Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9BMN8 (LAR_CAEEL) Reviewed, UniProtKB/Swiss-Prot

Last modified June 11, 2014. Version 109. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Tyrosine-protein phosphatase Lar-like

EC=3.1.3.48
Alternative name(s):
Protein-tyrosine phosphate 3
Gene names
Name:ptp-3
ORF Names:C09D8.1/C09D8.2
OrganismCaenorhabditis elegans [Reference proteome]
Taxonomic identifier6239 [NCBI]
Taxonomic lineageEukaryotaMetazoaEcdysozoaNematodaChromadoreaRhabditidaRhabditoideaRhabditidaePeloderinaeCaenorhabditis

Protein attributes

Sequence length2200 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Has a role in early neural and epidermal development; neuroblast movements during closure of the gastrulation cleft and epidermal morphogenesis. Vab-1 and ptp-3 may function redundantly within the same sets of neuronal precursors. Ref.1

Catalytic activity

Protein tyrosine phosphate + H2O = protein tyrosine + phosphate. UniProtKB P16621

Subcellular location

Cell junctionadherens junction. Cell membrane; Single-pass type I membrane protein.

Tissue specificity

Both isoforms are ubiquitously expressed in early embryos. In later embryos, larvae and adults expression is highest in the nerve ring, dorsal cord, ventral cord and epithelial tissues. Ref.1

Sequence similarities

Belongs to the protein-tyrosine phosphatase family. Receptor class 2A subfamily.

Contains 9 fibronectin type-III domains.

Contains 3 Ig-like C2-type (immunoglobulin-like) domains.

Contains 2 tyrosine-protein phosphatase domains.

Ontologies

Keywords
   Cellular componentCell junction
Cell membrane
Membrane
   Coding sequence diversityAlternative splicing
   DomainImmunoglobulin domain
Repeat
Signal
Transmembrane
Transmembrane helix
   Molecular functionHydrolase
Protein phosphatase
Receptor
   PTMDisulfide bond
Glycoprotein
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processembryonic body morphogenesis

Inferred from mutant phenotype Ref.1. Source: UniProtKB

epidermis development

Inferred from mutant phenotype Ref.1. Source: WormBase

gastrulation

Inferred from mutant phenotype Ref.1. Source: WormBase

motor neuron axon guidance

Inferred from mutant phenotype PubMed 16107639. Source: WormBase

nervous system development

Inferred from mutant phenotype Ref.1. Source: UniProtKB

peptidyl-tyrosine dephosphorylation

Inferred from sequence or structural similarity Ref.1. Source: GOC

protein dephosphorylation

Inferred from sequence or structural similarity. Source: UniProtKB

protein localization to synapse

Inferred from mutant phenotype PubMed 16107639. Source: WormBase

synapse assembly

Inferred from mutant phenotype PubMed 16107639. Source: WormBase

   Cellular_componentadherens junction

Inferred from mutant phenotype Ref.1. Source: UniProtKB

integral component of membrane

Inferred from electronic annotation. Source: UniProtKB-KW

plasma membrane

Inferred from electronic annotation. Source: UniProtKB-SubCell

synapse

Inferred from direct assay PubMed 16107639. Source: WormBase

   Molecular_functionprotein tyrosine phosphatase activity

Inferred from sequence or structural similarity. Source: UniProtKB

transmembrane receptor protein tyrosine phosphatase activity

Inferred from sequence or structural similarity Ref.1. Source: WormBase

Complete GO annotation...

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform a Ref.1 (identifier: Q9BMN8-1)

Also known as: ptp-3a;

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform b Ref.1 (identifier: Q9BMN8-2)

Also known as: ptp-3b;

The sequence of this isoform differs from the canonical sequence as follows:
     1-713: Missing.
     714-748: SDLLPYSSYEITVAASTMDGYGPESSIRVVKTLED → MGTPATTIAAINNNFRKFFILFLLLLAPTCRGQQK

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Signal peptide1 – 4242 Potential
Chain43 – 22002158Tyrosine-protein phosphatase Lar-like
PRO_0000025430

Regions

Topological domain43 – 14971455Extracellular Potential
Transmembrane1498 – 151821Helical; Potential
Topological domain1519 – 2200682Cytoplasmic Potential
Domain47 – 13993Ig-like C2-type 1
Domain151 – 24090Ig-like C2-type 2
Domain250 – 33485Ig-like C2-type 3
Domain341 – 43494Fibronectin type-III 1
Domain439 – 53597Fibronectin type-III 2
Domain539 – 62890Fibronectin type-III 3
Domain633 – 748116Fibronectin type-III 4
Domain752 – 856105Fibronectin type-III 5
Domain857 – 956100Fibronectin type-III 6
Domain957 – 105397Fibronectin type-III 7
Domain1058 – 1158101Fibronectin type-III 8
Domain1181 – 1287107Fibronectin type-III 9
Domain1647 – 1902256Tyrosine-protein phosphatase 1
Domain1933 – 2192260Tyrosine-protein phosphatase 2
Region1843 – 18497Substrate binding By similarity

