SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9BMN8

- LAR_CAEEL

UniProt

Q9BMN8 - LAR_CAEEL

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Tyrosine-protein phosphatase Lar-like

Gene
ptp-3, C09D8.1/C09D8.2
Organism
Caenorhabditis elegans
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Has a role in early neural and epidermal development; neuroblast movements during closure of the gastrulation cleft and epidermal morphogenesis. Vab-1 and ptp-3 may function redundantly within the same sets of neuronal precursors.1 Publication

Catalytic activityi

Protein tyrosine phosphate + H2O = protein tyrosine + phosphate.By similarity

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Binding sitei1811 – 18111Substrate By similarity
Active sitei1843 – 18431Phosphocysteine intermediate By similarityBy similarity
Binding sitei1887 – 18871Substrate By similarity
Active sitei2133 – 21331Phosphocysteine intermediate By similarityBy similarity

GO - Molecular functioni

  1. protein tyrosine phosphatase activity Source: UniProtKB
  2. transmembrane receptor protein tyrosine phosphatase activity Source: WormBase

GO - Biological processi

  1. embryonic body morphogenesis Source: UniProtKB
  2. epidermis development Source: WormBase
  3. gastrulation Source: WormBase
  4. motor neuron axon guidance Source: WormBase
  5. nervous system development Source: UniProtKB
  6. peptidyl-tyrosine dephosphorylation Source: GOC
  7. protein dephosphorylation Source: UniProtKB
  8. protein localization to synapse Source: WormBase
  9. synapse assembly Source: WormBase
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase, Protein phosphatase, Receptor

Names & Taxonomyi

Protein namesi
Recommended name:
Tyrosine-protein phosphatase Lar-like (EC:3.1.3.48)
Alternative name(s):
Protein-tyrosine phosphate 3
Gene namesi
Name:ptp-3
ORF Names:C09D8.1/C09D8.2
OrganismiCaenorhabditis elegans
Taxonomic identifieri6239 [NCBI]
Taxonomic lineageiEukaryotaMetazoaEcdysozoaNematodaChromadoreaRhabditidaRhabditoideaRhabditidaePeloderinaeCaenorhabditis
ProteomesiUP000001940: Chromosome II

Organism-specific databases

WormBaseiC09D8.1a; CE30244; WBGene00004215; ptp-3.
C09D8.1b; CE30245; WBGene00004215; ptp-3.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini43 – 14971455Extracellular Reviewed predictionAdd
BLAST
Transmembranei1498 – 151821Helical; Reviewed predictionAdd
BLAST
Topological domaini1519 – 2200682Cytoplasmic Reviewed predictionAdd
BLAST

GO - Cellular componenti

  1. adherens junction Source: UniProtKB
  2. integral component of membrane Source: UniProtKB-KW
  3. plasma membrane Source: UniProtKB-SubCell
  4. synapse Source: WormBase
Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Cell membrane, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 4242 Reviewed predictionAdd
BLAST
Chaini43 – 22002158Tyrosine-protein phosphatase Lar-likePRO_0000025430Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi8 – 81N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi69 ↔ 122 Reviewed predictionBy similarity
Glycosylationi116 – 1161N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi172 ↔ 225 Reviewed predictionBy similarity
Glycosylationi269 – 2691N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi272 ↔ 318 Reviewed predictionBy similarity
Glycosylationi315 – 3151N-linked (GlcNAc...) Reviewed prediction
Glycosylationi574 – 5741N-linked (GlcNAc...)1 Publication
Glycosylationi945 – 9451N-linked (GlcNAc...) Reviewed prediction
Glycosylationi988 – 9881N-linked (GlcNAc...) Reviewed prediction
Glycosylationi1069 – 10691N-linked (GlcNAc...) Reviewed prediction
Glycosylationi1141 – 11411N-linked (GlcNAc...) Reviewed prediction
Glycosylationi1212 – 12121N-linked (GlcNAc...)1 Publication
Glycosylationi1330 – 13301N-linked (GlcNAc...) Reviewed prediction

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiQ9BMN8.
PRIDEiQ9BMN8.

