Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q99PJ1

- PCD15_MOUSE

UniProt

Q99PJ1 - PCD15_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Protocadherin-15

Gene

Pcdh15

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Calcium-dependent cell-adhesion protein. Required for inner ear neuroepithelial cell elaboration and cochlear function. Probably involved in the maintenance of normal retinal function.

GO - Molecular functioni

  1. calcium ion binding Source: InterPro

GO - Biological processi

  1. actin filament organization Source: MGI
  2. adult walking behavior Source: MGI
  3. auditory receptor cell differentiation Source: MGI
  4. auditory receptor cell stereocilium organization Source: MGI
  5. detection of mechanical stimulus involved in equilibrioception Source: MGI
  6. detection of mechanical stimulus involved in sensory perception of sound Source: MGI
  7. homophilic cell adhesion Source: InterPro
  8. inner ear development Source: MGI
  9. locomotory behavior Source: MGI
  10. morphogenesis of an epithelium Source: MGI
  11. multicellular organism growth Source: MGI
  12. nonmotile primary cilium assembly Source: MGI
  13. righting reflex Source: MGI
  14. sensory perception of sound Source: MGI
  15. startle response Source: MGI
  16. visual perception Source: MGI
Complete GO annotation...

Keywords - Biological processi

Cell adhesion, Hearing

Keywords - Ligandi

Calcium

Names & Taxonomyi

Protein namesi
Recommended name:
Protocadherin-15
Gene namesi
Name:Pcdh15
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 10

Organism-specific databases

MGIiMGI:1891428. Pcdh15.

Subcellular locationi

Cell membrane 2 Publications; Single-pass membrane protein 2 Publications
Note: Efficient localization to the plasma membrane requires the presence of LHFPL5.

GO - Cellular componenti

  1. cytoplasm Source: MGI
  2. extracellular region Source: UniProtKB-KW
  3. integral component of membrane Source: MGI
  4. photoreceptor outer segment Source: MGI
  5. plasma membrane Source: MGI
  6. stereocilium Source: HGNC
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane, Secreted

Pathology & Biotechi

Involvement in diseasei

Defects in Pcdh15 are the cause of the Ames waltzer (av) phenotype. It is characterized by deafness and a balance disorder, associated with the degeneration of inner ear neuroepithelia.

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi48 – 481I → A: Strongly reduced interaction with CDH23. 1 Publication
Mutagenesisi139 – 1391R → G: Impaired interaction with CDH23. 1 Publication

Keywords - Diseasei

Deafness

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2626Sequence AnalysisAdd
BLAST
Chaini27 – 19431917Protocadherin-15PRO_0000003999Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi37 ↔ 1251 Publication
Glycosylationi57 – 571N-linked (GlcNAc...)Sequence Analysis
Glycosylationi102 – 1021N-linked (GlcNAc...)Sequence Analysis
Glycosylationi206 – 2061N-linked (GlcNAc...)Sequence Analysis
Glycosylationi424 – 4241N-linked (GlcNAc...)Sequence Analysis
Glycosylationi564 – 5641N-linked (GlcNAc...)Sequence Analysis
Glycosylationi667 – 6671N-linked (GlcNAc...)Sequence Analysis
Glycosylationi729 – 7291N-linked (GlcNAc...)Sequence Analysis
Glycosylationi773 – 7731N-linked (GlcNAc...)Sequence Analysis
Glycosylationi826 – 8261N-linked (GlcNAc...)Sequence Analysis
Glycosylationi856 – 8561N-linked (GlcNAc...)Sequence Analysis
Glycosylationi1069 – 10691N-linked (GlcNAc...)Sequence Analysis
Glycosylationi1089 – 10891N-linked (GlcNAc...)Sequence Analysis
Glycosylationi1180 – 11801N-linked (GlcNAc...)Sequence Analysis

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PRIDEiQ99PJ1.

PTM databases

PhosphoSiteiQ99PJ1.

Expressioni

Tissue specificityi

Expressed in brain and sensory epithelium of the developing inner ear. Expressed in the retina, in the photoreceptor inner segments, the outer plexiform layer, the inner nuclei layer and the ganglion cell layer and, more diffusely in the inner plexiform layer (at protein level). Not detected in the retinal pigment epithelium (at protein level). Expressed in the spleen, dorsal root ganglion, dorsal aspect of neural tube, floor plate and ependymal cells adjacent to the neural canal.4 Publications

Developmental stagei

Highest level of expression is detected at embryonic day 16. Alternative splicing isoforms have different spatiotemporal expression patterns. In cochlear cultures at the equivalent of postnatal day 3, isoforms belonging to the CD1 (isoforms 1 through 9) and CD3 (isoforms 18 through 20) groups are highly expressed in hair bundles in the basal coils and moderately in those in the middle of the apical coil; they are hardly detectable in those at the apical end of the apical coil (at protein level). At the base of the cultured cochlea, in the more mature hair bundles, CD3 group isoforms are restricted to the tips of the shorter stereocilia in both inner and outer hair cells. By contrast, at the same stage, isoforms belonging to the CD2 group (isoforms 10 through 17) are highly expressed in hair bundles in the apex of the cochlea and, at lower levels, in those in the middle of the apical coil; they are hardly detectable at the base of the cochlea (at protein level). In mature hair bundles, CD1 group isoforms are distributed fairly evenly along most of the length of the stereocilia on auditory hair cells, whereas they are concentrated toward the upper third of the hair bundle in vestibular hair cells. In both the auditory and the vestibular organs, these isoforms are excluded from a region at the very tip of each stereocilium (at protein level). In contrast, CD2 group isoforms are undetectable in adult cochlear hair cells (at protein level). These isoforms are expressed in the entire hair bundle of the immature cells in the sensory epithelium of the early postnatal vestibule and only in the kinocilium in the more mature hair bundles (at protein level). CD3 group isoforms are detected in immature vestibular hair bundles, concentrated toward the tip of each stereocilium, as early as 15.5 dpc. They also localize to the tips of the shorter stereocilia in the mature vestibular hair bundles and are not detected at the tips of the stereocilia in the tallest row (at protein level).1 Publication

Gene expression databases

CleanExiMM_PCDH15.
ExpressionAtlasiQ99PJ1. baseline and differential.
GenevestigatoriQ99PJ1.

Interactioni

Subunit structurei

antiparallel heterodimer with CDH23. Interacts with MYO7A. Interacts with USH1G; this interaction may recruit USH1G to the plasma membrane. Interacts with LHFPL5/TMHS; this interaction is required for efficient localization to hair bundles.5 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
Ush1cQ9ES643EBI-6556746,EBI-7418968

Protein-protein interaction databases

BioGridi198282. 3 interactions.
DIPiDIP-42151N.
IntActiQ99PJ1. 2 interactions.
MINTiMINT-1895732.
STRINGi10090.ENSMUSP00000101066.

Structurei

Secondary structure

1
1943
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Turni27 – 304
Helixi31 – 344
Beta strandi38 – 414
Beta strandi45 – 528
Beta strandi60 – 634
Beta strandi67 – 693
Beta strandi71 – 755
Beta strandi77 – 848
Helixi86 – 883
Beta strandi90 – 934
Turni94 – 974
Beta strandi98 – 1014
Turni112 – 1143
Beta strandi118 – 12710
Turni128 – 1303
Beta strandi133 – 14311
Beta strandi151 – 1555
Beta strandi157 – 1626
Beta strandi170 – 1723
Turni174 – 1796
Beta strandi180 – 1823
Beta strandi184 – 1863
Helixi187 – 1904
Beta strandi192 – 1976
Helixi205 – 2084
Turni214 – 2163
Beta strandi219 – 2213
Turni227 – 2293
Beta strandi232 – 24110
Helixi246 – 2483
Beta strandi251 – 2599

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
4APXX-ray1.65B27-259[»]
4AQ8X-ray2.63C/D27-259[»]
4AQAX-ray1.96B27-259[»]
4AQEX-ray2.27B27-259[»]
4AXWX-ray2.23B27-259[»]
ProteinModelPortaliQ99PJ1.
SMRiQ99PJ1. Positions 27-260.
ModBaseiSearch...
MobiDBiSearch...

