Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Tyrosine-protein phosphatase Lar-like

Gene

ptp-3

Organism
Caenorhabditis elegans
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Has a role in early neural and epidermal development; neuroblast movements during closure of the gastrulation cleft and epidermal morphogenesis. Vab-1 and ptp-3 may function redundantly within the same sets of neuronal precursors.1 Publication

Catalytic activityi

Protein tyrosine phosphate + H2O = protein tyrosine + phosphate.PROSITE-ProRule annotationBy similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei1811SubstrateBy similarity1
Active sitei1843Phosphocysteine intermediateBy similarity1
Binding sitei1887SubstrateBy similarity1
Active sitei2133Phosphocysteine intermediateBy similarity1

GO - Molecular functioni

GO - Biological processi

  • embryonic body morphogenesis Source: UniProtKB
  • epidermis development Source: WormBase
  • gastrulation Source: WormBase
  • motor neuron axon guidance Source: WormBase
  • nervous system development Source: UniProtKB
  • neuroblast migration Source: WormBase
  • neuron migration Source: WormBase
  • protein dephosphorylation Source: UniProtKB
  • protein localization to synapse Source: WormBase
  • synapse assembly Source: WormBase
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase, Protein phosphatase, Receptor

Names & Taxonomyi

Protein namesi
Recommended name:
Tyrosine-protein phosphatase Lar-like (EC:3.1.3.48)
Alternative name(s):
Protein-tyrosine phosphate 3
Gene namesi
Name:ptp-3
ORF Names:C09D8.1/C09D8.2
OrganismiCaenorhabditis elegansImported
Taxonomic identifieri6239 [NCBI]
Taxonomic lineageiEukaryotaMetazoaEcdysozoaNematodaChromadoreaRhabditidaRhabditoideaRhabditidaePeloderinaeCaenorhabditis
Proteomesi
  • UP000001940 Componenti: Chromosome II

Organism-specific databases

WormBaseiC09D8.1a; CE30244; WBGene00004215; ptp-3.
C09D8.1b; CE30245; WBGene00004215; ptp-3.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini43 – 1497ExtracellularSequence analysisAdd BLAST1455
Transmembranei1498 – 1518HelicalSequence analysisAdd BLAST21
Topological domaini1519 – 2200CytoplasmicSequence analysisAdd BLAST682

GO - Cellular componenti

  • adherens junction Source: UniProtKB
  • integral component of membrane Source: UniProtKB-KW
  • plasma membrane Source: UniProtKB-SubCell
  • synapse Source: WormBase
Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Cell membrane, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 42Sequence analysisAdd BLAST42
ChainiPRO_000002543043 – 2200Tyrosine-protein phosphatase Lar-likeAdd BLAST2158

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi8N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi69 ↔ 122PROSITE-ProRule annotationBy similarity
Glycosylationi116N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi172 ↔ 225PROSITE-ProRule annotationBy similarity
Glycosylationi269N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi272 ↔ 318PROSITE-ProRule annotationBy similarity
Glycosylationi315N-linked (GlcNAc...)Sequence analysis1
Glycosylationi574N-linked (GlcNAc...)1 Publication1
Glycosylationi945N-linked (GlcNAc...)Sequence analysis1
Glycosylationi988N-linked (GlcNAc...)Sequence analysis1
Glycosylationi1069N-linked (GlcNAc...)Sequence analysis1
Glycosylationi1141N-linked (GlcNAc...)Sequence analysis1
Glycosylationi1212N-linked (GlcNAc...)1 Publication1
Glycosylationi1330N-linked (GlcNAc...)Sequence analysis1

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

EPDiQ9BMN8.
PaxDbiQ9BMN8.
PeptideAtlasiQ9BMN8.
PRIDEiQ9BMN8.

Expressioni

Tissue specificityi

Both isoforms are ubiquitously expressed in early embryos. In later embryos, larvae and adults expression is highest in the nerve ring, dorsal cord, ventral cord and epithelial tissues.1 Publication

Gene expression databases

BgeeiWBGene00004215.
ExpressionAtlasiQ9BMN8. differential.

