Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Dehydrogenase/reductase SDR family member 9

Gene

DHRS9

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

3-alpha-hydroxysteroid dehydrogenase that converts 3-alpha-tetrahydroprogesterone (allopregnanolone) to dihydroxyprogesterone and 3-alpha-androstanediol to dihydroxyprogesterone. May play a role in the biosynthesis of retinoic acid from retinaldehyde, but seems to have low activity with retinoids. Can utilize both NADH and NADPH.3 Publications

Kineticsi

  1. KM=9 µM for NADH1 Publication
  2. KM=72 µM for NAD1 Publication
  3. KM=5 µM for allopregnanolone1 Publication
  4. KM=7.5 µM for 3-alpha-androstanediol1 Publication
  5. KM=24 µM for androsterone1 Publication
  6. KM=12 µM for dihydrotestosterone1 Publication

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Binding sitei83 – 831NADBy similarity
    Binding sitei164 – 1641SubstrateBy similarity
    Active sitei176 – 1761Proton acceptorBy similarity
    Binding sitei180 – 1801NADBy similarity

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Nucleotide bindingi34 – 5825NADBy similarityAdd
    BLAST

    GO - Molecular functioni

    • alcohol dehydrogenase (NAD) activity Source: UniProtKB
    • racemase and epimerase activity Source: UniProtKB
    • retinol dehydrogenase activity Source: UniProtKB
    • testosterone dehydrogenase (NAD+) activity Source: UniProtKB

    GO - Biological processi

    • 9-cis-retinoic acid biosynthetic process Source: UniProtKB
    • androgen metabolic process Source: UniProtKB
    • epithelial cell differentiation Source: UniProtKB
    • progesterone metabolic process Source: UniProtKB
    • retinol metabolic process Source: UniProtKB
    Complete GO annotation...

    Keywords - Molecular functioni

    Oxidoreductase

    Keywords - Ligandi

    NAD, NADP

    Enzyme and pathway databases

    BioCyciMetaCyc:HS01113-MONOMER.
    ReactomeiR-HSA-2453902. The canonical retinoid cycle in rods (twilight vision).
    R-HSA-5365859. RA biosynthesis pathway.
    SABIO-RKQ9BPW9.

    Chemistry

    SwissLipidsiSLP:000000793.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Dehydrogenase/reductase SDR family member 9 (EC:1.1.-.-)
    Alternative name(s):
    3-alpha hydroxysteroid dehydrogenase
    Short name:
    3-alpha-HSD
    NADP-dependent retinol dehydrogenase/reductase
    RDH-E2
    RDHL
    Retinol dehydrogenase 15
    Short chain dehydrogenase/reductase family 9C member 4
    Short-chain dehydrogenase/reductase retSDR8
    Tracheobronchial epithelial cell-specific retinol dehydrogenase
    Short name:
    RDH-TBE
    Gene namesi
    Name:DHRS9
    Synonyms:RDH15, SDR9C4
    ORF Names:UNQ835/PRO1773
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    Proteomesi
    • UP000005640 Componenti: Chromosome 2

    Organism-specific databases

    HGNCiHGNC:16888. DHRS9.

    Subcellular locationi

    GO - Cellular componenti

    Complete GO annotation...

    Keywords - Cellular componenti

    Endoplasmic reticulum, Membrane, Microsome

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA134913654.

    Chemistry

    ChEMBLiCHEMBL5974.

    Polymorphism and mutation databases

    BioMutaiDHRS9.
    DMDMi74752227.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 1717Sequence analysisAdd
    BLAST
    Chaini18 – 319302Dehydrogenase/reductase SDR family member 9PRO_0000042617Add
    BLAST

    Proteomic databases

    EPDiQ9BPW9.
    MaxQBiQ9BPW9.
    PaxDbiQ9BPW9.
    PeptideAtlasiQ9BPW9.
    PRIDEiQ9BPW9.

    PTM databases

    PhosphoSiteiQ9BPW9.

    Expressioni

    Tissue specificityi

    Highly expressed in trachea and epidermis. Detected at lower levels in spinal cord, bone marrow, brain, tongue, esophagus, heart, colon, testis, placenta, lung, skeletal muscle and lymph node.3 Publications

    Gene expression databases

    BgeeiENSG00000073737.
    CleanExiHS_DHRS9.
    ExpressionAtlasiQ9BPW9. baseline and differential.
    GenevisibleiQ9BPW9. HS.

