Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9BMN8

- LAR_CAEEL

UniProt

Q9BMN8 - LAR_CAEEL

Protein

Tyrosine-protein phosphatase Lar-like

Gene

ptp-3

Organism
Caenorhabditis elegans
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 110 (01 Oct 2014)
      Sequence version 1 (01 Jun 2001)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Has a role in early neural and epidermal development; neuroblast movements during closure of the gastrulation cleft and epidermal morphogenesis. Vab-1 and ptp-3 may function redundantly within the same sets of neuronal precursors.1 Publication

    Catalytic activityi

    Protein tyrosine phosphate + H2O = protein tyrosine + phosphate.By similarityPROSITE-ProRule annotation

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Binding sitei1811 – 18111SubstrateBy similarity
    Active sitei1843 – 18431Phosphocysteine intermediateBy similarity
    Binding sitei1887 – 18871SubstrateBy similarity
    Active sitei2133 – 21331Phosphocysteine intermediateBy similarity

    GO - Molecular functioni

    1. protein tyrosine phosphatase activity Source: UniProtKB
    2. transmembrane receptor protein tyrosine phosphatase activity Source: WormBase

    GO - Biological processi

    1. embryonic body morphogenesis Source: UniProtKB
    2. epidermis development Source: WormBase
    3. gastrulation Source: WormBase
    4. motor neuron axon guidance Source: WormBase
    5. nervous system development Source: UniProtKB
    6. peptidyl-tyrosine dephosphorylation Source: GOC
    7. protein dephosphorylation Source: UniProtKB
    8. protein localization to synapse Source: WormBase
    9. synapse assembly Source: WormBase

    Keywords - Molecular functioni

    Hydrolase, Protein phosphatase, Receptor

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Tyrosine-protein phosphatase Lar-like (EC:3.1.3.48)
    Alternative name(s):
    Protein-tyrosine phosphate 3
    Gene namesi
    Name:ptp-3
    ORF Names:C09D8.1/C09D8.2
    OrganismiCaenorhabditis elegansImported
    Taxonomic identifieri6239 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaEcdysozoaNematodaChromadoreaRhabditidaRhabditoideaRhabditidaePeloderinaeCaenorhabditis
    ProteomesiUP000001940: Chromosome II

    Organism-specific databases

    WormBaseiC09D8.1a; CE30244; WBGene00004215; ptp-3.
    C09D8.1b; CE30245; WBGene00004215; ptp-3.

    Subcellular locationi

    GO - Cellular componenti

    1. adherens junction Source: UniProtKB
    2. integral component of membrane Source: UniProtKB-KW
    3. plasma membrane Source: UniProtKB-SubCell
    4. synapse Source: WormBase

    Keywords - Cellular componenti

    Cell junction, Cell membrane, Membrane

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 4242Sequence AnalysisAdd
    BLAST
    Chaini43 – 22002158Tyrosine-protein phosphatase Lar-likePRO_0000025430Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi8 – 81N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi69 ↔ 122By similarityPROSITE-ProRule annotation
    Glycosylationi116 – 1161N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi172 ↔ 225By similarityPROSITE-ProRule annotation
    Glycosylationi269 – 2691N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi272 ↔ 318By similarityPROSITE-ProRule annotation
    Glycosylationi315 – 3151N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi574 – 5741N-linked (GlcNAc...)1 Publication
    Glycosylationi945 – 9451N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi988 – 9881N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi1069 – 10691N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi1141 – 11411N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi1212 – 12121N-linked (GlcNAc...)1 Publication
    Glycosylationi1330 – 13301N-linked (GlcNAc...)Sequence Analysis

    Keywords - PTMi

    Disulfide bond, Glycoprotein

    Proteomic databases

    PaxDbiQ9BMN8.
    PRIDEiQ9BMN8.