Interactioni

Protein-protein interaction databases

BioGridi39995. 3 interactors.
MINTiMINT-1041938.
STRINGi6239.C09D8.1d.

Structurei

3D structure databases

ProteinModelPortaliQ9BMN8.
SMRiQ9BMN8.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini47 – 139Ig-like C2-type 1Add BLAST93
Domaini151 – 240Ig-like C2-type 2Add BLAST90
Domaini250 – 334Ig-like C2-type 3Add BLAST85
Domaini341 – 434Fibronectin type-III 1PROSITE-ProRule annotationAdd BLAST94
Domaini439 – 535Fibronectin type-III 2PROSITE-ProRule annotationAdd BLAST97
Domaini539 – 628Fibronectin type-III 3PROSITE-ProRule annotationAdd BLAST90
Domaini633 – 748Fibronectin type-III 4PROSITE-ProRule annotationAdd BLAST116
Domaini752 – 856Fibronectin type-III 5PROSITE-ProRule annotationAdd BLAST105
Domaini857 – 956Fibronectin type-III 6PROSITE-ProRule annotationAdd BLAST100
Domaini957 – 1053Fibronectin type-III 7PROSITE-ProRule annotationAdd BLAST97
Domaini1058 – 1158Fibronectin type-III 8PROSITE-ProRule annotationAdd BLAST101
Domaini1181 – 1287Fibronectin type-III 9PROSITE-ProRule annotationAdd BLAST107
Domaini1647 – 1902Tyrosine-protein phosphatase 1PROSITE-ProRule annotationAdd BLAST256
Domaini1933 – 2192Tyrosine-protein phosphatase 2PROSITE-ProRule annotationAdd BLAST260

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni1843 – 1849Substrate bindingBy similarity7

Sequence similaritiesi

Contains 9 fibronectin type-III domains.PROSITE-ProRule annotation
Contains 2 tyrosine-protein phosphatase domains.PROSITE-ProRule annotation

Keywords - Domaini

Immunoglobulin domain, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG4228. Eukaryota.
COG5599. LUCA.
HOGENOMiHOG000010250.
InParanoidiQ9BMN8.
PhylomeDBiQ9BMN8.

Family and domain databases

CDDicd00063. FN3. 8 hits.
Gene3Di2.60.40.10. 12 hits.
3.90.190.10. 2 hits.
InterProiIPR003961. FN3_dom.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR013098. Ig_I-set.
IPR003599. Ig_sub.
IPR003598. Ig_sub2.
IPR029021. Prot-tyrosine_phosphatase-like.
IPR000242. PTPase_domain.
IPR016130. Tyr_Pase_AS.
IPR003595. Tyr_Pase_cat.
IPR000387. TYR_PHOSPHATASE_dom.
[Graphical view]
PfamiPF00041. fn3. 6 hits.
PF07679. I-set. 1 hit.
PF00102. Y_phosphatase. 2 hits.
[Graphical view]
PRINTSiPR00700. PRTYPHPHTASE.
SMARTiSM00060. FN3. 9 hits.
SM00409. IG. 3 hits.
SM00408. IGc2. 3 hits.
SM00194. PTPc. 2 hits.
SM00404. PTPc_motif. 2 hits.
[Graphical view]
SUPFAMiSSF48726. SSF48726. 3 hits.
SSF49265. SSF49265. 7 hits.
SSF52799. SSF52799. 2 hits.
PROSITEiPS50853. FN3. 9 hits.
PS50835. IG_LIKE. 3 hits.
PS00383. TYR_PHOSPHATASE_1. 1 hit.
PS50056. TYR_PHOSPHATASE_2. 2 hits.
PS50055. TYR_PHOSPHATASE_PTP. 2 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform a1 Publication (identifier: Q9BMN8-1) [UniParc]FASTAAdd to basket
Also known as: ptp-3a

