Ligon A.H., Ferguson H., Higgins A.W., Leach N.T., Herrick S.R., Lemyre E., Farra C.G., Kim H.-G., Summers A.M., Gripp K.W., Roberts W., Szatmari P., Winsor E.J.T., Grzeschik K.-H., Teebi A., Minassian B.A., Kere J., Armengol L., Pujana M.A., Estivill X., Wilson M.D., Koop B.F., Tosi S., Moore G.E., Boright A.P., Zlotorynski E., Kerem B., Kroisel P.M., Petek E., Oscier D.G., Mould S.J., Doehner H., Doehner K., Rommens J.M., Vincent J.B., Venter J.C., Li P.W., Mural R.J., Adams M.D., Tsui L.-C.
Science 300:767-772(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[4]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA].
Tissue: Muscle.
[5]"Global, in vivo, and site-specific phosphorylation dynamics in signaling networks."
Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M.
Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AK024820 mRNA. Translation: BAB15019.1.
AC010132 Genomic DNA. No translation available.
CH236951 Genomic DNA. Translation: EAL24004.1.
BC000769 mRNA. Translation: AAH00769.1.
BC001845 mRNA. Translation: AAH01845.1.
RefSeqNP_001093328.1. NM_001099858.1.
NP_076959.2. NM_024054.2.
XP_005249901.1. XM_005249844.2.
UniGeneHs.698120.

3D structure databases

ProteinModelPortalQ9BPX7.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid122489. 16 interactions.
IntActQ9BPX7. 18 interactions.
MINTMINT-6780908.

PTM databases

PhosphoSiteQ9BPX7.

Polymorphism databases

DMDM74732797.

Proteomic databases

PaxDbQ9BPX7.
PRIDEQ9BPX7.

Protocols and materials databases

DNASU79020.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000350427; ENSP00000343364; ENSG00000136197. [Q9BPX7-1]
ENST00000431882; ENSP00000416290; ENSG00000136197. [Q9BPX7-2]
ENST00000438029; ENSP00000396597; ENSG00000136197. [Q9BPX7-1]
ENST00000447342; ENSP00000413029; ENSG00000136197. [Q9BPX7-1]
GeneID79020.
KEGGhsa:79020.
UCSCuc010kxq.3. human. [Q9BPX7-1]

Organism-specific databases

CTD79020.
GeneCardsGC07M042948.
H-InvDBHIX0201127.
HGNCHGNC:21703. C7orf25.
HPAHPA020120.
neXtProtNX_Q9BPX7.
PharmGKBPA134976499.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG248806.
HOGENOMHOG000043090.
HOVERGENHBG081122.
InParanoidQ9BPX7.
OMAHNIWQGR.
OrthoDBEOG78SQJG.
PhylomeDBQ9BPX7.
TreeFamTF105980.

Gene expression databases

BgeeQ9BPX7.
CleanExHS_C7orf25.
GenevestigatorQ9BPX7.

Family and domain databases

InterProIPR010733. DUF1308.
[Graphical view]
PANTHERPTHR13379. PTHR13379. 1 hit.
PfamPF07000. DUF1308. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSC7orf25. human.
GenomeRNAi79020.
NextBio35535469.

Entry information

Entry nameCG025_HUMAN
AccessionPrimary (citable) accession number: Q9BPX7
Secondary accession number(s): A4D1V2, J3KR36, Q9H779
Entry history
Integrated into UniProtKB/Swiss-Prot: March 6, 2007
Last sequence update: June 1, 2001
Last modified: April 16, 2014
This is version 85 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

Uncharacterized protein families (UPF)

List of uncharacterized protein family (UPF) entries

SIMILARITY comments

Index of protein domains and families

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 7

Human chromosome 7: entries, gene names and cross-references to MIM