    Expressioni

    Tissue specificityi

    Both isoforms are ubiquitously expressed in early embryos. In later embryos, larvae and adults expression is highest in the nerve ring, dorsal cord, ventral cord and epithelial tissues.1 Publication

    Interactioni

    Protein-protein interaction databases

    BioGridi39995. 3 interactions.
    MINTiMINT-1041938.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9BMN8.
    SMRiQ9BMN8. Positions 45-1043, 1623-2196.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini43 – 14971455ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini1519 – 2200682CytoplasmicSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei1498 – 151821HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini47 – 13993Ig-like C2-type 1Add
    BLAST
    Domaini151 – 24090Ig-like C2-type 2Add
    BLAST
    Domaini250 – 33485Ig-like C2-type 3Add
    BLAST
    Domaini341 – 43494Fibronectin type-III 1PROSITE-ProRule annotationAdd
    BLAST
    Domaini439 – 53597Fibronectin type-III 2PROSITE-ProRule annotationAdd
    BLAST
    Domaini539 – 62890Fibronectin type-III 3PROSITE-ProRule annotationAdd
    BLAST
    Domaini633 – 748116Fibronectin type-III 4PROSITE-ProRule annotationAdd
    BLAST
    Domaini752 – 856105Fibronectin type-III 5PROSITE-ProRule annotationAdd
    BLAST
    Domaini857 – 956100Fibronectin type-III 6PROSITE-ProRule annotationAdd
    BLAST
    Domaini957 – 105397Fibronectin type-III 7PROSITE-ProRule annotationAdd
    BLAST
    Domaini1058 – 1158101Fibronectin type-III 8PROSITE-ProRule annotationAdd
    BLAST
    Domaini1181 – 1287107Fibronectin type-III 9PROSITE-ProRule annotationAdd
    BLAST
    Domaini1647 – 1902256Tyrosine-protein phosphatase 1PROSITE-ProRule annotationAdd
    BLAST
    Domaini1933 – 2192260Tyrosine-protein phosphatase 2PROSITE-ProRule annotationAdd
    BLAST

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni1843 – 18497Substrate bindingBy similarity

    Sequence similaritiesi

    Contains 9 fibronectin type-III domains.PROSITE-ProRule annotation
    Contains 2 tyrosine-protein phosphatase domains.PROSITE-ProRule annotation

    Keywords - Domaini

    Immunoglobulin domain, Repeat, Signal, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiCOG5599.
    HOGENOMiHOG000010250.
    KOiK05695.
    PhylomeDBiQ9BMN8.

    Family and domain databases

    Gene3Di2.60.40.10. 11 hits.
    3.90.190.10. 2 hits.
    InterProiIPR003961. Fibronectin_type3.
    IPR007110. Ig-like_dom.
    IPR013783. Ig-like_fold.
    IPR013098. Ig_I-set.
    IPR003599. Ig_sub.
    IPR003598. Ig_sub2.
    IPR029021. Prot-tyrosine_phosphatase-like.
    IPR000387. Tyr/Dual-sp_Pase.
    IPR016130. Tyr_Pase_AS.
    IPR000242. Tyr_Pase_rcpt/non-rcpt.
    [Graphical view]
    PfamiPF00041. fn3. 6 hits.
    PF07679. I-set. 2 hits.
    PF00102. Y_phosphatase. 2 hits.
    [Graphical view]
    PRINTSiPR00700. PRTYPHPHTASE.
    SMARTiSM00060. FN3. 9 hits.
    SM00409. IG. 2 hits.
    SM00408. IGc2. 1 hit.
    SM00194. PTPc. 2 hits.
    [Graphical view]
    SUPFAMiSSF49265. SSF49265. 7 hits.
    SSF52799. SSF52799. 2 hits.
    PROSITEiPS50853. FN3. 9 hits.
    PS50835. IG_LIKE. 3 hits.
    PS00383. TYR_PHOSPHATASE_1. 1 hit.
    PS50056. TYR_PHOSPHATASE_2. 2 hits.
    PS50055. TYR_PHOSPHATASE_PTP. 2 hits.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform a1 Publication (identifier: Q9BMN8-1) [UniParc]FASTAAdd to Basket