Topological domain

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini27 – 13811355ExtracellularSequence AnalysisAdd
BLAST
Topological domaini1403 – 1943541CytoplasmicSequence AnalysisAdd
BLAST

Transmembrane

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei1382 – 140221HelicalSequence AnalysisAdd
BLAST

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini45 – 152108Cadherin 1PROSITE-ProRule annotationAdd
BLAST
Domaini153 – 270118Cadherin 2PROSITE-ProRule annotationAdd
BLAST
Domaini283 – 400118Cadherin 3PROSITE-ProRule annotationAdd
BLAST
Domaini401 – 514114Cadherin 4PROSITE-ProRule annotationAdd
BLAST
Domaini515 – 621107Cadherin 5PROSITE-ProRule annotationAdd
BLAST
Domaini622 – 722101Cadherin 6PROSITE-ProRule annotationAdd
BLAST
Domaini724 – 824101Cadherin 7PROSITE-ProRule annotationAdd
BLAST
Domaini825 – 931107Cadherin 8PROSITE-ProRule annotationAdd
BLAST
Domaini932 – 1040109Cadherin 9PROSITE-ProRule annotationAdd
BLAST
Domaini1042 – 1149108Cadherin 10PROSITE-ProRule annotationAdd
BLAST
Domaini1150 – 1264115Cadherin 11PROSITE-ProRule annotationAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi1437 – 144812Poly-ProAdd
BLAST
Compositional biasi1772 – 17787Poly-Pro
Compositional biasi1804 – 18129Poly-Pro

Domaini

Cadherin repeats 1 and 2 mediate calcium-dependent heterophilic interaction with CDH23.1 Publication
Three calcium ions are usually bound at the interface of each cadherin domain and rigidify the connections, imparting a strong curvature to the full-length ectodomain.1 Publication

Sequence similaritiesi

Contains 11 cadherin domains.PROSITE-ProRule annotation

Keywords - Domaini

Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG253862.
GeneTreeiENSGT00760000118805.
HOGENOMiHOG000230919.
HOVERGENiHBG053521.
InParanoidiQ99PJ1.
KOiK16500.
OMAiCESARCH.
OrthoDBiEOG7ZWD0W.
TreeFamiTF326779.

Family and domain databases

Gene3Di2.60.40.60. 10 hits.
InterProiIPR002126. Cadherin.
IPR015919. Cadherin-like.
IPR020894. Cadherin_CS.
[Graphical view]
PfamiPF00028. Cadherin. 8 hits.
[Graphical view]
PRINTSiPR00205. CADHERIN.
SMARTiSM00112. CA. 11 hits.
[Graphical view]
SUPFAMiSSF49313. SSF49313. 10 hits.
PROSITEiPS00232. CADHERIN_1. 4 hits.
PS50268. CADHERIN_2. 11 hits.
[Graphical view]

Sequences (26)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 26 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q99PJ1) [UniParc]FASTAAdd to Basket

Also known as: CD1-1

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MFLQFAVWKC LPHGILIASL LVVSWGQYDD DWQYEDCKLA RGGPPATIVA
60 70 80 90 100
IDEESRNGTI LVDNMLIKGT AGGPDPTIEL SLKDNVDYWV LLDPVKQMLF
110 120 130 140 150
LNSTGRVLDR DPPMNIHSIV VQVQCVNKKV GTVIYHEVRI VVRDRNDNSP
160 170 180 190 200
TFKHESYYAT VNELTPVGTT IFTGFSGDNG ATDIDDGPNG QIEYVIQYNP
210 220 230 240 250
EDPTSNDTFE IPLMLTGNVV LRKRLNYEDK TRYYVIIQAN DRAQNLNERR
260 270 280 290 300
TTTTTLTVDV LDGDDLGPMF LPCVLVPNTR DCRPLTYQAA IPELRTPEEL
310 320 330 340 350
NPILVTPPIQ AIDQDRNIQP PSDRPGILYS ILVGTPEDYP RFFHMHPRTA
360 370 380 390 400
ELTLLEPVNR DFHQKFDLVI KAEQDNGHPL PAFASLHIEI LDENNQSPYF
410 420 430 440 450
TMPSYQGYIL ESAPVGATIS ESLNLTTPLR IVALDKDIED TKDPELHLFL
460 470 480 490 500
NDYTSVFTVT PTGITRYLTL LQPVDREEQQ TYTFLITAFD GVQESEPVVV
510 520 530 540 550
NIRVMDANDN TPTFPEISYD VYVYTDMSPG DSVIQLTAVD ADEGSNGEIS
560 570 580 590 600
YEILVGGKGD FVINKTTGLV SIAPGVELIV GQTYALTVQA SDNAPPAERR
610 620 630 640 650
HSICTVYIEV LPPNNQSPPR FPQLMYSLEV SEAMRIGAIL LNLQATDREG
660 670 680 690 700
DPITYAIENG DPQRVFNLSE TTGILSLGKA LDRESTDRYI LIVTASDGRP
710 720 730 740 750
DGTSTATVNI VVTDVNDNAP VFDPYLPRNL SVVEEEANAF VGQVRATDPD
760 770 780 790 800
AGINGQVHYS LGNFNNLFRI TSNGSIYTAV KLNREARDHY ELVVVATDGA
810 820 830 840 850
VHPRHSTLTL YIKVLDIDDN SPVFTNSTYT VVVEENLPAG TSFLQIEAKD
860 870 880 890 900
VDLGANVSYR IRSPEVKHLF ALHPFTGELS LLRSLDYEAF PDQEASITFL
910 920 930 940 950
VEAFDIYGTM PPGIATVTVI VKDMNDYPPV FSKRIYKGMV APDAVKGTPI
960 970 980 990 1000
TTVYAEDADP PGMPASRVRY RVDDVQFPYP ASIFDVEEDS GRVVTRVNLN
1010 1020 1030 1040 1050
EEPTTIFKLV VVAFDDGEPV MSSSATVRIL VLHPGEIPRF TQEEYRPPPV
1060 1070 1080 1090 1100
SELAARGTVV GVISAAAINQ SIVYSIVAGN EEDKFGINNV TGVIYVNSPL
1110 1120 1130 1140 1150
DYETRTSYVL RVQADSLEVV LANLRVPSKS NTAKVYIEIQ DENDHPPVFQ
1160 1170 1180 1190 1200
KKFYIGGVSE DARMFASVLR VKATDRDTGN YSAMAYRLII PPIKEGKEGF
1210 1220 1230 1240 1250
VVETYTGLIK TAMLFHNMRR SYFKFQVIAT DDYGKGLSGK ADVLVSVVNQ
1260 1270 1280 1290 1300
LDMQVIVSNV PPTLVEKKIE DLTEILDRYV QEQIPGAKVV VESIGARRHG
1310 1320 1330 1340 1350
DAYSLEDYSK CDLTVYAIDP QTNRAIDRNE LFKFLDGKLL DINKDFQPYY
1360 1370 1380 1390 1400
GEGGRILEIR TPEAVTSIKK RGESLGYTEG ALLALAFIII LCCIPAILVV
1410 1420 1430 1440 1450
LVSYRQFKVR QAECTKTARI QSAMPAAKPA APVPAAPAPP PPPPPPPPGA
1460 1470 1480 1490 1500
HLYEELGESA MHNLFLLYHF EQSRGNNSVP EDRSSHRDGM AFSSSTTESH
1510 1520 1530 1540 1550
EPAHVEGPLK ESQPNPARTF SFVPDEDNLS THNPLYMESI GQRSTNSDLQ
1560 1570 1580 1590 1600
PRTDFEELLA PRTQVKSQSL RGPREKIQRV WNQSVSFPRR LMWKAPNRPE
1610 1620 1630 1640 1650
TIDLVEWQIT NQRAECESAR CHPSQRGSSN VLLATEDAHE SEKEGGHRDT
1660 1670 1680 1690 1700
LIVQQTEQLK SLSSGSSFSS SWSHFSFSTL PTISRAVELG SEPNVVTSPA
1710 1720 1730 1740 1750
DCTLELSPPL RPRILNSLSS KRETPTCASD TEPKRNSFEI APHPPSISAP
1760 1770 1780 1790 1800
LPHPPLPRPP IAFTTFPLPL SPPNPPPPQL VTFSLPISTP PTSSLPLPPP
1810 1820 1830 1840 1850
LSLPPPPRPP APRLFPQPPS TSIPSTDSIS APAAKCTASA THARETTSTT
1860 1870 1880 1890 1900
QPPASNPQWG AEPHRHPKGI LRHVKNLAEL EKSVSNMYSH IEKNCPPADP
1910 1920 1930 1940
SKLHTFCPAE KTGMKITHDQ SQETLVRVVE GIDVQPHSQS TSL
Length:1,943
Mass (Da):214,738
Last modified:June 26, 2013 - v3
Checksum:i6FD6836082655855
GO
Isoform 2 (identifier: Q99PJ1-2) [UniParc]FASTAAdd to Basket

Also known as: CD1-2

The sequence of this isoform differs from the canonical sequence as follows:
     31-35: Missing.