    Organism-specific databases

    HPAiHPA036491.
    HPA036667.

    Interactioni

    Subunit structurei

    Homotetramer.By similarity

    Protein-protein interaction databases

    BioGridi115472. 10 interactions.
    STRINGi9606.ENSP00000316670.

    Chemistry

    BindingDBiQ9BPW9.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9BPW9.
    SMRiQ9BPW9. Positions 27-264.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Sequence similaritiesi

    Keywords - Domaini

    Signal

    Phylogenomic databases

    eggNOGiKOG1610. Eukaryota.
    ENOG410Y7FK. LUCA.
    GeneTreeiENSGT00840000129713.
    HOVERGENiHBG005482.
    InParanoidiQ9BPW9.
    KOiK11149.
    OMAiLFPKTHY.
    OrthoDBiEOG091G0LMI.
    PhylomeDBiQ9BPW9.
    TreeFamiTF325617.

    Family and domain databases

    Gene3Di3.40.50.720. 1 hit.
    InterProiIPR016040. NAD(P)-bd_dom.
    IPR002347. SDR_fam.
    [Graphical view]
    PANTHERiPTHR24322. PTHR24322. 1 hit.
    PfamiPF00106. adh_short. 1 hit.
    [Graphical view]
    PRINTSiPR00081. GDHRDH.
    PR00080. SDRFAMILY.
    SUPFAMiSSF51735. SSF51735. 2 hits.

    Sequences (4)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

    Isoform 1 (identifier: Q9BPW9-1) [UniParc]FASTAAdd to basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

            10         20         30         40         50
    MLFWVLGLLI LCGFLWTRKG KLKIEDITDK YIFITGCDSG FGNLAARTFD
    60 70 80 90 100
    KKGFHVIAAC LTESGSTALK AETSERLRTV LLDVTDPENV KRTAQWVKNQ
    110 120 130 140 150
    VGEKGLWGLI NNAGVPGVLA PTDWLTLEDY REPIEVNLFG LISVTLNMLP
    160 170 180 190 200
    LVKKAQGRVI NVSSVGGRLA IVGGGYTPSK YAVEGFNDSL RRDMKAFGVH
    210 220 230 240 250
    VSCIEPGLFK TNLADPVKVI EKKLAIWEQL SPDIKQQYGE GYIEKSLDKL
    260 270 280 290 300
    KGNKSYVNMD LSPVVECMDH ALTSLFPKTH YAAGKDAKIF WIPLSHMPAA
    310
    LQDFLLLKQK AELANPKAV
    Length:319
    Mass (Da):35,227
    Last modified:June 1, 2001 - v1
    Checksum:iDEE8CD65E5C25C6F
    GO
    Isoform 2 (identifier: Q9BPW9-2) [UniParc]FASTAAdd to basket
    Also known as: Retinol dehydrogenase homolog isoform-2

    The sequence of this isoform differs from the canonical sequence as follows:
         1-147: Missing.

    Note: No experimental confirmation available.
    Show »
    Length:172
    Mass (Da):18,943
    Checksum:i463DDCEE1084DD43
    GO
    Isoform 3 (identifier: Q9BPW9-3) [UniParc]FASTAAdd to basket
    Also known as: Retinol dehydrogenase homolog isoform-1

    The sequence of this isoform differs from the canonical sequence as follows:
         206-246: PGLFKTNLADPVKVIEKKLAIWEQLSPDIKQQYGEGYIEKS → R

    Note: No experimental confirmation available.
    Show »
    Length:279
    Mass (Da):30,726
    Checksum:iB3E2180767B0759E
    GO
    Isoform 4 (identifier: Q9BPW9-4) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MPEGRSHCACSITSLTLLVSLTRVTLDILQKLDPPQPAHWRHHLLVLYKKGVYLSHTGGKM

    Note: No experimental confirmation available.
    Show »
    Length:379
    Mass (Da):41,927
    Checksum:i4298C15F253128A0
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti162 – 1621V → G in AAF82747 (Ref. 5) Curated
    Sequence conflicti194 – 1941M → L in AAF82747 (Ref. 5) Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti286 – 2861D → H.
    Corresponds to variant rs11695788 [ dbSNP | Ensembl ].
    VAR_052320