Expressioni

Tissue specificityi

Both isoforms are ubiquitously expressed in early embryos. In later embryos, larvae and adults expression is highest in the nerve ring, dorsal cord, ventral cord and epithelial tissues.1 Publication

Interactioni

Protein-protein interaction databases

BioGridi39995. 3 interactions.
MINTiMINT-1041938.

Structurei

3D structure databases

ProteinModelPortaliQ9BMN8.
SMRiQ9BMN8. Positions 45-1043, 1623-2196.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini47 – 13993Ig-like C2-type 1Add
BLAST
Domaini151 – 24090Ig-like C2-type 2Add
BLAST
Domaini250 – 33485Ig-like C2-type 3Add
BLAST
Domaini341 – 43494Fibronectin type-III 1Add
BLAST
Domaini439 – 53597Fibronectin type-III 2Add
BLAST
Domaini539 – 62890Fibronectin type-III 3Add
BLAST
Domaini633 – 748116Fibronectin type-III 4Add
BLAST
Domaini752 – 856105Fibronectin type-III 5Add
BLAST
Domaini857 – 956100Fibronectin type-III 6Add
BLAST
Domaini957 – 105397Fibronectin type-III 7Add
BLAST
Domaini1058 – 1158101Fibronectin type-III 8Add
BLAST
Domaini1181 – 1287107Fibronectin type-III 9Add
BLAST
Domaini1647 – 1902256Tyrosine-protein phosphatase 1Add
BLAST
Domaini1933 – 2192260Tyrosine-protein phosphatase 2Add
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni1843 – 18497Substrate binding By similarity

Sequence similaritiesi

Keywords - Domaini

Immunoglobulin domain, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiCOG5599.
HOGENOMiHOG000010250.
KOiK05695.
PhylomeDBiQ9BMN8.

Family and domain databases

Gene3Di2.60.40.10. 11 hits.
3.90.190.10. 2 hits.
InterProiIPR003961. Fibronectin_type3.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR013098. Ig_I-set.
IPR003599. Ig_sub.
IPR003598. Ig_sub2.
IPR029021. Prot-tyrosine_phosphatase-like.
IPR000387. Tyr/Dual-sp_Pase.
IPR016130. Tyr_Pase_AS.
IPR000242. Tyr_Pase_rcpt/non-rcpt.
[Graphical view]
PfamiPF00041. fn3. 6 hits.
PF07679. I-set. 2 hits.
PF00102. Y_phosphatase. 2 hits.
[Graphical view]
PRINTSiPR00700. PRTYPHPHTASE.
SMARTiSM00060. FN3. 9 hits.
SM00409. IG. 2 hits.
SM00408. IGc2. 1 hit.
SM00194. PTPc. 2 hits.
[Graphical view]
SUPFAMiSSF49265. SSF49265. 7 hits.
SSF52799. SSF52799. 2 hits.
PROSITEiPS50853. FN3. 9 hits.
PS50835. IG_LIKE. 3 hits.
PS00383. TYR_PHOSPHATASE_1. 1 hit.
PS50056. TYR_PHOSPHATASE_2. 2 hits.
PS50055. TYR_PHOSPHATASE_PTP. 2 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform a1 Publication (identifier: Q9BMN8-1) [UniParc]FASTAAdd to Basket