Show »
Length:1,938
Mass (Da):214,016
Checksum:i40B0EB13DF4E5EFC
GO
Isoform 3 (identifier: Q99PJ1-3) [UniParc]FASTAAdd to Basket

Also known as: CD1-3/5

The sequence of this isoform differs from the canonical sequence as follows:
     31-35: Missing.
     645-689: ATDREGDPIT...ALDRESTDRY → HRDSQPREGS...HCEHSGDGRQ
     690-1943: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.

Show »
Length:684
Mass (Da):76,656
Checksum:i9042A0B5CB766F1F
GO
Isoform 4 (identifier: Q99PJ1-4) [UniParc]FASTAAdd to Basket

Also known as: CD1-4

The sequence of this isoform differs from the canonical sequence as follows:
     31-35: Missing.
     1461-1463: MHN → I

Show »
Length:1,936
Mass (Da):213,747
Checksum:i3740C7F23545D42B
GO
Isoform 5 (identifier: Q99PJ1-5) [UniParc]FASTAAdd to Basket

Also known as: CD1-6

The sequence of this isoform differs from the canonical sequence as follows:
     31-35: Missing.
     600-671: RHSICTVYIEVLPPNNQSPPRFPQLMYSLEVSEAMRIGAILLNLQATDREGDPITYAIENGDPQRVFNLSET → S

Show »
Length:1,867
Mass (Da):205,990
Checksum:iEC9AFA9363BE7757
GO
Isoform 6 (identifier: Q99PJ1-6) [UniParc]FASTAAdd to Basket

Also known as: CD1-7

The sequence of this isoform differs from the canonical sequence as follows:
     31-35: Missing.
     1407-1409: Missing.
     1461-1463: MHN → I

Show »
Length:1,933
Mass (Da):213,372
Checksum:iC708CC475A755E15
GO
Isoform 7 (identifier: Q99PJ1-7) [UniParc]FASTAAdd to Basket

Also known as: CD1-8

The sequence of this isoform differs from the canonical sequence as follows:
     31-35: Missing.
     204-240: Missing.
     1407-1409: Missing.
     1461-1463: MHN → I

Show »
Length:1,896
Mass (Da):209,000
Checksum:iCAA46E2AA740CA6A
GO
Isoform 8 (identifier: Q99PJ1-8) [UniParc]FASTAAdd to Basket

Also known as: CD1-9

The sequence of this isoform differs from the canonical sequence as follows:
     31-57: Missing.

Show »
Length:1,916
Mass (Da):211,721
Checksum:iA416619EE89EABC8
GO
Isoform 9 (identifier: Q99PJ1-9) [UniParc]FASTAAdd to Basket

Also known as: CD1-10

The sequence of this isoform differs from the canonical sequence as follows:
     31-57: Missing.
     1407-1409: Missing.

Show »
Length:1,913
Mass (Da):211,347
Checksum:iFB42EBAEE0565806
GO
Isoform 10 (identifier: Q99PJ1-10) [UniParc]FASTAAdd to Basket

Also known as: CD2-1

The sequence of this isoform differs from the canonical sequence as follows:
     440-440: D → DVPPGGVP
     1463-1943: NLFLLYHFEQ...VQPHSQSTSL → KYEMPQYGSR...ANSEGYNTAL

Show »
Length:1,790
Mass (Da):198,941
Checksum:i5731151E416F5119
GO
Isoform 11 (identifier: Q99PJ1-11) [UniParc]FASTAAdd to Basket

Also known as: CD2-2

The sequence of this isoform differs from the canonical sequence as follows:
     31-35: Missing.
     1463-1523: NLFLLYHFEQ...PNPARTFSFV → KSYPWNLGLI...KLKRNMKKKR
     1524-1943: Missing.

Show »
Length:1,518
Mass (Da):168,209
Checksum:i31FC7C15E9D26B80
GO
Isoform 12 (identifier: Q99PJ1-12) [UniParc]FASTAAdd to Basket

Also known as: CD2-3

The sequence of this isoform differs from the canonical sequence as follows:
     1-401: Missing.
     440-440: D → DVPPGGVP
     1463-1523: NLFLLYHFEQ...PNPARTFSFV → KSYPWNLGLI...KLKRNMKKKR
     1524-1943: Missing.

Show »
Length:1,129
Mass (Da):124,249
Checksum:i1B8BAD179452BA79
GO
Isoform 13 (identifier: Q99PJ1-13) [UniParc]FASTAAdd to Basket

Also known as: CD2-4

The sequence of this isoform differs from the canonical sequence as follows:
     31-35: Missing.
     298-331: EELNPILVTPPIQAIDQDRNIQPPSDRPGILYSI → DFGSLRSGANSWCQGCGGVHRCPSPWRRLLPRRL
     332-1943: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.

Show »
Length:326
Mass (Da):36,453
Checksum:iFA6863C72C1324C2
GO
Isoform 14 (identifier: Q99PJ1-14) [UniParc]FASTAAdd to Basket

Also known as: CD2-5

The sequence of this isoform differs from the canonical sequence as follows:
     31-35: Missing.
     335-339: TPEDY → RARES
     340-1943: Missing.

Show »
Length:334
Mass (Da):37,309
Checksum:i8A4A6FECF06B3883
GO
Isoform 15 (identifier: Q99PJ1-15) [UniParc]FASTAAdd to Basket

Also known as: CD2-6

The sequence of this isoform differs from the canonical sequence as follows:
     31-35: Missing.
     372-655: AEQDNGHPLP...TDREGDPITY → VEPEKVKKPK...ANSEGYNTAL
     656-1943: Missing.

Show »
Length:650
Mass (Da):73,340
Checksum:i0E288A38E5D417FF
GO
Isoform 16 (identifier: Q99PJ1-16) [UniParc]FASTAAdd to Basket

Also known as: CD2-7

The sequence of this isoform differs from the canonical sequence as follows:
     31-35: Missing.
     441-725: TKDPELHLFL...NDNAPVFDPY → VEPEKVKKPK...ANSEGYNTAL
     726-1943: Missing.

Show »
Length:719
Mass (Da):80,894
Checksum:iFFC3D62480CD3DED
GO
Isoform 17 (identifier: Q99PJ1-17) [UniParc]FASTAAdd to Basket

Also known as: CD2-8

The sequence of this isoform differs from the canonical sequence as follows:
     31-35: Missing.
     703-986: TSTATVNIVV...FPYPASIFDV → VEPEKVKKPK...ANSEGYNTAL
     987-1943: Missing.

Show »
Length:981
Mass (Da):109,606
Checksum:i56619B194F1C4501
GO
Isoform 18 (identifier: Q99PJ1-18) [UniParc]FASTAAdd to Basket

Also known as: CD3-1

The sequence of this isoform differs from the canonical sequence as follows:
     1463-1682: NLFLLYHFEQ...SHFSFSTLPT → KYEMPQYGSR...NSLHIPMTKL
     1683-1943: Missing.

Show »
Length:1,682
Mass (Da):186,541
Checksum:i820F564D0CF70A21
GO
Isoform 19 (identifier: Q99PJ1-19) [UniParc]FASTAAdd to Basket

Also known as: CD3-2

The sequence of this isoform differs from the canonical sequence as follows:
     31-35: Missing.
     1463-1682: NLFLLYHFEQ...SHFSFSTLPT → KYEMPQYGSR...NSLHIPMTKL
     1683-1943: Missing.

Show »
Length:1,677
Mass (Da):185,819
Checksum:i2823260AD289185F
GO
Isoform 20 (identifier: Q99PJ1-20) [UniParc]FASTAAdd to Basket

Also known as: CD3-3

The sequence of this isoform differs from the canonical sequence as follows:
     1-1252: Missing.
     1407-1667: FKVRQAECTK...QLKSLSSGSS → GGFAPEHQLL...NSLHIPMTKL
     1668-1943: Missing.

Show »
Length:415
Mass (Da):46,543
Checksum:i58702C92B3B8A8B1
GO
Isoform 21 (identifier: Q99PJ1-21) [UniParc]FASTAAdd to Basket

Also known as: SI-1

The sequence of this isoform differs from the canonical sequence as follows:
     1131-1176: NTAKVYIEIQ...SVLRVKATDR → LSVIPCSWRT...STRAASVPIH
     1177-1943: Missing.

Show »
Length:1,176
Mass (Da):129,853
Checksum:i694D3FBB2455620D
GO
Isoform 22 (identifier: Q99PJ1-22) [UniParc]FASTAAdd to Basket

Also known as: SI-2

The sequence of this isoform differs from the canonical sequence as follows:
     31-35: Missing.
     1131-1176: NTAKVYIEIQ...SVLRVKATDR → LSVIPCSWRT...STRAASVPIH
     1177-1943: Missing.

Show »
Length:1,171
Mass (Da):129,132
Checksum:iF1F9A2CAA115DEA2
GO
Isoform 23 (identifier: Q99PJ1-23) [UniParc]FASTAAdd to Basket

Also known as: SI-3

The sequence of this isoform differs from the canonical sequence as follows:
     31-35: Missing.
     441-961: Missing.
     1131-1176: NTAKVYIEIQ...SVLRVKATDR → LSVIPCSWRT...STRAASVPIH
     1177-1943: Missing.

Show »
Length:650
Mass (Da):72,054
Checksum:iE3300DA7C9F333FB
GO
Isoform 24 (identifier: Q99PJ1-24) [UniParc]FASTAAdd to Basket

Also known as: C

The sequence of this isoform differs from the canonical sequence as follows:
     31-600: Missing.
     1464-1473: Missing.

Note: Produced by aberrant splicing sites.

Show »
Length:1,363
Mass (Da):149,922
Checksum:i5047B631063401AD
GO
Isoform 25 (identifier: Q99PJ1-25) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1462-1943: HNLFLLYHFE...VQPHSQSTSL → YEMPQYGSRR...ANSEGYNTAL

Show »
Length:1,781
Mass (Da):198,072
Checksum:iEE3878002ED66B31
GO
Isoform 26 (identifier: Q99PJ1-26) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1407-1409: Missing.
     1462-1943: HNLFLLYHFE...VQPHSQSTSL → YEMPQYGSRR...NSLHIPMTKL