    Also known as: ptp-3a

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MIQFRNKNNS MNRIARHLRN VARRKGSSLL LFLMLSTVLV AAKEDDPARL     50
    VVRPDSSTVV DESKISFFCR ADGNPLPSVI WRVNGKSITD HNRISIKSLA 100
    TGLSTLRFER VSLDDNATVV SCSADNGVAN PVVAEASLTV VPRDKVPIGF 150
    PQIELHPSLK SVEQGKTAYV SCRVRGDPRA KVLWLRDLIP LDIRADGRYS 200
    VSTIGNPGAL MIQHAREEDQ GKYECIARNT LGVAHSKAAN LYVKVRRVPP 250
    YFSYKLERQY VVGVGGNINL TCVAVGYPMP RVFWKKTDLM VLDDPSTAPI 300
    GKNVLTLTHV ESTENFTCVA VSALGNIEAT TTVIAKELPP PPVNIVVSSV 350
    TSESVVITWK PPKYNEAINK YVVNYRLKYS EGRSSRGKTM ETLENSLVID 400
    GLVAFQTYEF TVRSAGPVGV GLESLPVEAQ TKPSKPATAP VSPQARSLNR 450
    DSILVKWGPC EQPNGLITGY KVYYTNDLVT TPIREWKQHD AKSDEFMTTI 500
    NGLEPDSRYF VRVIAQNSEG DSPLSTLVTV ATRQGIPGQP PMLTVKALDS 550
    RRMQLTWDKP LYSSPVVGYT VRYNTSDGEK ELTLTSPHEK HVVTGLHPDK 600
    YYYFRVAAYS DRGQGEFTEP MISKTIASIP LSSPTIVSAA ATSSKSVEIR 650
    WKGPEQKKLN GVLTAYRINY FRLEDSKTAN LESVEYDEDM DDSSSFLDRM 700
    SVVVPSDATS YVLSDLLPYS SYEITVAAST MDGYGPESSI RVVKTLEDVP 750
    SAPRNFNAEL TSATSVKLTW DAPAAANGAL LGYYVYLDRM VNGEPVVEKG 800
    SKKRIVMIRD SSKRYFELDS LDPNTEYSFR LNAFNRNGDG EFSERKSIIT 850
    QGIPPEAPEI VSVSLDRDEP PVVARIEWKM PKMKPNETPI EKYNLWLRAQ 900
    GYPDSYVKAK TVDGTDLSTT ISGLWMGVVY DVLLAAENRE GRSQNATETI 950
    ATPVGSPDGE PIDVQYEVMK GKIVVSWRPP SEEKRNGNIT SYKAILSAMD 1000
    ATADRYEQPV PAPSTSSTFE VNVRRAYLFK VAAATMKGIG PYSPVLTINP 1050
    DPAALVGPPT NVRVEATSNS TAVVQWDFES QKADSFVVKY MHEPGNRMDT 1100
    EKWKQLPVVS IDKENPKRFA VVSDLNAHKP YAFCVLAVKN NLTLNEQFNK 1150
    VRVTNYMTNF QRQGPCSDPP TVLESVTPTY MVQNLRVLWK TSNSVQLTWE 1200
    YNGPRNVGFY VNHTGRKDYV NHELQEKTMS TPGFGQDVDE KHREYLWTNL 1250
    RPHMMYTIHV GVRTLPPGAR KYWPQEVVTI TDPTGPPFVD VPKLVDSSGT 1300
    QPGQQMIRLT PATEEYGPIS HYWIILVPAN YSTEDVVNLD PIELEKATAE 1350
    KRAQLARSLS VSPSKKLKRK ASEVGDDSQS ASYHPKEKRA RRATVPGAYV 1400
    TARLSADRVK QQYRNNQPFI VGDSQLYDGF TNYPLEHNLH YRLMMRAFAK 1450
    NDVRTKDSFE QRAPMSEKLS RMYSDSVLTE PFTIKSALRG ASQKSSPWVG 1500
    ACIAFLVLFS IVGMLICWWL RCNKKSAGRH PRHGSITKVA LTGNIMNGGG 1550
    GIPGETSKLL STSNEYGRQI MNPYEQMNGN HHMESSMDLY PLPTSHSRSN 1600
    GYAPVPVAIP SLPNNGNNMT TVSHPAVPIA ELANHIERLR MNNNAGFQSE 1650
    FESIETGQHF TWEHSSADMN KHKNRYANVA AYDHSRVVLS NVEGYPGMDY 1700
    INANYVDGYD KPRSYIATQG PLPETFSDFW RMVWEEQSVT IVMLTNLEER 1750
    SRVKCDQYWP SRGTATYGDI EVTLLESVHL AHYTMRTMRL KMVGEPEVRE 1800
    IKHLQYTAWP DHGVPDHPTP FLIFLKRVKT LNPNDAGPII SHCSAGIGRT 1850
    GAFIVIDCML ERLRYDNTVD IYGCVTALRA QRSYMVQTEE QYIFIHDAVL 1900
    DAVNSGSTEV PASRLHQHLH ILSQPSADQL SGIDMEFRHL TTLKWTSNRC 1950
    TVANLPVNRP KNRMLSAVPY DSNRVIMRLL PGADGSDYIN ASWIDGYKER 2000
    GAYIATQAPT NETAADFWRA IWEHNSPIIA MLVRTNERGQ EQCSDYWPLE 2050
    TGVQVGMLVV EPMAEYDMKH YHLREFRISD INTREVRTVR QFHFMEWPDV 2100
    GKPHTADHFL DFVTQVHNTY AQFGCTGPIT VHCCSGAGRT AVFIALSIIL 2150
    DRMRAEHVVD VFTTVKLLRT ERQNMIQEPE QYHFLYLAAY EYLAAYDNFS 2200
    Length:2,200
    Mass (Da):246,620
    Last modified:June 1, 2001 - v1
    Checksum:i43A5D8133EC07E37
    GO
    Isoform b1 Publication (identifier: Q9BMN8-2) [UniParc]FASTAAdd to Basket