Also known as: ptp-3a

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MIQFRNKNNS MNRIARHLRN VARRKGSSLL LFLMLSTVLV AAKEDDPARL     50
VVRPDSSTVV DESKISFFCR ADGNPLPSVI WRVNGKSITD HNRISIKSLA 100
TGLSTLRFER VSLDDNATVV SCSADNGVAN PVVAEASLTV VPRDKVPIGF 150
PQIELHPSLK SVEQGKTAYV SCRVRGDPRA KVLWLRDLIP LDIRADGRYS 200
VSTIGNPGAL MIQHAREEDQ GKYECIARNT LGVAHSKAAN LYVKVRRVPP 250
YFSYKLERQY VVGVGGNINL TCVAVGYPMP RVFWKKTDLM VLDDPSTAPI 300
GKNVLTLTHV ESTENFTCVA VSALGNIEAT TTVIAKELPP PPVNIVVSSV 350
TSESVVITWK PPKYNEAINK YVVNYRLKYS EGRSSRGKTM ETLENSLVID 400
GLVAFQTYEF TVRSAGPVGV GLESLPVEAQ TKPSKPATAP VSPQARSLNR 450
DSILVKWGPC EQPNGLITGY KVYYTNDLVT TPIREWKQHD AKSDEFMTTI 500
NGLEPDSRYF VRVIAQNSEG DSPLSTLVTV ATRQGIPGQP PMLTVKALDS 550
RRMQLTWDKP LYSSPVVGYT VRYNTSDGEK ELTLTSPHEK HVVTGLHPDK 600
YYYFRVAAYS DRGQGEFTEP MISKTIASIP LSSPTIVSAA ATSSKSVEIR 650
WKGPEQKKLN GVLTAYRINY FRLEDSKTAN LESVEYDEDM DDSSSFLDRM 700
SVVVPSDATS YVLSDLLPYS SYEITVAAST MDGYGPESSI RVVKTLEDVP 750
SAPRNFNAEL TSATSVKLTW DAPAAANGAL LGYYVYLDRM VNGEPVVEKG 800
SKKRIVMIRD SSKRYFELDS LDPNTEYSFR LNAFNRNGDG EFSERKSIIT 850
QGIPPEAPEI VSVSLDRDEP PVVARIEWKM PKMKPNETPI EKYNLWLRAQ 900
GYPDSYVKAK TVDGTDLSTT ISGLWMGVVY DVLLAAENRE GRSQNATETI 950
ATPVGSPDGE PIDVQYEVMK GKIVVSWRPP SEEKRNGNIT SYKAILSAMD 1000
ATADRYEQPV PAPSTSSTFE VNVRRAYLFK VAAATMKGIG PYSPVLTINP 1050
DPAALVGPPT NVRVEATSNS TAVVQWDFES QKADSFVVKY MHEPGNRMDT 1100
EKWKQLPVVS IDKENPKRFA VVSDLNAHKP YAFCVLAVKN NLTLNEQFNK 1150
VRVTNYMTNF QRQGPCSDPP TVLESVTPTY MVQNLRVLWK TSNSVQLTWE 1200
YNGPRNVGFY VNHTGRKDYV NHELQEKTMS TPGFGQDVDE KHREYLWTNL 1250
RPHMMYTIHV GVRTLPPGAR KYWPQEVVTI TDPTGPPFVD VPKLVDSSGT 1300
QPGQQMIRLT PATEEYGPIS HYWIILVPAN YSTEDVVNLD PIELEKATAE 1350
KRAQLARSLS VSPSKKLKRK ASEVGDDSQS ASYHPKEKRA RRATVPGAYV 1400
TARLSADRVK QQYRNNQPFI VGDSQLYDGF TNYPLEHNLH YRLMMRAFAK 1450
NDVRTKDSFE QRAPMSEKLS RMYSDSVLTE PFTIKSALRG ASQKSSPWVG 1500
ACIAFLVLFS IVGMLICWWL RCNKKSAGRH PRHGSITKVA LTGNIMNGGG 1550
GIPGETSKLL STSNEYGRQI MNPYEQMNGN HHMESSMDLY PLPTSHSRSN 1600
GYAPVPVAIP SLPNNGNNMT TVSHPAVPIA ELANHIERLR MNNNAGFQSE 1650
FESIETGQHF TWEHSSADMN KHKNRYANVA AYDHSRVVLS NVEGYPGMDY 1700
INANYVDGYD KPRSYIATQG PLPETFSDFW RMVWEEQSVT IVMLTNLEER 1750
SRVKCDQYWP SRGTATYGDI EVTLLESVHL AHYTMRTMRL KMVGEPEVRE 1800
IKHLQYTAWP DHGVPDHPTP FLIFLKRVKT LNPNDAGPII SHCSAGIGRT 1850
GAFIVIDCML ERLRYDNTVD IYGCVTALRA QRSYMVQTEE QYIFIHDAVL 1900
DAVNSGSTEV PASRLHQHLH ILSQPSADQL SGIDMEFRHL TTLKWTSNRC 1950
TVANLPVNRP KNRMLSAVPY DSNRVIMRLL PGADGSDYIN ASWIDGYKER 2000
GAYIATQAPT NETAADFWRA IWEHNSPIIA MLVRTNERGQ EQCSDYWPLE 2050
TGVQVGMLVV EPMAEYDMKH YHLREFRISD INTREVRTVR QFHFMEWPDV 2100
GKPHTADHFL DFVTQVHNTY AQFGCTGPIT VHCCSGAGRT AVFIALSIIL 2150
DRMRAEHVVD VFTTVKLLRT ERQNMIQEPE QYHFLYLAAY EYLAAYDNFS 2200
Length:2,200
Mass (Da):246,620
Last modified:June 1, 2001 - v1
Checksum:i43A5D8133EC07E37
GO
Isoform b1 Publication (identifier: Q9BMN8-2) [UniParc]FASTAAdd to Basket