Sites

Active site18431Phosphocysteine intermediate By similarity UniProtKB P16621
Active site21331Phosphocysteine intermediate By similarity UniProtKB P16621
Binding site18111Substrate By similarity
Binding site18871Substrate By similarity

Amino acid modifications

Glycosylation81N-linked (GlcNAc...) Potential
Glycosylation1161N-linked (GlcNAc...) Potential
Glycosylation2691N-linked (GlcNAc...) Potential
Glycosylation3151N-linked (GlcNAc...) Potential
Glycosylation5741N-linked (GlcNAc...) Ref.3
Glycosylation9451N-linked (GlcNAc...) Potential
Glycosylation9881N-linked (GlcNAc...) Potential
Glycosylation10691N-linked (GlcNAc...) Potential
Glycosylation11411N-linked (GlcNAc...) Potential
Glycosylation12121N-linked (GlcNAc...) Ref.3
Glycosylation13301N-linked (GlcNAc...) Potential
Disulfide bond69 ↔ 122 Potential UniProtKB P16621
Disulfide bond172 ↔ 225 Potential UniProtKB P16621
Disulfide bond272 ↔ 318 Potential UniProtKB P16621

Natural variations

Alternative sequence1 – 713713Missing in isoform b. Ref.1
VSP_007007
Alternative sequence714 – 74835SDLLP…KTLED → MGTPATTIAAINNNFRKFFI LFLLLLAPTCRGQQK in isoform b. Ref.1
VSP_007008

Sequences

Sequence LengthMass (Da)Tools
Isoform a (ptp-3a) [UniParc].

Last modified June 1, 2001. Version 1.
Checksum: 43A5D8133EC07E37

FASTA2,200246,620
        10         20         30         40         50         60 
MIQFRNKNNS MNRIARHLRN VARRKGSSLL LFLMLSTVLV AAKEDDPARL VVRPDSSTVV 

        70         80         90        100        110        120 
DESKISFFCR ADGNPLPSVI WRVNGKSITD HNRISIKSLA TGLSTLRFER VSLDDNATVV 

       130        140        150        160        170        180 
SCSADNGVAN PVVAEASLTV VPRDKVPIGF PQIELHPSLK SVEQGKTAYV SCRVRGDPRA 

       190        200        210        220        230        240 
KVLWLRDLIP LDIRADGRYS VSTIGNPGAL MIQHAREEDQ GKYECIARNT LGVAHSKAAN 

       250        260        270        280        290        300 
LYVKVRRVPP YFSYKLERQY VVGVGGNINL TCVAVGYPMP RVFWKKTDLM VLDDPSTAPI 

       310        320        330        340        350        360 
GKNVLTLTHV ESTENFTCVA VSALGNIEAT TTVIAKELPP PPVNIVVSSV TSESVVITWK 

       370        380        390        400        410        420 
PPKYNEAINK YVVNYRLKYS EGRSSRGKTM ETLENSLVID GLVAFQTYEF TVRSAGPVGV 

       430        440        450        460        470        480 
GLESLPVEAQ TKPSKPATAP VSPQARSLNR DSILVKWGPC EQPNGLITGY KVYYTNDLVT 

       490        500        510        520        530        540 
TPIREWKQHD AKSDEFMTTI NGLEPDSRYF VRVIAQNSEG DSPLSTLVTV ATRQGIPGQP 

       550        560        570        580        590        600 
PMLTVKALDS RRMQLTWDKP LYSSPVVGYT VRYNTSDGEK ELTLTSPHEK HVVTGLHPDK 

       610        620        630        640        650        660 
YYYFRVAAYS DRGQGEFTEP MISKTIASIP LSSPTIVSAA ATSSKSVEIR WKGPEQKKLN 

       670        680        690        700        710        720 
GVLTAYRINY FRLEDSKTAN LESVEYDEDM DDSSSFLDRM SVVVPSDATS YVLSDLLPYS 

       730        740        750        760        770        780 
SYEITVAAST MDGYGPESSI RVVKTLEDVP SAPRNFNAEL TSATSVKLTW DAPAAANGAL 

       790        800        810        820        830        840 
LGYYVYLDRM VNGEPVVEKG SKKRIVMIRD SSKRYFELDS LDPNTEYSFR LNAFNRNGDG 