Show »
Length:1,677
Mass (Da):185,901
Checksum:i924FA442271BE3F4
GO

Sequence cautioni

The sequence ABC79270.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti608 – 6081I → T in AAG53891. (PubMed:11138007)Curated
Sequence conflicti608 – 6081I → T in AAY24693. (PubMed:16799054)Curated
Sequence conflicti608 – 6081I → T in ABC79259. (PubMed:16807332)Curated
Sequence conflicti608 – 6081I → T in ABC79260. (PubMed:16807332)Curated
Sequence conflicti608 – 6081I → T in ABC79261. (PubMed:16807332)Curated
Sequence conflicti608 – 6081I → T in ABC79262. (PubMed:16807332)Curated
Sequence conflicti608 – 6081I → T in ABC79264. (PubMed:16807332)Curated
Sequence conflicti608 – 6081I → T in ABC79265. (PubMed:16807332)Curated
Sequence conflicti608 – 6081I → T in ABC79266. (PubMed:16807332)Curated
Sequence conflicti608 – 6081I → T in ABC79267. (PubMed:16807332)Curated
Sequence conflicti608 – 6081I → T in ABC79268. (PubMed:16807332)Curated
Sequence conflicti608 – 6081I → T in ABC79269. (PubMed:16807332)Curated
Sequence conflicti608 – 6081I → T in ABC79270. (PubMed:16807332)Curated
Sequence conflicti608 – 6081I → T in ABC79276. (PubMed:16807332)Curated
Sequence conflicti608 – 6081I → T in ABC79277. (PubMed:16807332)Curated
Sequence conflicti901 – 9011V → A in AAG53891. (PubMed:11138007)Curated
Sequence conflicti901 – 9011V → A in AAY24693. (PubMed:16799054)Curated
Sequence conflicti901 – 9011V → A in ABC79259. (PubMed:16807332)Curated
Sequence conflicti901 – 9011V → A in ABC79261. (PubMed:16807332)Curated
Sequence conflicti901 – 9011V → A in ABC79263. (PubMed:16807332)Curated
Sequence conflicti901 – 9011V → A in ABC79264. (PubMed:16807332)Curated
Sequence conflicti901 – 9011V → A in ABC79265. (PubMed:16807332)Curated
Sequence conflicti901 – 9011V → A in ABC79266. (PubMed:16807332)Curated
Sequence conflicti901 – 9011V → A in ABC79267. (PubMed:16807332)Curated
Sequence conflicti901 – 9011V → A in ABC79268. (PubMed:16807332)Curated
Sequence conflicti901 – 9011V → A in ABC79269. (PubMed:16807332)Curated
Sequence conflicti901 – 9011V → A in ABC79270. (PubMed:16807332)Curated
Sequence conflicti901 – 9011V → A in ABC79276. (PubMed:16807332)Curated
Sequence conflicti901 – 9011V → A in ABC79277. (PubMed:16807332)Curated
Sequence conflicti1748 – 17481S → F in AAG53891. (PubMed:11138007)Curated
Sequence conflicti1748 – 17481S → F in AAY24693. (PubMed:16799054)Curated
Sequence conflicti1748 – 17481S → F in ABC79259. (PubMed:16807332)Curated
Sequence conflicti1748 – 17481S → F in ABC79261. (PubMed:16807332)Curated
Sequence conflicti1748 – 17481S → F in ABC79263. (PubMed:16807332)Curated
Sequence conflicti1748 – 17481S → F in ABC79264. (PubMed:16807332)Curated
Sequence conflicti1748 – 17481S → F in ABC79265. (PubMed:16807332)Curated
Sequence conflicti1748 – 17481S → F in ABC79266. (PubMed:16807332)Curated
Sequence conflicti1748 – 17481S → F in ABC79267. (PubMed:16807332)Curated
Sequence conflicti1848 – 18481S → F in AAG53891. (PubMed:11138007)Curated
Sequence conflicti1848 – 18481S → F in AAY24693. (PubMed:16799054)Curated
Sequence conflicti1848 – 18481S → F in ABC79259. (PubMed:16807332)Curated
Sequence conflicti1848 – 18481S → F in ABC79261. (PubMed:16807332)Curated
Sequence conflicti1848 – 18481S → F in ABC79263. (PubMed:16807332)Curated
Sequence conflicti1848 – 18481S → F in ABC79264. (PubMed:16807332)Curated
Sequence conflicti1848 – 18481S → F in ABC79265. (PubMed:16807332)Curated
Sequence conflicti1848 – 18481S → F in ABC79266. (PubMed:16807332)Curated
Sequence conflicti1848 – 18481S → F in ABC79267. (PubMed:16807332)Curated
Sequence conflicti1859 – 18591W → G in BAE24546. (PubMed:16141072)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 12521252Missing in isoform 20. 1 PublicationVSP_046576Add
BLAST
Alternative sequencei1 – 401401Missing in isoform 12. 1 PublicationVSP_046577Add
BLAST
Alternative sequencei31 – 600570Missing in isoform 24. 1 PublicationVSP_046578Add
BLAST
Alternative sequencei31 – 5727Missing in isoform 8 and isoform 9. 1 PublicationVSP_046579Add
BLAST
Alternative sequencei31 – 355Missing in isoform 2, isoform 3, isoform 4, isoform 5, isoform 6, isoform 7, isoform 11, isoform 13, isoform 14, isoform 15, isoform 16, isoform 17, isoform 19, isoform 22 and isoform 23. 1 PublicationVSP_046580
Alternative sequencei204 – 24037Missing in isoform 7. 1 PublicationVSP_046581Add
BLAST
Alternative sequencei298 – 33134EELNP…ILYSI → DFGSLRSGANSWCQGCGGVH RCPSPWRRLLPRRL in isoform 13. 1 PublicationVSP_046582Add
BLAST
Alternative sequencei332 – 19431612Missing in isoform 13. 1 PublicationVSP_046583Add
BLAST
Alternative sequencei335 – 3395TPEDY → RARES in isoform 14. 1 PublicationVSP_046584
Alternative sequencei340 – 19431604Missing in isoform 14. 1 PublicationVSP_046585Add
BLAST
Alternative sequencei372 – 655284AEQDN…DPITY → VEPEKVKKPKVEIREPSEEE VVVTVEKPPAAEPTYPTWKR ARIFPMIFKKVRGLAEKRGI DLEGEEWRRRLDEEDKDYLQ LTLDQEEATESTVESEEESS DYTEYTETESEFSESETTEE SESETPSEEAEESSTPESEE SESTESEGEKARKNIVLARR RPVVEEIQEVKGKREEPPVE EEEEPPLEEEERAEEGEESE AAPMDESTDLEAQDVPEEGS AESVSMERGVESEESESELS SSSSTSESLSGGPWGFQVPE YDRRKDEEPKKSPGANSEGY NTAL in isoform 15. 1 PublicationVSP_046587Add
BLAST
Alternative sequencei440 – 4401D → DVPPGGVP in isoform 10 and isoform 12. 1 PublicationVSP_046588
Alternative sequencei441 – 961521Missing in isoform 23. 1 PublicationVSP_046589Add
BLAST
Alternative sequencei441 – 725285TKDPE…VFDPY → VEPEKVKKPKVEIREPSEEE VVVTVEKPPAAEPTYPTWKR ARIFPMIFKKVRGLAEKRGI DLEGEEWRRRLDEEDKDYLQ LTLDQEEATESTVESEEESS DYTEYTETESEFSESETTEE SESETPSEEAEESSTPESEE SESTESEGEKARKNIVLARR RPVVEEIQEVKGKREEPPVE EEEEPPLEEEERAEEGEESE AAPMDESTDLEAQDVPEEGS AESVSMERGVESEESESELS SSSSTSESLSGGPWGFQVPE YDRRKDEEPKKSPGANSEGY NTAL in isoform 16. 1 PublicationVSP_046590Add
BLAST
Alternative sequencei600 – 67172RHSIC…NLSET → S in isoform 5. 1 PublicationVSP_046591Add
BLAST
Alternative sequencei645 – 68945ATDRE…STDRY → HRDSQPREGSRPREHRPLHP HRHSLRWQTGWNLNCHCEHS GDGRQ in isoform 3. 1 PublicationVSP_046592Add
BLAST
Alternative sequencei656 – 19431288Missing in isoform 15. 1 PublicationVSP_046593Add
BLAST
Alternative sequencei690 – 19431254Missing in isoform 3. 1 PublicationVSP_046594Add
BLAST
Alternative sequencei703 – 986284TSTAT…SIFDV → VEPEKVKKPKVEIREPSEEE VVVTVEKPPAAEPTYPTWKR ARIFPMIFKKVRGLAEKRGI DLEGEEWRRRLDEEDKDYLQ LTLDQEEATESTVESEEESS DYTEYTETESEFSESETTEE SESETPSEEAEESSTPESEE SESTESEGEKARKNIVLARR RPVVEEIQEVKGKREEPPVE EEEEPPLEEEERAEEGEESE AAPMDESTDLEAQDVPEEGS AESVSMERGVESEESESELS SSSSTSESLSGGPWGFQVPE YDRRKDEEPKKSPGANSEGY NTAL in isoform 17. 1 PublicationVSP_046595Add