Also known as: ptp-3b

The sequence of this isoform differs from the canonical sequence as follows:
     1-713: Missing.
     714-748: SDLLPYSSYEITVAASTMDGYGPESSIRVVKTLED → MGTPATTIAAINNNFRKFFILFLLLLAPTCRGQQK

Show »
Length:1,487
Mass (Da):167,959
Checksum:i2FBE21B52B16F7D7
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 713713Missing in isoform b. 1 PublicationVSP_007007Add
BLAST
Alternative sequencei714 – 74835SDLLP…KTLED → MGTPATTIAAINNNFRKFFI LFLLLLAPTCRGQQK in isoform b. 1 PublicationVSP_007008Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF316539 mRNA. Translation: AAK01632.1.
AF316540 mRNA. Translation: AAK01633.1.
Z46811, Z49938 Genomic DNA. Translation: CAA86842.3. Sequence problems.
Z49938, Z46811 Genomic DNA. Translation: CAA90189.3. Sequence problems.
Z49938, Z46811 Genomic DNA. Translation: CAD31752.1. Sequence problems.
Z46811, Z49938 Genomic DNA. Translation: CAD31753.1. Sequence problems.
PIRiT19121.
RefSeqiNP_001021942.1. NM_001026771.2.
NP_001021943.1. NM_001026772.3.
UniGeneiCel.5177.

Genome annotation databases

GeneIDi174685.
KEGGicel:CELE_C09D8.1.
UCSCiC09D8.1d. c. elegans. [Q9BMN8-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF316539 mRNA. Translation: AAK01632.1 .
AF316540 mRNA. Translation: AAK01633.1 .
Z46811 , Z49938 Genomic DNA. Translation: CAA86842.3 . Sequence problems.
Z49938 , Z46811 Genomic DNA. Translation: CAA90189.3 . Sequence problems.
Z49938 , Z46811 Genomic DNA. Translation: CAD31752.1 . Sequence problems.
Z46811 , Z49938 Genomic DNA. Translation: CAD31753.1 . Sequence problems.
PIRi T19121.
RefSeqi NP_001021942.1. NM_001026771.2.
NP_001021943.1. NM_001026772.3.
UniGenei Cel.5177.