       850        860        870        880        890        900 
EFSERKSIIT QGIPPEAPEI VSVSLDRDEP PVVARIEWKM PKMKPNETPI EKYNLWLRAQ 

       910        920        930        940        950        960 
GYPDSYVKAK TVDGTDLSTT ISGLWMGVVY DVLLAAENRE GRSQNATETI ATPVGSPDGE 

       970        980        990       1000       1010       1020 
PIDVQYEVMK GKIVVSWRPP SEEKRNGNIT SYKAILSAMD ATADRYEQPV PAPSTSSTFE 

      1030       1040       1050       1060       1070       1080 
VNVRRAYLFK VAAATMKGIG PYSPVLTINP DPAALVGPPT NVRVEATSNS TAVVQWDFES 

      1090       1100       1110       1120       1130       1140 
QKADSFVVKY MHEPGNRMDT EKWKQLPVVS IDKENPKRFA VVSDLNAHKP YAFCVLAVKN 

      1150       1160       1170       1180       1190       1200 
NLTLNEQFNK VRVTNYMTNF QRQGPCSDPP TVLESVTPTY MVQNLRVLWK TSNSVQLTWE 

      1210       1220       1230       1240       1250       1260 
YNGPRNVGFY VNHTGRKDYV NHELQEKTMS TPGFGQDVDE KHREYLWTNL RPHMMYTIHV 

      1270       1280       1290       1300       1310       1320 
GVRTLPPGAR KYWPQEVVTI TDPTGPPFVD VPKLVDSSGT QPGQQMIRLT PATEEYGPIS 

      1330       1340       1350       1360       1370       1380 
HYWIILVPAN YSTEDVVNLD PIELEKATAE KRAQLARSLS VSPSKKLKRK ASEVGDDSQS 

      1390       1400       1410       1420       1430       1440 
ASYHPKEKRA RRATVPGAYV TARLSADRVK QQYRNNQPFI VGDSQLYDGF TNYPLEHNLH 

      1450       1460       1470       1480       1490       1500 
YRLMMRAFAK NDVRTKDSFE QRAPMSEKLS RMYSDSVLTE PFTIKSALRG ASQKSSPWVG 

      1510       1520       1530       1540       1550       1560 
ACIAFLVLFS IVGMLICWWL RCNKKSAGRH PRHGSITKVA LTGNIMNGGG GIPGETSKLL 

      1570       1580       1590       1600       1610       1620 
STSNEYGRQI MNPYEQMNGN HHMESSMDLY PLPTSHSRSN GYAPVPVAIP SLPNNGNNMT 

      1630       1640       1650       1660       1670       1680 
TVSHPAVPIA ELANHIERLR MNNNAGFQSE FESIETGQHF TWEHSSADMN KHKNRYANVA 

      1690       1700       1710       1720       1730       1740 
AYDHSRVVLS NVEGYPGMDY INANYVDGYD KPRSYIATQG PLPETFSDFW RMVWEEQSVT 

      1750       1760       1770       1780       1790       1800 
IVMLTNLEER SRVKCDQYWP SRGTATYGDI EVTLLESVHL AHYTMRTMRL KMVGEPEVRE 

      1810       1820       1830       1840       1850       1860 
IKHLQYTAWP DHGVPDHPTP FLIFLKRVKT LNPNDAGPII SHCSAGIGRT GAFIVIDCML 

      1870       1880       1890       1900       1910       1920 
ERLRYDNTVD IYGCVTALRA QRSYMVQTEE QYIFIHDAVL DAVNSGSTEV PASRLHQHLH 

      1930       1940       1950       1960       1970       1980 
ILSQPSADQL SGIDMEFRHL TTLKWTSNRC TVANLPVNRP KNRMLSAVPY DSNRVIMRLL 

      1990       2000       2010       2020       2030       2040 
PGADGSDYIN ASWIDGYKER GAYIATQAPT NETAADFWRA IWEHNSPIIA MLVRTNERGQ 

      2050       2060       2070       2080       2090       2100 
EQCSDYWPLE TGVQVGMLVV EPMAEYDMKH YHLREFRISD INTREVRTVR QFHFMEWPDV 

      2110       2120       2130       2140       2150       2160 
GKPHTADHFL DFVTQVHNTY AQFGCTGPIT VHCCSGAGRT AVFIALSIIL DRMRAEHVVD 

      2170       2180       2190       2200 
VFTTVKLLRT ERQNMIQEPE QYHFLYLAAY EYLAAYDNFS 

« Hide

Isoform b (ptp-3b) [UniParc].