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 147147Missing in isoform 2. 1 PublicationVSP_015875Add
    BLAST
    Alternative sequencei1 – 11M → MPEGRSHCACSITSLTLLVS LTRVTLDILQKLDPPQPAHW RHHLLVLYKKGVYLSHTGGK M in isoform 4. 1 PublicationVSP_054357
    Alternative sequencei206 – 24641PGLFK…YIEKS → R in isoform 3. 1 PublicationVSP_015876Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBLi
    GenBanki
    DDBJi
    Links Updated
    AF343729 mRNA. Translation: AAK37528.1.
    AY017349 mRNA. Translation: AAG49422.1.
    AF529286 mRNA. Translation: AAN04008.1.
    AF529287 mRNA. Translation: AAN04009.1.
    AF529288 mRNA. Translation: AAN04010.1.
    AF295380 mRNA. Translation: AAL37037.1.
    AF240697 mRNA. Translation: AAF82747.1.
    AF240698 mRNA. Translation: AAF82748.1.
    AY359046 mRNA. Translation: AAQ89405.1.
    AK296625 mRNA. Translation: BAH12402.1.
    AC007556 Genomic DNA. No translation available.
    AC008177 Genomic DNA. No translation available.
    CH471058 Genomic DNA. Translation: EAX11282.1.
    CH471058 Genomic DNA. Translation: EAX11283.1.
    CH471058 Genomic DNA. Translation: EAX11284.1.
    BC058883 mRNA. Translation: AAH58883.1.
    CCDSiCCDS2231.1. [Q9BPW9-1]
    CCDS74600.1. [Q9BPW9-4]
    RefSeqiNP_001135742.1. NM_001142270.1. [Q9BPW9-1]
    NP_001135743.1. NM_001142271.1. [Q9BPW9-1]
    NP_001276692.1. NM_001289763.1. [Q9BPW9-4]
    NP_954674.1. NM_199204.1. [Q9BPW9-1]
    XP_011508777.1. XM_011510475.1. [Q9BPW9-1]
    UniGeneiHs.179608.

    Genome annotation databases

    EnsembliENST00000357546; ENSP00000350154; ENSG00000073737. [Q9BPW9-1]
    ENST00000412271; ENSP00000407747; ENSG00000073737. [Q9BPW9-1]
    ENST00000421653; ENSP00000388066; ENSG00000073737. [Q9BPW9-2]
    ENST00000428522; ENSP00000388564; ENSG00000073737. [Q9BPW9-1]
    ENST00000432060; ENSP00000389241; ENSG00000073737. [Q9BPW9-4]
    ENST00000436483; ENSP00000407167; ENSG00000073737. [Q9BPW9-1]
    ENST00000602501; ENSP00000473337; ENSG00000073737. [Q9BPW9-1]
    GeneIDi10170.
    KEGGihsa:10170.
    UCSCiuc002ueq.3. human. [Q9BPW9-1]

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBLi
    GenBanki
    DDBJi
    Links Updated
    AF343729 mRNA. Translation: AAK37528.1.
    AY017349 mRNA. Translation: AAG49422.1.
    AF529286 mRNA. Translation: AAN04008.1.
    AF529287 mRNA. Translation: AAN04009.1.
    AF529288 mRNA. Translation: AAN04010.1.
    AF295380 mRNA. Translation: AAL37037.1.
    AF240697 mRNA. Translation: AAF82747.1.
    AF240698 mRNA. Translation: AAF82748.1.
    AY359046 mRNA. Translation: AAQ89405.1.
    AK296625 mRNA. Translation: BAH12402.1.
    AC007556 Genomic DNA. No translation available.
    AC008177 Genomic DNA. No translation available.
    CH471058 Genomic DNA. Translation: EAX11282.1.
    CH471058 Genomic DNA. Translation: EAX11283.1.
    CH471058 Genomic DNA. Translation: EAX11284.1.
    BC058883 mRNA. Translation: AAH58883.1.
    CCDSiCCDS2231.1. [Q9BPW9-1]
    CCDS74600.1. [Q9BPW9-4]
    RefSeqiNP_001135742.1. NM_001142270.1. [Q9BPW9-1]
    NP_001135743.1. NM_001142271.1. [Q9BPW9-1]
    NP_001276692.1. NM_001289763.1. [Q9BPW9-4]
    NP_954674.1. NM_199204.1. [Q9BPW9-1]
    XP_011508777.1. XM_011510475.1. [Q9BPW9-1]
    UniGeneiHs.179608.

    3D structure databases

    ProteinModelPortaliQ9BPW9.
    SMRiQ9BPW9. Positions 27-264.
    ModBaseiSearch...
    MobiDBiSearch...

    Protein-protein interaction databases

    BioGridi115472. 10 interactions.
    STRINGi9606.ENSP00000316670.

    Chemistry

    BindingDBiQ9BPW9.
    ChEMBLiCHEMBL5974.
    SwissLipidsiSLP:000000793.

    PTM databases

    PhosphoSiteiQ9BPW9.

    Polymorphism and mutation databases

    BioMutaiDHRS9.
    DMDMi74752227.

    Proteomic databases

    EPDiQ9BPW9.
    MaxQBiQ9BPW9.
    PaxDbiQ9BPW9.
    PeptideAtlasiQ9BPW9.
    PRIDEiQ9BPW9.

    Protocols and materials databases

    DNASUi10170.
    Structural Biology KnowledgebaseSearch...

    Genome annotation databases

    EnsembliENST00000357546; ENSP00000350154; ENSG00000073737. [Q9BPW9-1]
    ENST00000412271; ENSP00000407747; ENSG00000073737. [Q9BPW9-1]
    ENST00000421653; ENSP00000388066; ENSG00000073737. [Q9BPW9-2]
    ENST00000428522; ENSP00000388564; ENSG00000073737. [Q9BPW9-1]
    ENST00000432060; ENSP00000389241; ENSG00000073737. [Q9BPW9-4]
    ENST00000436483; ENSP00000407167; ENSG00000073737. [Q9BPW9-1]
    ENST00000602501; ENSP00000473337; ENSG00000073737. [Q9BPW9-1]
    GeneIDi10170.
    KEGGihsa:10170.
    UCSCiuc002ueq.3. human. [Q9BPW9-1]

    Organism-specific databases

    CTDi10170.
    GeneCardsiDHRS9.
    HGNCiHGNC:16888. DHRS9.
    HPAiHPA036491.
    HPA036667.
    MIMi612131. gene.
    neXtProtiNX_Q9BPW9.
    PharmGKBiPA134913654.
    GenAtlasiSearch...

    Phylogenomic databases

    eggNOGiKOG1610. Eukaryota.
    ENOG410Y7FK. LUCA.
    GeneTreeiENSGT00840000129713.
    HOVERGENiHBG005482.
    InParanoidiQ9BPW9.
    KOiK11149.
    OMAiLFPKTHY.
    OrthoDBiEOG091G0LMI.
    PhylomeDBiQ9BPW9.
    TreeFamiTF325617.

    Enzyme and pathway databases

    BioCyciMetaCyc:HS01113-MONOMER.
    ReactomeiR-HSA-2453902. The canonical retinoid cycle in rods (twilight vision).
    R-HSA-5365859. RA biosynthesis pathway.
    SABIO-RKQ9BPW9.

    Miscellaneous databases

    GeneWikiiDHRS9.
    GenomeRNAii10170.
    PROiQ9BPW9.
    SOURCEiSearch...

    Gene expression databases

    BgeeiENSG00000073737.
    CleanExiHS_DHRS9.
    ExpressionAtlasiQ9BPW9. baseline and differential.
    GenevisibleiQ9BPW9. HS.

    Family and domain databases

    Gene3Di3.40.50.720. 1 hit.
    InterProiIPR016040. NAD(P)-bd_dom.
    IPR002347. SDR_fam.
    [Graphical view]
    PANTHERiPTHR24322. PTHR24322. 1 hit.
    PfamiPF00106. adh_short. 1 hit.
    [Graphical view]
    PRINTSiPR00081. GDHRDH.
    PR00080. SDRFAMILY.
    SUPFAMiSSF51735. SSF51735. 2 hits.
    ProtoNetiSearch...

    Entry informationi

    Entry nameiDHRS9_HUMAN
    AccessioniPrimary (citable) accession number: Q9BPW9
    Secondary accession number(s): B7Z416
    , D3DPC1, Q5RKX1, Q9NRA9, Q9NRB0
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: October 25, 2005
    Last sequence update: June 1, 2001
    Last modified: September 7, 2016
    This is version 135 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 2
      Human chromosome 2: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    Similar proteinsi

    Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
    100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
    90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
    50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.