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MIQFRNKNNS MNRIARHLRN VARRKGSSLL LFLMLSTVLV AAKEDDPARL
60 70 80 90 100
VVRPDSSTVV DESKISFFCR ADGNPLPSVI WRVNGKSITD HNRISIKSLA
110 120 130 140 150
TGLSTLRFER VSLDDNATVV SCSADNGVAN PVVAEASLTV VPRDKVPIGF
160 170 180 190 200
PQIELHPSLK SVEQGKTAYV SCRVRGDPRA KVLWLRDLIP LDIRADGRYS
210 220 230 240 250
VSTIGNPGAL MIQHAREEDQ GKYECIARNT LGVAHSKAAN LYVKVRRVPP
260 270 280 290 300
YFSYKLERQY VVGVGGNINL TCVAVGYPMP RVFWKKTDLM VLDDPSTAPI
310 320 330 340 350
GKNVLTLTHV ESTENFTCVA VSALGNIEAT TTVIAKELPP PPVNIVVSSV
360 370 380 390 400
TSESVVITWK PPKYNEAINK YVVNYRLKYS EGRSSRGKTM ETLENSLVID
410 420 430 440 450
GLVAFQTYEF TVRSAGPVGV GLESLPVEAQ TKPSKPATAP VSPQARSLNR
460 470 480 490 500
DSILVKWGPC EQPNGLITGY KVYYTNDLVT TPIREWKQHD AKSDEFMTTI
510 520 530 540 550
NGLEPDSRYF VRVIAQNSEG DSPLSTLVTV ATRQGIPGQP PMLTVKALDS
560 570 580 590 600
RRMQLTWDKP LYSSPVVGYT VRYNTSDGEK ELTLTSPHEK HVVTGLHPDK
610 620 630 640 650
YYYFRVAAYS DRGQGEFTEP MISKTIASIP LSSPTIVSAA ATSSKSVEIR
660 670 680 690 700
WKGPEQKKLN GVLTAYRINY FRLEDSKTAN LESVEYDEDM DDSSSFLDRM
710 720 730 740 750
SVVVPSDATS YVLSDLLPYS SYEITVAAST MDGYGPESSI RVVKTLEDVP
760 770 780 790 800
SAPRNFNAEL TSATSVKLTW DAPAAANGAL LGYYVYLDRM VNGEPVVEKG
810 820 830 840 850
SKKRIVMIRD SSKRYFELDS LDPNTEYSFR LNAFNRNGDG EFSERKSIIT
860 870 880 890 900
QGIPPEAPEI VSVSLDRDEP PVVARIEWKM PKMKPNETPI EKYNLWLRAQ
910 920 930 940 950
GYPDSYVKAK TVDGTDLSTT ISGLWMGVVY DVLLAAENRE GRSQNATETI
960 970 980 990 1000
ATPVGSPDGE PIDVQYEVMK GKIVVSWRPP SEEKRNGNIT SYKAILSAMD
1010 1020 1030 1040 1050
ATADRYEQPV PAPSTSSTFE VNVRRAYLFK VAAATMKGIG PYSPVLTINP
1060 1070 1080 1090 1100
DPAALVGPPT NVRVEATSNS TAVVQWDFES QKADSFVVKY MHEPGNRMDT
1110 1120 1130 1140 1150
EKWKQLPVVS IDKENPKRFA VVSDLNAHKP YAFCVLAVKN NLTLNEQFNK
1160 1170 1180 1190 1200
VRVTNYMTNF QRQGPCSDPP TVLESVTPTY MVQNLRVLWK TSNSVQLTWE
1210 1220 1230 1240 1250
YNGPRNVGFY VNHTGRKDYV NHELQEKTMS TPGFGQDVDE KHREYLWTNL
1260 1270 1280 1290 1300
RPHMMYTIHV GVRTLPPGAR KYWPQEVVTI TDPTGPPFVD VPKLVDSSGT
1310 1320 1330 1340 1350
QPGQQMIRLT PATEEYGPIS HYWIILVPAN YSTEDVVNLD PIELEKATAE
1360 1370 1380 1390 1400
KRAQLARSLS VSPSKKLKRK ASEVGDDSQS ASYHPKEKRA RRATVPGAYV
1410 1420 1430 1440 1450
TARLSADRVK QQYRNNQPFI VGDSQLYDGF TNYPLEHNLH YRLMMRAFAK
1460 1470 1480 1490 1500
NDVRTKDSFE QRAPMSEKLS RMYSDSVLTE PFTIKSALRG ASQKSSPWVG
1510 1520 1530 1540 1550
ACIAFLVLFS IVGMLICWWL RCNKKSAGRH PRHGSITKVA LTGNIMNGGG
1560 1570 1580 1590 1600
GIPGETSKLL STSNEYGRQI MNPYEQMNGN HHMESSMDLY PLPTSHSRSN
1610 1620 1630 1640 1650
GYAPVPVAIP SLPNNGNNMT TVSHPAVPIA ELANHIERLR MNNNAGFQSE
1660 1670 1680 1690 1700
FESIETGQHF TWEHSSADMN KHKNRYANVA AYDHSRVVLS NVEGYPGMDY
1710 1720 1730 1740 1750
INANYVDGYD KPRSYIATQG PLPETFSDFW RMVWEEQSVT IVMLTNLEER
1760 1770 1780 1790 1800
SRVKCDQYWP SRGTATYGDI EVTLLESVHL AHYTMRTMRL KMVGEPEVRE
1810 1820 1830 1840 1850
IKHLQYTAWP DHGVPDHPTP FLIFLKRVKT LNPNDAGPII SHCSAGIGRT
1860 1870 1880 1890 1900
GAFIVIDCML ERLRYDNTVD IYGCVTALRA QRSYMVQTEE QYIFIHDAVL
1910 1920 1930 1940 1950
DAVNSGSTEV PASRLHQHLH ILSQPSADQL SGIDMEFRHL TTLKWTSNRC
1960 1970 1980 1990 2000
TVANLPVNRP KNRMLSAVPY DSNRVIMRLL PGADGSDYIN ASWIDGYKER
2010 2020 2030 2040 2050
GAYIATQAPT NETAADFWRA IWEHNSPIIA MLVRTNERGQ EQCSDYWPLE
2060 2070 2080 2090 2100
TGVQVGMLVV EPMAEYDMKH YHLREFRISD INTREVRTVR QFHFMEWPDV
2110 2120 2130 2140 2150
GKPHTADHFL DFVTQVHNTY AQFGCTGPIT VHCCSGAGRT AVFIALSIIL
2160 2170 2180 2190 2200
DRMRAEHVVD VFTTVKLLRT ERQNMIQEPE QYHFLYLAAY EYLAAYDNFS
Length:2,200
Mass (Da):246,620
Last modified:June 1, 2001 - v1
Checksum:i43A5D8133EC07E37
GO
Isoform b1 Publication (identifier: Q9BMN8-2) [UniParc]FASTAAdd to basket
Also known as: ptp-3b