Checksum: 2FBE21B52B16F7D7
Show »

FASTA1,487167,959

References

« Hide 'large scale' references
[1]"The C. elegans LAR-like receptor tyrosine phosphatase PTP-3 and the VAB-1 Eph receptor tyrosine kinase have partly redundant functions in morphogenesis."
Harrington R.J., Gutch M.J., Hengartner M.O., Tonks N.K., Chisholm A.D.
Development 129:2141-2153(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS A AND B), FUNCTION, ALTERNATIVE SPLICING.
Strain: Bristol N2.
[2]"Genome sequence of the nematode C. elegans: a platform for investigating biology."
The C. elegans sequencing consortium
Science 282:2012-2018(1998) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Strain: Bristol N2.
[3]"Proteomics reveals N-linked glycoprotein diversity in Caenorhabditis elegans and suggests an atypical translocation mechanism for integral membrane proteins."
Kaji H., Kamiie J., Kawakami H., Kido K., Yamauchi Y., Shinkawa T., Taoka M., Takahashi N., Isobe T.
Mol. Cell. Proteomics 6:2100-2109(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-574 AND ASN-1212, IDENTIFICATION BY MASS SPECTROMETRY.
Strain: Bristol N2.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF316539 mRNA. Translation: AAK01632.1.
AF316540 mRNA. Translation: AAK01633.1.
Z46811, Z49938 Genomic DNA. Translation: CAA86842.3. Sequence problems.
Z49938, Z46811 Genomic DNA. Translation: CAA90189.3. Sequence problems.
Z49938, Z46811 Genomic DNA. Translation: CAD31752.1. Sequence problems.
Z46811, Z49938 Genomic DNA. Translation: CAD31753.1. Sequence problems.
PIRT19121.
RefSeqNP_001021942.1. NM_001026771.2.
NP_001021943.1. NM_001026772.3.
UniGeneCel.5177.

3D structure databases

ProteinModelPortalQ9BMN8.
SMRQ9BMN8. Positions 45-1043, 1623-2196.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid39995. 3 interactions.
MINTMINT-1041938.

Proteomic databases

PaxDbQ9BMN8.
PRIDEQ9BMN8.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

GeneID174685.
KEGGcel:CELE_C09D8.1.
UCSCC09D8.1d. c. elegans. [Q9BMN8-1]

Organism-specific databases

CTD174685.
WormBaseC09D8.1a; CE30244; WBGene00004215; ptp-3.
C09D8.1b; CE30245; WBGene00004215; ptp-3.

Phylogenomic databases

eggNOGCOG5599.
HOGENOMHOG000010250.
KOK05695.
PhylomeDBQ9BMN8.

Family and domain databases

Gene3D2.60.40.10. 11 hits.
3.90.190.10. 2 hits.
InterProIPR003961. Fibronectin_type3.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR013098. Ig_I-set.
IPR003599. Ig_sub.
IPR003598. Ig_sub2.
IPR029021. Prot-tyrosine_phosphatase-like.
IPR000387. Tyr/Dual-sp_Pase.
IPR016130. Tyr_Pase_AS.
IPR000242. Tyr_Pase_rcpt/non-rcpt.
[Graphical view]
PfamPF00041. fn3. 6 hits.
PF07679. I-set. 2 hits.
PF00102. Y_phosphatase. 2 hits.
[Graphical view]
PRINTSPR00700. PRTYPHPHTASE.
SMARTSM00060. FN3. 9 hits.
SM00409. IG. 2 hits.
SM00408. IGc2. 1 hit.
SM00194. PTPc. 2 hits.
[Graphical view]
SUPFAMSSF49265. SSF49265. 7 hits.
SSF52799. SSF52799. 2 hits.
PROSITEPS50853. FN3. 9 hits.
PS50835. IG_LIKE. 3 hits.
PS00383. TYR_PHOSPHATASE_1. 1 hit.
PS50056. TYR_PHOSPHATASE_2. 2 hits.
PS50055. TYR_PHOSPHATASE_PTP. 2 hits.
[Graphical view]
ProtoNetSearch...

Other

NextBio885058.
PROQ9BMN8.

Entry information

Entry nameLAR_CAEEL
AccessionPrimary (citable) accession number: Q9BMN8
Secondary accession number(s): Q09434 expand/collapse secondary AC list , Q17859, Q20137, Q9BMN7
Entry history
Integrated into UniProtKB/Swiss-Prot: March 28, 2003
Last sequence update: June 1, 2001
Last modified: June 11, 2014
This is version 109 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programCaenorhabditis annotation project

Relevant documents

SIMILARITY comments

Index of protein domains and families

Caenorhabditis elegans

Caenorhabditis elegans: entries, gene names and cross-references to WormBase