3D structure databases

ProteinModelPortali Q9BMN8.
SMRi Q9BMN8. Positions 45-1043, 1623-2196.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 39995. 3 interactions.
MINTi MINT-1041938.

Proteomic databases

PaxDbi Q9BMN8.
PRIDEi Q9BMN8.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

GeneIDi 174685.
KEGGi cel:CELE_C09D8.1.
UCSCi C09D8.1d. c. elegans. [Q9BMN8-1 ]

Organism-specific databases

CTDi 174685.
WormBasei C09D8.1a ; CE30244 ; WBGene00004215 ; ptp-3.
C09D8.1b ; CE30245 ; WBGene00004215 ; ptp-3.

Phylogenomic databases

eggNOGi COG5599.
HOGENOMi HOG000010250.
KOi K05695.
PhylomeDBi Q9BMN8.

Miscellaneous databases

NextBioi 885058.
PROi Q9BMN8.

Family and domain databases

Gene3Di 2.60.40.10. 11 hits.
3.90.190.10. 2 hits.
InterProi IPR003961. Fibronectin_type3.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR013098. Ig_I-set.
IPR003599. Ig_sub.
IPR003598. Ig_sub2.
IPR029021. Prot-tyrosine_phosphatase-like.
IPR000387. Tyr/Dual-sp_Pase.
IPR016130. Tyr_Pase_AS.
IPR000242. Tyr_Pase_rcpt/non-rcpt.
[Graphical view ]
Pfami PF00041. fn3. 6 hits.
PF07679. I-set. 2 hits.
PF00102. Y_phosphatase. 2 hits.
[Graphical view ]
PRINTSi PR00700. PRTYPHPHTASE.
SMARTi SM00060. FN3. 9 hits.
SM00409. IG. 2 hits.
SM00408. IGc2. 1 hit.
SM00194. PTPc. 2 hits.
[Graphical view ]
SUPFAMi SSF49265. SSF49265. 7 hits.
SSF52799. SSF52799. 2 hits.
PROSITEi PS50853. FN3. 9 hits.
PS50835. IG_LIKE. 3 hits.
PS00383. TYR_PHOSPHATASE_1. 1 hit.
PS50056. TYR_PHOSPHATASE_2. 2 hits.
PS50055. TYR_PHOSPHATASE_PTP. 2 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "The C. elegans LAR-like receptor tyrosine phosphatase PTP-3 and the VAB-1 Eph receptor tyrosine kinase have partly redundant functions in morphogenesis."
    Harrington R.J., Gutch M.J., Hengartner M.O., Tonks N.K., Chisholm A.D.
    Development 129:2141-2153(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS A AND B), FUNCTION, ALTERNATIVE SPLICING.
    Strain: Bristol N2.
  2. "Genome sequence of the nematode C. elegans: a platform for investigating biology."
    The C. elegans sequencing consortium
    Science 282:2012-2018(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: Bristol N2.
  3. "Proteomics reveals N-linked glycoprotein diversity in Caenorhabditis elegans and suggests an atypical translocation mechanism for integral membrane proteins."
    Kaji H., Kamiie J., Kawakami H., Kido K., Yamauchi Y., Shinkawa T., Taoka M., Takahashi N., Isobe T.
    Mol. Cell. Proteomics 6:2100-2109(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-574 AND ASN-1212, IDENTIFICATION BY MASS SPECTROMETRY.
    Strain: Bristol N2.

Entry informationi

Entry nameiLAR_CAEEL
AccessioniPrimary (citable) accession number: Q9BMN8
Secondary accession number(s): Q09434
, Q17859, Q20137, Q9BMN7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 28, 2003
Last sequence update: June 1, 2001
Last modified: June 11, 2014
This is version 109 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programCaenorhabditis annotation project

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Caenorhabditis elegans
    Caenorhabditis elegans: entries, gene names and cross-references to WormBase
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi