Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Agamous-like MADS-box protein AGL27

Gene

AGL27

Organism
Arabidopsis thaliana (Mouse-ear cress)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Probable transcription factor involved in the negative regulation of flowering time in both long and short days, probably through the photoperiodic and vernalization pathways. Prevents premature flowering.4 Publications

GO - Molecular functioni

  • DNA binding Source: UniProtKB-KW
  • transcription factor activity, sequence-specific DNA binding Source: TAIR

GO - Biological processi

  • flower development Source: UniProtKB-KW
  • photoperiodism, flowering Source: TAIR
  • regulation of flower development Source: TAIR
  • regulation of transcription, DNA-templated Source: TAIR
  • transcription, DNA-templated Source: UniProtKB-KW
Complete GO annotation...

Keywords - Molecular functioni

Developmental protein

Keywords - Biological processi

Flowering, Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Agamous-like MADS-box protein AGL27
Alternative name(s):
MADS box FLC1-like nuclear protein
Protein FLOWERING LOCUS M
Protein MADS AFFECTING FLOWERING 1
Gene namesi
Name:AGL27
Synonyms:FK1, FLM, MAF1
Ordered Locus Names:At1g77080
ORF Names:F22K20.15
OrganismiArabidopsis thaliana (Mouse-ear cress)
Taxonomic identifieri3702 [NCBI]
Taxonomic lineageiEukaryotaViridiplantaeStreptophytaEmbryophytaTracheophytaSpermatophytaMagnoliophytaeudicotyledonsGunneridaePentapetalaerosidsmalvidsBrassicalesBrassicaceaeCamelineaeArabidopsis
Proteomesi
  • UP000006548 Componenti: Chromosome 1

Organism-specific databases

TAIRiAT1G77080.

Subcellular locationi

  • Nucleus PROSITE-ProRule annotation

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Disruption phenotypei

Suppress the late-flowering phenotype of photoperiod-pathway mutants. Affects natural variation in flowering behavior in both long and short days.3 Publications

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 196196Agamous-like MADS-box protein AGL27PRO_0000412532Add
BLAST

Proteomic databases

PaxDbiQ9AT76.

Expressioni

Tissue specificityi

Expressed in most plant tissues, embryo, seedlings, roots, leaves, stems, inflorescence, pollen, siliques and flowers.4 Publications

Inductioni

Slightly repressed by vernalization. Negatively regulated at the chromatin level by VIL1 through the photoperiod and vernalization pathways. Requires EARLY FLOWERING 7 (ELF7) and ELF8 to be expressed. Up-regulated by HUA2.4 Publications

Gene expression databases

ExpressionAtlasiQ9AT76. baseline and differential.
GenevisibleiQ9AT76. AT.

Interactioni

Subunit structurei

Interacts with AGL39, AGL97 and AGL74.1 Publication

Protein-protein interaction databases

BioGridi29261. 7 interactions.
DIPiDIP-33758N.
IntActiQ9AT76. 10 interactions.
STRINGi3702.AT1G77080.4.

Structurei

3D structure databases

ProteinModelPortaliQ9AT76.
SMRiQ9AT76. Positions 3-59.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini1 – 6161MADS-boxPROSITE-ProRule annotationAdd
BLAST
Domaini80 – 17091K-boxPROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Contains 1 K-box domain.PROSITE-ProRule annotation
Contains 1 MADS-box domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiKOG0014. Eukaryota.
COG5068. LUCA.
HOGENOMiHOG000155301.
InParanoidiQ9AT76.
OMAiASQMGKN.
OrthoDBiEOG09360SLW.
PhylomeDBiQ9AT76.

Family and domain databases

InterProiIPR002487. TF_Kbox.
IPR002100. TF_MADSbox.
[Graphical view]
PfamiPF01486. K-box. 1 hit.
PF00319. SRF-TF. 1 hit.
[Graphical view]
PRINTSiPR00404. MADSDOMAIN.
SMARTiSM00432. MADS. 1 hit.
[Graphical view]
SUPFAMiSSF55455. SSF55455. 1 hit.
PROSITEiPS51297. K_BOX. 1 hit.
PS50066. MADS_BOX_2. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9AT76-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGRRKIEIKR IENKSSRQVT FSKRRNGLID KARQLSILCE SSVAVVVVSA
60 70 80 90 100
SGKLYDSSSG DDISKIIDRY EIQHADELRA LDLEEKIQNY LPHKELLETV
110 120 130 140 150
QSKLEEPNVD NVSVDSLISL EEQLETALSV SRARKAELMM EYIESLKEKE
160 170 180 190
KLLREENQVL ASQMGKNTLL ATDDERGMFP GSSSGNKIPE TLPLLN
Length:196
Mass (Da):22,119
Last modified:June 1, 2001 - v1
Checksum:i8A9EEEE7085236DD
GO
Isoform 2 (identifier: Q9AT76-2) [UniParc]FASTAAdd to basket
Also known as: AGL27-I

The sequence of this isoform differs from the canonical sequence as follows:
     164-173: MGKNTLLATD → LSEKKGMSHR
     174-196: Missing.

Note: No experimental confirmation available.
Show »
Length:173
Mass (Da):19,787
Checksum:i07422E88B307A818
GO
Isoform 3 (identifier: Q9AT76-3) [UniParc]FASTAAdd to basket
Also known as: AGL27-II

The sequence of this isoform differs from the canonical sequence as follows:
     62-80: DISKIIDRYEIQHADELRA → EIEALFKPEKPQCFE

Note: No experimental confirmation available.
Show »
Length:192
Mass (Da):21,642
Checksum:i7D4B0B34C74B7E5B
GO
Isoform 4 (identifier: Q9AT76-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-62: MGRRKIEIKRIENKSSRQVTFSKRRNGLIDKARQLSILCESSVAVVVVSASGKLYDSSSGDD → MHFCFISS
     101-101: Q → QRLAVRHIFLPSSSDKKNVFFLLSTCEY
     150-168: EKLLREENQVLASQMGKNT → VSALVFIFDKGHILGYDDS
     169-196: Missing.

Note: No experimental confirmation available.
Show »
Length:141
Mass (Da):16,326
Checksum:i2C3AF9F13DD381B5
GO

Sequence cautioni

The sequence AAC00628 differs from that shown. Reason: Erroneous gene model prediction. Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 6262MGRRK…SSGDD → MHFCFISS in isoform 4. 1 PublicationVSP_041692Add
BLAST
Alternative sequencei62 – 8019DISKI…DELRA → EIEALFKPEKPQCFE in isoform 3. 1 PublicationVSP_041693Add
BLAST
Alternative sequencei101 – 1011Q → QRLAVRHIFLPSSSDKKNVF FLLSTCEY in isoform 4. 1 PublicationVSP_041694
Alternative sequencei150 – 16819EKLLR…MGKNT → VSALVFIFDKGHILGYDDS in isoform 4. 1 PublicationVSP_041695Add
BLAST
Alternative sequencei164 – 17310MGKNTLLATD → LSEKKGMSHR in isoform 2. 1 PublicationVSP_041696
Alternative sequencei169 – 19628Missing in isoform 4. 1 PublicationVSP_041697Add
BLAST
Alternative sequencei174 – 19623Missing in isoform 2. 1 PublicationVSP_041698Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF312665 mRNA. Translation: AAG37902.1.
AF312666 mRNA. Translation: AAG37903.1.
AF342808 mRNA. Translation: AAK37527.1.
AY141210 mRNA. Translation: AAN52774.1.
AY034083 mRNA. Translation: AAK54440.1.
AC002291 Genomic DNA. Translation: AAC00628.1. Sequence problems.
CP002684 Genomic DNA. Translation: AEE35929.1.
CP002684 Genomic DNA. Translation: AEE35930.1.
CP002684 Genomic DNA. Translation: AEE35931.1.
CP002684 Genomic DNA. Translation: AEE35932.1.
AK117577 mRNA. Translation: BAC42235.1.
BT004598 mRNA. Translation: AAO42844.1.
AK175247 mRNA. Translation: BAD43010.1.
AK176270 mRNA. Translation: BAD44033.1.
AK227948 mRNA. Translation: BAE99916.1.
AY088709 mRNA. Translation: AAM67028.1.
PIRiF96799.
RefSeqiNP_177833.3. NM_106358.3. [Q9AT76-1]
NP_850979.1. NM_180648.3. [Q9AT76-3]
NP_850980.2. NM_180649.3. [Q9AT76-4]
NP_974160.2. NM_202431.2. [Q9AT76-2]
UniGeneiAt.19799.

Genome annotation databases

EnsemblPlantsiAT1G77080.4; AT1G77080.4; AT1G77080. [Q9AT76-1]
GeneIDi844042.
KEGGiath:AT1G77080.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF312665 mRNA. Translation: AAG37902.1.
AF312666 mRNA. Translation: AAG37903.1.
AF342808 mRNA. Translation: AAK37527.1.
AY141210 mRNA. Translation: AAN52774.1.
AY034083 mRNA. Translation: AAK54440.1.
AC002291 Genomic DNA. Translation: AAC00628.1. Sequence problems.
CP002684 Genomic DNA. Translation: AEE35929.1.
CP002684 Genomic DNA. Translation: AEE35930.1.
CP002684 Genomic DNA. Translation: AEE35931.1.
CP002684 Genomic DNA. Translation: AEE35932.1.
AK117577 mRNA. Translation: BAC42235.1.
BT004598 mRNA. Translation: AAO42844.1.
AK175247 mRNA. Translation: BAD43010.1.
AK176270 mRNA. Translation: BAD44033.1.
AK227948 mRNA. Translation: BAE99916.1.
AY088709 mRNA. Translation: AAM67028.1.
PIRiF96799.
RefSeqiNP_177833.3. NM_106358.3. [Q9AT76-1]
NP_850979.1. NM_180648.3. [Q9AT76-3]
NP_850980.2. NM_180649.3. [Q9AT76-4]
NP_974160.2. NM_202431.2. [Q9AT76-2]
UniGeneiAt.19799.

3D structure databases

ProteinModelPortaliQ9AT76.
SMRiQ9AT76. Positions 3-59.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi29261. 7 interactions.
DIPiDIP-33758N.
IntActiQ9AT76. 10 interactions.
STRINGi3702.AT1G77080.4.

Proteomic databases

PaxDbiQ9AT76.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsemblPlantsiAT1G77080.4; AT1G77080.4; AT1G77080. [Q9AT76-1]
GeneIDi844042.
KEGGiath:AT1G77080.

Organism-specific databases

TAIRiAT1G77080.

Phylogenomic databases

eggNOGiKOG0014. Eukaryota.
COG5068. LUCA.
HOGENOMiHOG000155301.
InParanoidiQ9AT76.
OMAiASQMGKN.
OrthoDBiEOG09360SLW.
PhylomeDBiQ9AT76.

Miscellaneous databases

PROiQ9AT76.

Gene expression databases

ExpressionAtlasiQ9AT76. baseline and differential.
GenevisibleiQ9AT76. AT.

Family and domain databases

InterProiIPR002487. TF_Kbox.
IPR002100. TF_MADSbox.
[Graphical view]
PfamiPF01486. K-box. 1 hit.
PF00319. SRF-TF. 1 hit.
[Graphical view]
PRINTSiPR00404. MADSDOMAIN.
SMARTiSM00432. MADS. 1 hit.
[Graphical view]
SUPFAMiSSF55455. SSF55455. 1 hit.
PROSITEiPS51297. K_BOX. 1 hit.
PS50066. MADS_BOX_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiAGL27_ARATH
AccessioniPrimary (citable) accession number: Q9AT76
Secondary accession number(s): O49291
, Q7XYY7, Q9FPN8, Q9FPN9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: September 21, 2011
Last sequence update: June 1, 2001
Last modified: September 7, 2016
This is version 110 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programPlant Protein Annotation Program

Miscellaneousi

Miscellaneous

The early flowering of cv. Nd-1 (especially in short days) is due to a deletion of AGL27. This deletion is associated with the QTL 'FLOWERING 1' (FLW1) (PubMed:15695584).1 Publication

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Arabidopsis thaliana
    Arabidopsis thaliana: entries and gene names
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.