    Also known as: ptp-3b

    The sequence of this isoform differs from the canonical sequence as follows:
         1-713: Missing.
         714-748: SDLLPYSSYEITVAASTMDGYGPESSIRVVKTLED → MGTPATTIAAINNNFRKFFILFLLLLAPTCRGQQK

    Show »
    Length:1,487
    Mass (Da):167,959
    Checksum:i2FBE21B52B16F7D7
    GO

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 713713Missing in isoform b. 1 PublicationVSP_007007Add
    BLAST
    Alternative sequencei714 – 74835SDLLP…KTLED → MGTPATTIAAINNNFRKFFI LFLLLLAPTCRGQQK in isoform b. 1 PublicationVSP_007008Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF316539 mRNA. Translation: AAK01632.1.
    AF316540 mRNA. Translation: AAK01633.1.
    Z46811, Z49938 Genomic DNA. Translation: CAA86842.3. Sequence problems.
    Z49938, Z46811 Genomic DNA. Translation: CAA90189.3. Sequence problems.
    Z49938, Z46811 Genomic DNA. Translation: CAD31752.1. Sequence problems.
    Z46811, Z49938 Genomic DNA. Translation: CAD31753.1. Sequence problems.
    PIRiT19121.
    RefSeqiNP_001021942.1. NM_001026771.2.
    NP_001021943.1. NM_001026772.3.
    UniGeneiCel.5177.

    Genome annotation databases

    GeneIDi174685.
    KEGGicel:CELE_C09D8.1.
    UCSCiC09D8.1d. c. elegans. [Q9BMN8-1]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF316539 mRNA. Translation: AAK01632.1 .
    AF316540 mRNA. Translation: AAK01633.1 .
    Z46811 , Z49938 Genomic DNA. Translation: CAA86842.3 . Sequence problems.
    Z49938 , Z46811 Genomic DNA. Translation: CAA90189.3 . Sequence problems.
    Z49938 , Z46811 Genomic DNA. Translation: CAD31752.1 . Sequence problems.
    Z46811 , Z49938 Genomic DNA. Translation: CAD31753.1 . Sequence problems.
    PIRi T19121.
    RefSeqi NP_001021942.1. NM_001026771.2.
    NP_001021943.1. NM_001026772.3.
    UniGenei Cel.5177.

    3D structure databases

    ProteinModelPortali Q9BMN8.
    SMRi Q9BMN8. Positions 45-1043, 1623-2196.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 39995. 3 interactions.
    MINTi MINT-1041938.

    Proteomic databases

    PaxDbi Q9BMN8.
    PRIDEi Q9BMN8.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    GeneIDi 174685.
    KEGGi cel:CELE_C09D8.1.
    UCSCi C09D8.1d. c. elegans. [Q9BMN8-1 ]

    Organism-specific databases

    CTDi 174685.
    WormBasei C09D8.1a ; CE30244 ; WBGene00004215 ; ptp-3.
    C09D8.1b ; CE30245 ; WBGene00004215 ; ptp-3.

    Phylogenomic databases

    eggNOGi COG5599.
    HOGENOMi HOG000010250.
    KOi K05695.
    PhylomeDBi Q9BMN8.

    Miscellaneous databases

    NextBioi 885058.
    PROi Q9BMN8.

    Family and domain databases

    Gene3Di 2.60.40.10. 11 hits.
    3.90.190.10. 2 hits.
    InterProi IPR003961. Fibronectin_type3.
    IPR007110. Ig-like_dom.
    IPR013783. Ig-like_fold.
    IPR013098. Ig_I-set.
    IPR003599. Ig_sub.
    IPR003598. Ig_sub2.
    IPR029021. Prot-tyrosine_phosphatase-like.
    IPR000387. Tyr/Dual-sp_Pase.
    IPR016130. Tyr_Pase_AS.
    IPR000242. Tyr_Pase_rcpt/non-rcpt.
    [Graphical view ]
    Pfami PF00041. fn3. 6 hits.
    PF07679. I-set. 2 hits.
    PF00102. Y_phosphatase. 2 hits.
    [Graphical view ]
    PRINTSi PR00700. PRTYPHPHTASE.
    SMARTi SM00060. FN3. 9 hits.
    SM00409. IG. 2 hits.
    SM00408. IGc2. 1 hit.
    SM00194. PTPc. 2 hits.
    [Graphical view ]
    SUPFAMi SSF49265. SSF49265. 7 hits.
    SSF52799. SSF52799. 2 hits.
    PROSITEi PS50853. FN3. 9 hits.
    PS50835. IG_LIKE. 3 hits.
    PS00383. TYR_PHOSPHATASE_1. 1 hit.
    PS50056. TYR_PHOSPHATASE_2. 2 hits.
    PS50055. TYR_PHOSPHATASE_PTP. 2 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "The C. elegans LAR-like receptor tyrosine phosphatase PTP-3 and the VAB-1 Eph receptor tyrosine kinase have partly redundant functions in morphogenesis."
      Harrington R.J., Gutch M.J., Hengartner M.O., Tonks N.K., Chisholm A.D.
      Development 129:2141-2153(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS A AND B), FUNCTION, ALTERNATIVE SPLICING.
      Strain: Bristol N2.
    2. "Genome sequence of the nematode C. elegans: a platform for investigating biology."
      The C. elegans sequencing consortium
      Science 282:2012-2018(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
      Strain: Bristol N2.
    3. "Proteomics reveals N-linked glycoprotein diversity in Caenorhabditis elegans and suggests an atypical translocation mechanism for integral membrane proteins."
      Kaji H., Kamiie J., Kawakami H., Kido K., Yamauchi Y., Shinkawa T., Taoka M., Takahashi N., Isobe T.
      Mol. Cell. Proteomics 6:2100-2109(2007) [PubMed] [Europe PMC] [Abstract]
      Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-574 AND ASN-1212, IDENTIFICATION BY MASS SPECTROMETRY.
      Strain: Bristol N2.

    Entry informationi

    Entry nameiLAR_CAEEL
    AccessioniPrimary (citable) accession number: Q9BMN8
    Secondary accession number(s): Q09434
    , Q17859, Q20137, Q9BMN7
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: March 28, 2003
    Last sequence update: June 1, 2001
    Last modified: October 1, 2014
    This is version 110 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programCaenorhabditis annotation project

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Caenorhabditis elegans
      Caenorhabditis elegans: entries, gene names and cross-references to WormBase
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3