BLAST
Alternative sequencei726 – 19431218Missing in isoform 16. 1 PublicationVSP_046596Add
BLAST
Alternative sequencei987 – 1943957Missing in isoform 17. 1 PublicationVSP_046597Add
BLAST
Alternative sequencei1131 – 117646NTAKV…KATDR → LSVIPCSWRTQVSKSLGLEL GVPVSHSVESGTRTGSSTRA ASVPIH in isoform 21, isoform 22 and isoform 23. 2 PublicationsVSP_046598Add
BLAST
Alternative sequencei1177 – 1943767Missing in isoform 21, isoform 22 and isoform 23. 2 PublicationsVSP_046599Add
BLAST
Alternative sequencei1407 – 1667261FKVRQ…SSGSS → GGFAPEHQLLRPSLLKPEEL SMESGIDPGQEYGQDYYSYE HGYEMPQYGSRRRLLPPAGQ EEYGEVIGEAEEEYEEEEWA RKRMIKLVVDREYESSSPGE DSAPESQRSRTHKPSGRSNV NGNIYIAQNGSVVRTRRACV ADNLKVPSPGLLGRHLKKLD TLAGTREENVPLNTLFKGPF STEKAKRTPTLVTFAPCPVV AEHSAVKPSGTRLKHTAEQE SMVDSRLSRESMEFHGDSAP SDEEELWMGPWNSLHIPMTK L in isoform 20. 1 PublicationVSP_046600Add
BLAST
Alternative sequencei1407 – 14093Missing in isoform 6, isoform 7, isoform 9 and isoform 26. 2 PublicationsVSP_046601
Alternative sequencei1461 – 14633MHN → I in isoform 4, isoform 6 and isoform 7. 1 PublicationVSP_046602
Alternative sequencei1462 – 1943482HNLFL…QSTSL → YEMPQYGSRRRLLPPAGQEE YGEVIGEAEEEYEEEEVEPE KVKKPKVEIREPSEEEVVVT VEKPPAAEPTYPTWKRARIF PMIFKKVRGLAEKRGIDLEG EEWRRRLDEEDKDYLQLTLD QEEATESTVESEEESSDYTE YTETESEFSESETTEESESE TPSEEAEESSTPESEESEST ESEGEKARKNIVLARRRPVV EEIQEVKGKREEPPVEEEEE PPLEEEERAEEGEESEAAPM DESTDLEAQDVPEEGSAESV SMERGVESEESESELSSSSS TSESLSGGPWGFQVPEYDRR KDEEPKKSPGANSEGYNTAL in isoform 25. 1 PublicationVSP_046603Add
BLAST
Alternative sequencei1462 – 1943482HNLFL…QSTSL → YEMPQYGSRRRLLPPAGQEE YGEVIGEAEEEYEEEEWARK RMIKLVVDREYESSSPGEDS APESQRSRTHKPSGRSNVNG NIYIAQNGSVVRTRRACVAD NLKVPSPGLLGRHLKKLDTL AGTREENVPLNTLFKGPFST EKAKRTPTLVTFAPCPVVAE HSAVKPSGTRLKHTAEQESM VDSRLSRESMEFHGDSAPSD EEELWMGPWNSLHIPMTKL in isoform 26. 1 PublicationVSP_046604Add
BLAST
Alternative sequencei1463 – 1943481NLFLL…QSTSL → KYEMPQYGSRRRLLPPAGQE EYGEVIGEAEEEYEEEEVEP EKVKKPKVEIREPSEEEVVV TVEKPPAAEPTYPTWKRARI FPMIFKKVRGLAEKRGIDLE GEEWRRRLDEEDKDYLQLTL DQEEATESTVESEEESSDYT EYTETESEFSESETTEESES ETPSEEAEESSTPESEESES TESEGEKARKNIVLARRRPV VEEIQEVKGKREEPPVEEEE EPPLEEEERAEEGEESEAAP MDESTDLEAQDVPEEGSAES VSMERGVESEESESELSSSS STSESLSGGPWGFQVPEYDR RKDEEPKKSPGANSEGYNTA L in isoform 10. 1 PublicationVSP_046605Add
BLAST
Alternative sequencei1463 – 1682220NLFLL…STLPT → KYEMPQYGSRRRLLPPAGQE EYGEVIGEAEEEYEEEEWAR KRMIKLVVDREYESSSPGED SAPESQRSRTHKPSGRSNVN GNIYIAQNGSVVRTRRACVA DNLKVPSPGLLGRHLKKLDT LAGTREENVPLNTLFKGPFS TEKAKRTPTLVTFAPCPVVA EHSAVKPSGTRLKHTAEQES MVDSRLSRESMEFHGDSAPS DEEELWMGPWNSLHIPMTKL in isoform 18 and isoform 19. 1 PublicationVSP_046606Add
BLAST
Alternative sequencei1463 – 152361NLFLL…TFSFV → KSYPWNLGLILARNMDKIIT VMSMGMRCPSMEVAVDCCHL LDRRNTAKSLVKLKRNMKKK R in isoform 11 and isoform 12. 1 PublicationVSP_046607Add
BLAST
Alternative sequencei1464 – 147310Missing in isoform 24. 1 PublicationVSP_046608
Alternative sequencei1524 – 1943420Missing in isoform 11 and isoform 12. 1 PublicationVSP_046609Add
BLAST
Alternative sequencei1668 – 1943276Missing in isoform 20. 1 PublicationVSP_046610Add
BLAST
Alternative sequencei1683 – 1943261Missing in isoform 18 and isoform 19. 1 PublicationVSP_046611Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF281899 mRNA. Translation: AAG53891.1.
AY949849 mRNA. Translation: AAY24693.1.
DQ354396 mRNA. Translation: ABC79259.1.
DQ354397 mRNA. Translation: ABC79260.1.
DQ354398 mRNA. Translation: ABC79261.1.
DQ354399 mRNA. Translation: ABC79262.1.
DQ354400 mRNA. Translation: ABC79263.1.
DQ354401 mRNA. Translation: ABC79264.1.
DQ354402 mRNA. Translation: ABC79265.1.
DQ354403 mRNA. Translation: ABC79266.1.
DQ354404 mRNA. Translation: ABC79267.1.
DQ354405 mRNA. Translation: ABC79268.1.
DQ354406 mRNA. Translation: ABC79269.1.
DQ354407 mRNA. Translation: ABC79270.1. Different initiation.
DQ354408 mRNA. Translation: ABC79271.1.
DQ354409 mRNA. Translation: ABC79272.1.
DQ354410 mRNA. Translation: ABC79273.1.
DQ354411 mRNA. Translation: ABC79274.1.
DQ354412 mRNA. Translation: ABC79275.1.
DQ354413 mRNA. Translation: ABC79276.1.
DQ354414 mRNA. Translation: ABC79277.1.
DQ354415 mRNA. Translation: ABC79278.1.
DQ354416 mRNA. Translation: ABC79279.1.
DQ354417 mRNA. Translation: ABC79280.1.
DQ354418 mRNA. Translation: ABC79281.1.
AK139154 mRNA. Translation: BAE23903.1.
AK141024 mRNA. Translation: BAE24546.1.
AC108392 Genomic DNA. No translation available.
AC119894 Genomic DNA. No translation available.
AC121142 Genomic DNA. No translation available.
AC121602 Genomic DNA. No translation available.
AC121832 Genomic DNA. No translation available.
AC123032 Genomic DNA. No translation available.
AC123809 Genomic DNA. No translation available.
AC144802 Genomic DNA. No translation available.
AC147721 Genomic DNA. No translation available.
AC153858 Genomic DNA. No translation available.
AC158800 Genomic DNA. No translation available.
AC159477 Genomic DNA. No translation available.
AC186813 Genomic DNA. No translation available.
AC188091 Genomic DNA. No translation available.
CAAA01110489 Genomic DNA. No translation available.
HQ404375 mRNA. Translation: ADP09331.1.
HQ420254 mRNA. Translation: ADT91308.1.
CCDSiCCDS35934.1. [Q99PJ1-1]
CCDS48594.1. [Q99PJ1-6]
CCDS48595.1. [Q99PJ1-7]
CCDS56711.1. [Q99PJ1-10]
CCDS56712.1. [Q99PJ1-21]
CCDS56713.1. [Q99PJ1-18]
CCDS56714.1. [Q99PJ1-22]
CCDS56715.1. [Q99PJ1-2]
CCDS56716.1. [Q99PJ1-11]
CCDS56717.1. [Q99PJ1-19]
CCDS56718.1. [Q99PJ1-4]
CCDS56719.1. [Q99PJ1-5]
CCDS56720.1. [Q99PJ1-8]
CCDS56721.1. [Q99PJ1-9]
RefSeqiNP_001136207.1. NM_001142735.1. [Q99PJ1-2]
NP_001136208.1. NM_001142736.1. [Q99PJ1-4]
NP_001136209.1. NM_001142737.1. [Q99PJ1-5]
NP_001136210.1. NM_001142738.1. [Q99PJ1-7]
NP_001136211.1. NM_001142739.1. [Q99PJ1-8]
NP_001136212.1. NM_001142740.1. [Q99PJ1-6]
NP_001136213.1. NM_001142741.1. [Q99PJ1-9]
NP_001136214.1. NM_001142742.1. [Q99PJ1-10]
NP_001136215.1. NM_001142743.1. [Q99PJ1-11]
NP_001136218.1. NM_001142746.1. [Q99PJ1-18]
NP_001136219.1. NM_001142747.1. [Q99PJ1-21]
NP_001136220.1. NM_001142748.1. [Q99PJ1-22]
NP_001136232.1. NM_001142760.1. [Q99PJ1-19]
NP_075604.2. NM_023115.3. [Q99PJ1-1]
XP_006513206.1. XM_006513143.1. [Q99PJ1-1]
XP_006513207.1. XM_006513144.1. [Q99PJ1-1]
XP_006513208.1. XM_006513145.1. [Q99PJ1-1]
XP_006513209.1. XM_006513146.1. [Q99PJ1-1]
XP_006513210.1. XM_006513147.1. [Q99PJ1-1]
XP_006513213.1. XM_006513150.1. [Q99PJ1-2]
XP_006513219.1. XM_006513156.1. [Q99PJ1-26]
UniGeneiMm.338933.

Genome annotation databases

EnsembliENSMUST00000092420; ENSMUSP00000090076; ENSMUSG00000052613. [Q99PJ1-6]
ENSMUST00000105424; ENSMUSP00000101064; ENSMUSG00000052613. [Q99PJ1-2]
ENSMUST00000105426; ENSMUSP00000101066; ENSMUSG00000052613. [Q99PJ1-1]
ENSMUST00000105429; ENSMUSP00000101069; ENSMUSG00000052613. [Q99PJ1-5]
ENSMUST00000124046; ENSMUSP00000121130; ENSMUSG00000052613. [Q99PJ1-12]
ENSMUST00000125006; ENSMUSP00000120056; ENSMUSG00000052613. [Q99PJ1-22]
ENSMUST00000125055; ENSMUSP00000114326; ENSMUSG00000052613. [Q99PJ1-3]
ENSMUST00000125517; ENSMUSP00000115399; ENSMUSG00000052613. [Q99PJ1-16]
ENSMUST00000126920; ENSMUSP00000121939; ENSMUSG00000052613. [Q99PJ1-8]
ENSMUST00000129404; ENSMUSP00000117731; ENSMUSG00000052613. [Q99PJ1-9]
ENSMUST00000131321; ENSMUSP00000122911; ENSMUSG00000052613. [Q99PJ1-4]
ENSMUST00000131724; ENSMUSP00000122466; ENSMUSG00000052613. [Q99PJ1-11]
ENSMUST00000134009; ENSMUSP00000120618; ENSMUSG00000052613. [Q99PJ1-23]
ENSMUST00000136096; ENSMUSP00000121534; ENSMUSG00000052613. [Q99PJ1-3]
ENSMUST00000144302; ENSMUSP00000122606; ENSMUSG00000052613. [Q99PJ1-13]
ENSMUST00000146682; ENSMUSP00000134863; ENSMUSG00000052613. [Q99PJ1-20]
ENSMUST00000147189; ENSMUSP00000122940; ENSMUSG00000052613. [Q99PJ1-7]
ENSMUST00000149977; ENSMUSP00000118833; ENSMUSG00000052613. [Q99PJ1-19]
ENSMUST00000151116; ENSMUSP00000119662; ENSMUSG00000052613. [Q99PJ1-10]
ENSMUST00000152655; ENSMUSP00000118201; ENSMUSG00000052613. [Q99PJ1-17]
ENSMUST00000152819; ENSMUSP00000123647; ENSMUSG00000052613. [Q99PJ1-15]
ENSMUST00000155701; ENSMUSP00000135495; ENSMUSG00000052613. [Q99PJ1-14]
ENSMUST00000177107; ENSMUSP00000135501; ENSMUSG00000052613. [Q99PJ1-18]
ENSMUST00000177420; ENSMUSP00000135849; ENSMUSG00000052613. [Q99PJ1-21]
GeneIDi11994.
KEGGimmu:11994.
UCSCiuc007fpf.2. mouse.
uc007fpg.2. mouse.
uc007fpo.2. mouse.
uc007fpq.2. mouse.
uc011xfz.1. mouse.
uc011xgd.1. mouse.
uc011xge.1. mouse.
uc011xgf.1. mouse.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF281899 mRNA. Translation: AAG53891.1 .
AY949849 mRNA. Translation: AAY24693.1 .
DQ354396 mRNA. Translation: ABC79259.1 .
DQ354397 mRNA. Translation: ABC79260.1 .
DQ354398 mRNA. Translation: ABC79261.1 .
DQ354399 mRNA. Translation: ABC79262.1 .
DQ354400 mRNA. Translation: ABC79263.1 .
DQ354401 mRNA. Translation: ABC79264.1 .
DQ354402 mRNA. Translation: ABC79265.1 .
DQ354403 mRNA. Translation: ABC79266.1 .
DQ354404 mRNA. Translation: ABC79267.1 .
DQ354405 mRNA. Translation: ABC79268.1 .
DQ354406 mRNA. Translation: ABC79269.1 .
DQ354407 mRNA. Translation: ABC79270.1 . Different initiation.
DQ354408 mRNA. Translation: ABC79271.1 .
DQ354409 mRNA. Translation: ABC79272.1 .
DQ354410 mRNA. Translation: ABC79273.1 .
DQ354411 mRNA. Translation: ABC79274.1 .
DQ354412 mRNA. Translation: ABC79275.1 .
DQ354413 mRNA. Translation: ABC79276.1 .
DQ354414 mRNA. Translation: ABC79277.1 .
DQ354415 mRNA. Translation: ABC79278.1 .
DQ354416 mRNA. Translation: ABC79279.1 .
DQ354417 mRNA. Translation: ABC79280.1 .
DQ354418 mRNA. Translation: ABC79281.1 .
AK139154 mRNA. Translation: BAE23903.1 .
AK141024 mRNA. Translation: BAE24546.1 .
AC108392 Genomic DNA. No translation available.
AC119894 Genomic DNA. No translation available.
AC121142 Genomic DNA. No translation available.
AC121602 Genomic DNA. No translation available.
AC121832 Genomic DNA. No translation available.
AC123032 Genomic DNA. No translation available.
AC123809 Genomic DNA. No translation available.
AC144802 Genomic DNA. No translation available.
AC147721 Genomic DNA. No translation available.
AC153858 Genomic DNA. No translation available.
AC158800 Genomic DNA. No translation available.
AC159477 Genomic DNA. No translation available.
AC186813 Genomic DNA. No translation available.
AC188091 Genomic DNA. No translation available.
CAAA01110489 Genomic DNA. No translation available.
HQ404375 mRNA. Translation: ADP09331.1 .
HQ420254 mRNA. Translation: ADT91308.1 .
CCDSi CCDS35934.1. [Q99PJ1-1 ]
CCDS48594.1. [Q99PJ1-6 ]
CCDS48595.1. [Q99PJ1-7 ]
CCDS56711.1. [Q99PJ1-10 ]
CCDS56712.1. [Q99PJ1-21 ]
CCDS56713.1. [Q99PJ1-18 ]
CCDS56714.1. [Q99PJ1-22 ]
CCDS56715.1. [Q99PJ1-2 ]
CCDS56716.1. [Q99PJ1-11 ]
CCDS56717.1. [Q99PJ1-19 ]
CCDS56718.1. [Q99PJ1-4 ]
CCDS56719.1. [Q99PJ1-5 ]
CCDS56720.1. [Q99PJ1-8 ]
CCDS56721.1. [Q99PJ1-9 ]
RefSeqi NP_001136207.1. NM_001142735.1. [Q99PJ1-2 ]
NP_001136208.1. NM_001142736.1. [Q99PJ1-4 ]
NP_001136209.1. NM_001142737.1. [Q99PJ1-5 ]
NP_001136210.1. NM_001142738.1. [Q99PJ1-7 ]
NP_001136211.1. NM_001142739.1. [Q99PJ1-8 ]
NP_001136212.1. NM_001142740.1. [Q99PJ1-6 ]
NP_001136213.1. NM_001142741.1. [Q99PJ1-9 ]
NP_001136214.1. NM_001142742.1. [Q99PJ1-10 ]
NP_001136215.1. NM_001142743.1. [Q99PJ1-11 ]
NP_001136218.1. NM_001142746.1. [Q99PJ1-18 ]
NP_001136219.1. NM_001142747.1. [Q99PJ1-21 ]
NP_001136220.1. NM_001142748.1. [Q99PJ1-22 ]
NP_001136232.1. NM_001142760.1. [Q99PJ1-19 ]
NP_075604.2. NM_023115.3. [Q99PJ1-1 ]
XP_006513206.1. XM_006513143.1. [Q99PJ1-1 ]
XP_006513207.1. XM_006513144.1. [Q99PJ1-1 ]
XP_006513208.1. XM_006513145.1. [Q99PJ1-1 ]
XP_006513209.1. XM_006513146.1. [Q99PJ1-1 ]
XP_006513210.1. XM_006513147.1. [Q99PJ1-1 ]
XP_006513213.1. XM_006513150.1. [Q99PJ1-2 ]
XP_006513219.1. XM_006513156.1. [Q99PJ1-26 ]
UniGenei Mm.338933.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
4APX X-ray 1.65 B 27-259 [» ]
4AQ8 X-ray 2.63 C/D 27-259 [» ]
4AQA X-ray 1.96 B 27-259 [» ]
4AQE X-ray 2.27 B 27-259 [» ]
4AXW X-ray 2.23 B 27-259 [» ]
ProteinModelPortali Q99PJ1.
SMRi Q99PJ1. Positions 27-260.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 198282. 3 interactions.
DIPi DIP-42151N.
IntActi Q99PJ1. 2 interactions.
MINTi MINT-1895732.
STRINGi 10090.ENSMUSP00000101066.

PTM databases

PhosphoSitei Q99PJ1.

Proteomic databases

PRIDEi Q99PJ1.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000092420 ; ENSMUSP00000090076 ; ENSMUSG00000052613 . [Q99PJ1-6 ]
ENSMUST00000105424 ; ENSMUSP00000101064 ; ENSMUSG00000052613 . [Q99PJ1-2 ]
ENSMUST00000105426 ; ENSMUSP00000101066 ; ENSMUSG00000052613 . [Q99PJ1-1 ]
ENSMUST00000105429 ; ENSMUSP00000101069 ; ENSMUSG00000052613 . [Q99PJ1-5 ]
ENSMUST00000124046 ; ENSMUSP00000121130 ; ENSMUSG00000052613 . [Q99PJ1-12 ]
ENSMUST00000125006 ; ENSMUSP00000120056 ; ENSMUSG00000052613 . [Q99PJ1-22 ]
ENSMUST00000125055 ; ENSMUSP00000114326 ; ENSMUSG00000052613 . [Q99PJ1-3 ]
ENSMUST00000125517 ; ENSMUSP00000115399 ; ENSMUSG00000052613 . [Q99PJ1-16 ]
ENSMUST00000126920 ; ENSMUSP00000121939 ; ENSMUSG00000052613 . [Q99PJ1-8 ]
ENSMUST00000129404 ; ENSMUSP00000117731 ; ENSMUSG00000052613 . [Q99PJ1-9 ]
ENSMUST00000131321 ; ENSMUSP00000122911 ; ENSMUSG00000052613 . [Q99PJ1-4 ]
ENSMUST00000131724 ; ENSMUSP00000122466 ; ENSMUSG00000052613 . [Q99PJ1-11 ]
ENSMUST00000134009 ; ENSMUSP00000120618 ; ENSMUSG00000052613 . [Q99PJ1-23 ]
ENSMUST00000136096 ; ENSMUSP00000121534 ; ENSMUSG00000052613 . [Q99PJ1-3 ]
ENSMUST00000144302 ; ENSMUSP00000122606 ; ENSMUSG00000052613 . [Q99PJ1-13 ]
ENSMUST00000146682 ; ENSMUSP00000134863 ; ENSMUSG00000052613 . [Q99PJ1-20 ]
ENSMUST00000147189 ; ENSMUSP00000122940 ; ENSMUSG00000052613 . [Q99PJ1-7 ]
ENSMUST00000149977 ; ENSMUSP00000118833 ; ENSMUSG00000052613 . [Q99PJ1-19 ]
ENSMUST00000151116 ; ENSMUSP00000119662 ; ENSMUSG00000052613 . [Q99PJ1-10 ]
ENSMUST00000152655 ; ENSMUSP00000118201 ; ENSMUSG00000052613 . [Q99PJ1-17 ]
ENSMUST00000152819 ; ENSMUSP00000123647 ; ENSMUSG00000052613 . [Q99PJ1-15 ]
ENSMUST00000155701 ; ENSMUSP00000135495 ; ENSMUSG00000052613 . [Q99PJ1-14 ]
ENSMUST00000177107 ; ENSMUSP00000135501 ; ENSMUSG00000052613 . [Q99PJ1-18 ]
ENSMUST00000177420 ; ENSMUSP00000135849 ; ENSMUSG00000052613 . [Q99PJ1-21 ]
GeneIDi 11994.
KEGGi mmu:11994.
UCSCi uc007fpf.2. mouse.
uc007fpg.2. mouse.
uc007fpo.2. mouse.
uc007fpq.2. mouse.
uc011xfz.1. mouse.
uc011xgd.1. mouse.
uc011xge.1. mouse.
uc011xgf.1. mouse.