The sequence of this isoform differs from the canonical sequence as follows:
     1-713: Missing.
     714-748: SDLLPYSSYEITVAASTMDGYGPESSIRVVKTLED → MGTPATTIAAINNNFRKFFILFLLLLAPTCRGQQK

Show »
Length:1,487
Mass (Da):167,959
Checksum:i2FBE21B52B16F7D7
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0070071 – 713Missing in isoform b. 1 PublicationAdd BLAST713
Alternative sequenceiVSP_007008714 – 748SDLLP…KTLED → MGTPATTIAAINNNFRKFFI LFLLLLAPTCRGQQK in isoform b. 1 PublicationAdd BLAST35

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF316539 mRNA. Translation: AAK01632.1.
AF316540 mRNA. Translation: AAK01633.1.
Z46811, Z49938 Genomic DNA. Translation: CAA86842.3. Sequence problems.
Z49938, Z46811 Genomic DNA. Translation: CAA90189.3. Sequence problems.
Z49938, Z46811 Genomic DNA. Translation: CAD31752.1. Sequence problems.
Z46811, Z49938 Genomic DNA. Translation: CAD31753.1. Sequence problems.
PIRiT19121.
RefSeqiNP_001021942.1. NM_001026771.2.
NP_001021943.1. NM_001026772.3.
NP_001293468.1. NM_001306539.1. [Q9BMN8-2]
NP_001293469.1. NM_001306540.1. [Q9BMN8-1]
UniGeneiCel.5177.

Genome annotation databases

EnsemblMetazoaiC09D8.1l; C09D8.1l; WBGene00004215. [Q9BMN8-1]
GeneIDi174685.
UCSCiC09D8.1d. c. elegans. [Q9BMN8-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF316539 mRNA. Translation: AAK01632.1.
AF316540 mRNA. Translation: AAK01633.1.
Z46811, Z49938 Genomic DNA. Translation: CAA86842.3. Sequence problems.
Z49938, Z46811 Genomic DNA. Translation: CAA90189.3. Sequence problems.
Z49938, Z46811 Genomic DNA. Translation: CAD31752.1. Sequence problems.
Z46811, Z49938 Genomic DNA. Translation: CAD31753.1. Sequence problems.
PIRiT19121.
RefSeqiNP_001021942.1. NM_001026771.2.
NP_001021943.1. NM_001026772.3.
NP_001293468.1. NM_001306539.1. [Q9BMN8-2]
NP_001293469.1. NM_001306540.1. [Q9BMN8-1]
UniGeneiCel.5177.

3D structure databases

ProteinModelPortaliQ9BMN8.
SMRiQ9BMN8.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi39995. 3 interactors.
MINTiMINT-1041938.
STRINGi6239.C09D8.1d.

Proteomic databases

EPDiQ9BMN8.
PaxDbiQ9BMN8.
PeptideAtlasiQ9BMN8.
PRIDEiQ9BMN8.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsemblMetazoaiC09D8.1l; C09D8.1l; WBGene00004215. [Q9BMN8-1]
GeneIDi174685.
UCSCiC09D8.1d. c. elegans. [Q9BMN8-1]

Organism-specific databases

CTDi174685.
WormBaseiC09D8.1a; CE30244; WBGene00004215; ptp-3.
C09D8.1b; CE30245; WBGene00004215; ptp-3.

Phylogenomic databases

eggNOGiKOG4228. Eukaryota.
COG5599. LUCA.
HOGENOMiHOG000010250.
InParanoidiQ9BMN8.
PhylomeDBiQ9BMN8.

Miscellaneous databases

PROiQ9BMN8.

Gene expression databases

BgeeiWBGene00004215.
ExpressionAtlasiQ9BMN8. differential.

Family and domain databases

CDDicd00063. FN3. 8 hits.
Gene3Di2.60.40.10. 12 hits.
3.90.190.10. 2 hits.
InterProiIPR003961. FN3_dom.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR013098. Ig_I-set.
IPR003599. Ig_sub.
IPR003598. Ig_sub2.
IPR029021. Prot-tyrosine_phosphatase-like.
IPR000242. PTPase_domain.
IPR016130. Tyr_Pase_AS.
IPR003595. Tyr_Pase_cat.
IPR000387. TYR_PHOSPHATASE_dom.
[Graphical view]
PfamiPF00041. fn3. 6 hits.
PF07679. I-set. 1 hit.
PF00102. Y_phosphatase. 2 hits.
[Graphical view]
PRINTSiPR00700. PRTYPHPHTASE.
SMARTiSM00060. FN3. 9 hits.
SM00409. IG. 3 hits.
SM00408. IGc2. 3 hits.
SM00194. PTPc. 2 hits.
SM00404. PTPc_motif. 2 hits.
[Graphical view]
SUPFAMiSSF48726. SSF48726. 3 hits.
SSF49265. SSF49265. 7 hits.
SSF52799. SSF52799. 2 hits.
PROSITEiPS50853. FN3. 9 hits.
PS50835. IG_LIKE. 3 hits.
PS00383. TYR_PHOSPHATASE_1. 1 hit.
PS50056. TYR_PHOSPHATASE_2. 2 hits.
PS50055. TYR_PHOSPHATASE_PTP. 2 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiLAR_CAEEL
AccessioniPrimary (citable) accession number: Q9BMN8
Secondary accession number(s): Q09434
, Q17859, Q20137, Q9BMN7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 28, 2003
Last sequence update: June 1, 2001
Last modified: November 30, 2016
This is version 129 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programCaenorhabditis annotation project

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Caenorhabditis elegans
    Caenorhabditis elegans: entries, gene names and cross-references to WormBase
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.