Organism-specific databases

CTDi 65217.
MGIi MGI:1891428. Pcdh15.

Phylogenomic databases

eggNOGi NOG253862.
GeneTreei ENSGT00760000118805.
HOGENOMi HOG000230919.
HOVERGENi HBG053521.
InParanoidi Q99PJ1.
KOi K16500.
OMAi CESARCH.
OrthoDBi EOG7ZWD0W.
TreeFami TF326779.

Miscellaneous databases

NextBioi 280177.
PROi Q99PJ1.
SOURCEi Search...

Gene expression databases

CleanExi MM_PCDH15.
ExpressionAtlasi Q99PJ1. baseline and differential.
Genevestigatori Q99PJ1.

Family and domain databases

Gene3Di 2.60.40.60. 10 hits.
InterProi IPR002126. Cadherin.
IPR015919. Cadherin-like.
IPR020894. Cadherin_CS.
[Graphical view ]
Pfami PF00028. Cadherin. 8 hits.
[Graphical view ]
PRINTSi PR00205. CADHERIN.
SMARTi SM00112. CA. 11 hits.
[Graphical view ]
SUPFAMi SSF49313. SSF49313. 10 hits.
PROSITEi PS00232. CADHERIN_1. 4 hits.
PS50268. CADHERIN_2. 11 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "The mouse Ames waltzer hearing-loss mutant is caused by mutation of Pcdh15, a novel protocadherin gene."
    Alagramam K.N., Murcia C.L., Kwon H.Y., Pawlowski K.S., Wright C.G., Woychik R.P.
    Nat. Genet. 27:99-102(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  2. "Ames Waltzer deaf mice have reduced electroretinogram amplitudes and complex alternative splicing of Pcdh15 transcripts."
    Haywood-Watson R.J. II, Ahmed Z.M., Kjellstrom S., Bush R.A., Takada Y., Hampton L.L., Battey J.F., Sieving P.A., Friedman T.B.
    Invest. Ophthalmol. Vis. Sci. 47:3074-3084(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 24), TISSUE SPECIFICITY.
    Tissue: Retina.
  3. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2; 3; 4; 5; 6; 7; 8; 9; 10; 11; 12; 13; 14; 15; 16; 17; 18; 19; 20; 21; 22 AND 23), DEVELOPMENTAL STAGE.
    Strain: C57BL/6J.
    Tissue: Inner ear.
  4. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 21), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1763-1943 (ISOFORMS 1/2/4/5/6/7/8/9).
    Strain: C57BL/6J.
    Tissue: Cerebellum.
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: C57BL/6J.
  6. "Usher type 1G protein sans is a critical component of the tip-link complex, a structure controlling actin polymerization in stereocilia."
    Caberlotto E., Michel V., Foucher I., Bahloul A., Goodyear R.J., Pepermans E., Michalski N., Perfettini I., Alegria-Prevot O., Chardenoux S., Do Cruzeiro M., Hardelin J.P., Richardson G.P., Avan P., Weil D., Petit C.
    Proc. Natl. Acad. Sci. U.S.A. 108:5825-5830(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1368-1943 (ISOFORMS 25 AND 26), INTERACTION WITH USH1G, SUBCELLULAR LOCATION.
    Strain: Swiss.
    Tissue: Cochlea.
  7. Lubec G., Kang S.U.
    Submitted (APR-2007) to UniProtKB
    Cited for: PROTEIN SEQUENCE OF 1876-1882, IDENTIFICATION BY MASS SPECTROMETRY.
    Strain: C57BL/6.
    Tissue: Brain.
  8. "Expression of Pcdh15 in the inner ear, nervous system and various epithelia of the developing embryo."
    Murcia C.L., Woychik R.P.
    Mech. Dev. 105:163-166(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: TISSUE SPECIFICITY.
  9. "Physical and functional interaction between protocadherin 15 and myosin VIIa in mechanosensory hair cells."
    Senften M., Schwander M., Kazmierczak P., Lillo C., Shin J.B., Hasson T., Geleoc G.S., Gillespie P.G., Williams D., Holt J.R., Muller U.
    J. Neurosci. 26:2060-2071(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH MYO7A, TISSUE SPECIFICITY.
  10. "Cadherin 23 and protocadherin 15 interact to form tip-link filaments in sensory hair cells."
    Kazmierczak P., Sakaguchi H., Tokita J., Wilson-Kubalek E.M., Milligan R.A., Muller U., Kachar B.
    Nature 449:87-91(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH CDH23, TISSUE SPECIFICITY.
  11. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Liver.
  12. "TMHS is an integral component of the mechanotransduction machinery of cochlear hair cells."
    Xiong W., Grillet N., Elledge H.M., Wagner T.F., Zhao B., Johnson K.R., Kazmierczak P., Muller U.
    Cell 151:1283-1295(2012) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUBCELLULAR LOCATION, INTERACTION WITH LHFPL5.
  13. "Structure of a force-conveying cadherin bond essential for inner-ear mechanotransduction."
    Sotomayor M., Weihofen W.A., Gaudet R., Corey D.P.
    Nature 492:128-132(2012) [PubMed] [Europe PMC] [Abstract]
    Cited for: X-RAY CRYSTALLOGRAPHY (1.65 ANGSTROMS) OF 27-259 IN COMPLEX WITH CALCIUM IONS AND CDH23, SUBUNIT, DISULFIDE BOND, MUTAGENESIS OF ILE-48 AND ARG-139.

Entry informationi

Entry nameiPCD15_MOUSE
AccessioniPrimary (citable) accession number: Q99PJ1
Secondary accession number(s): D6RCH0
, E9Q7D7, E9Q7R1, E9Q7R2, F6KJX4, F6KKG6, F6R5Z7, F6RBV2, F6U3Q6, F6UPC9, F6VPR3, F6WUN7, F6X715, F6XPA1, F6Y0A5, F6YP25, F6YZQ9, F7ASH0, F7CIN1, F7D5J8, F7DFU0, F8VQ61, H3BKS0, Q0ZM15, Q0ZM16, Q0ZM18, Q0ZM19, Q0ZM20, Q0ZM21, Q0ZM22, Q0ZM23, Q0ZM24, Q0ZM25, Q0ZM26, Q0ZM27, Q0ZM28, Q0ZM29, Q0ZM30, Q0ZM31, Q0ZM32, Q0ZM33, Q0ZM34, Q0ZM35, Q0ZM37, Q2VQG7, Q3URZ1, Q3UTS7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 31, 2002
Last sequence update: June 26, 2013
Last modified: October 29, 2014
This is version 116 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3