Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protocadherin-15

Gene

Pcdh15

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Calcium-dependent cell-adhesion protein. Required for inner ear neuroepithelial cell elaboration and cochlear function. Probably involved in the maintenance of normal retinal function.

GO - Molecular functioni

GO - Biological processi

  • actin filament bundle assembly Source: MGI
  • actin filament organization Source: MGI
  • adult walking behavior Source: MGI
  • auditory receptor cell differentiation Source: MGI
  • auditory receptor cell stereocilium organization Source: MGI
  • detection of mechanical stimulus involved in equilibrioception Source: MGI
  • detection of mechanical stimulus involved in sensory perception of sound Source: MGI
  • equilibrioception Source: MGI
  • homophilic cell adhesion via plasma membrane adhesion molecules Source: InterPro
  • inner ear development Source: MGI
  • inner ear receptor stereocilium organization Source: MGI
  • locomotory behavior Source: MGI
  • morphogenesis of an epithelium Source: MGI
  • multicellular organism growth Source: MGI
  • non-motile cilium assembly Source: MGI
  • photoreceptor cell maintenance Source: MGI
  • response to calcium ion Source: Ensembl
  • righting reflex Source: MGI
  • sensory perception of light stimulus Source: MGI
  • sensory perception of sound Source: MGI
  • startle response Source: MGI
  • visual perception Source: MGI
Complete GO annotation...

Keywords - Biological processi

Cell adhesion, Hearing

Keywords - Ligandi

Calcium

Names & Taxonomyi

Protein namesi
Recommended name:
Protocadherin-15
Gene namesi
Name:Pcdh15
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 10

Organism-specific databases

MGIiMGI:1891428. Pcdh15.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini27 – 1381ExtracellularSequence analysisAdd BLAST1355
Transmembranei1382 – 1402HelicalSequence analysisAdd BLAST21
Topological domaini1403 – 1943CytoplasmicSequence analysisAdd BLAST541

GO - Cellular componenti

  • cytoplasm Source: MGI
  • extracellular exosome Source: MGI
  • integral component of membrane Source: MGI
  • photoreceptor outer segment Source: MGI
  • plasma membrane Source: MGI
  • stereocilium Source: HGNC
  • stereocilium bundle Source: MGI
  • synapse Source: MGI
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane, Secreted

Pathology & Biotechi

Involvement in diseasei

Defects in Pcdh15 are the cause of the Ames waltzer (av) phenotype. It is characterized by deafness and a balance disorder, associated with the degeneration of inner ear neuroepithelia.

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi48I → A: Strongly reduced interaction with CDH23. 1 Publication1
Mutagenesisi139R → G: Impaired interaction with CDH23. 1 Publication1

Keywords - Diseasei

Deafness

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 26Sequence analysisAdd BLAST26
ChainiPRO_000000399927 – 1943Protocadherin-15Add BLAST1917

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi37 ↔ 1251 Publication
Glycosylationi57N-linked (GlcNAc...)Sequence analysis1
Glycosylationi102N-linked (GlcNAc...)Sequence analysis1
Glycosylationi206N-linked (GlcNAc...)Sequence analysis1
Glycosylationi424N-linked (GlcNAc...)Sequence analysis1
Glycosylationi564N-linked (GlcNAc...)Sequence analysis1
Glycosylationi667N-linked (GlcNAc...)Sequence analysis1
Glycosylationi729N-linked (GlcNAc...)Sequence analysis1
Glycosylationi773N-linked (GlcNAc...)Sequence analysis1
Glycosylationi826N-linked (GlcNAc...)Sequence analysis1
Glycosylationi856N-linked (GlcNAc...)Sequence analysis1
Glycosylationi1069N-linked (GlcNAc...)Sequence analysis1
Glycosylationi1089N-linked (GlcNAc...)Sequence analysis1
Glycosylationi1180N-linked (GlcNAc...)Sequence analysis1

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiQ99PJ1.
PRIDEiQ99PJ1.

PTM databases

iPTMnetiQ99PJ1.
PhosphoSitePlusiQ99PJ1.

Expressioni

Tissue specificityi

Expressed in brain and sensory epithelium of the developing inner ear. Expressed in the retina, in the photoreceptor inner segments, the outer plexiform layer, the inner nuclei layer and the ganglion cell layer and, more diffusely in the inner plexiform layer (at protein level). Not detected in the retinal pigment epithelium (at protein level). Expressed in the spleen, dorsal root ganglion, dorsal aspect of neural tube, floor plate and ependymal cells adjacent to the neural canal.4 Publications

Developmental stagei

Highest level of expression is detected at embryonic day 16. Alternative splicing isoforms have different spatiotemporal expression patterns. In cochlear cultures at the equivalent of postnatal day 3, isoforms belonging to the CD1 (isoforms 1 through 9) and CD3 (isoforms 18 through 20) groups are highly expressed in hair bundles in the basal coils and moderately in those in the middle of the apical coil; they are hardly detectable in those at the apical end of the apical coil (at protein level). At the base of the cultured cochlea, in the more mature hair bundles, CD3 group isoforms are restricted to the tips of the shorter stereocilia in both inner and outer hair cells. By contrast, at the same stage, isoforms belonging to the CD2 group (isoforms 10 through 17) are highly expressed in hair bundles in the apex of the cochlea and, at lower levels, in those in the middle of the apical coil; they are hardly detectable at the base of the cochlea (at protein level). In mature hair bundles, CD1 group isoforms are distributed fairly evenly along most of the length of the stereocilia on auditory hair cells, whereas they are concentrated toward the upper third of the hair bundle in vestibular hair cells. In both the auditory and the vestibular organs, these isoforms are excluded from a region at the very tip of each stereocilium (at protein level). In contrast, CD2 group isoforms are undetectable in adult cochlear hair cells (at protein level). These isoforms are expressed in the entire hair bundle of the immature cells in the sensory epithelium of the early postnatal vestibule and only in the kinocilium in the more mature hair bundles (at protein level). CD3 group isoforms are detected in immature vestibular hair bundles, concentrated toward the tip of each stereocilium, as early as 15.5 dpc. They also localize to the tips of the shorter stereocilia in the mature vestibular hair bundles and are not detected at the tips of the stereocilia in the tallest row (at protein level).1 Publication

Gene expression databases

BgeeiENSMUSG00000052613.
CleanExiMM_PCDH15.
ExpressionAtlasiQ99PJ1. baseline and differential.
GenevisibleiQ99PJ1. MM.

Interactioni

Subunit structurei

Antiparallel heterodimer with CDH23 (PubMed:23135401, PubMed:17805295). Found in a complex with TMIE and LHFPL5 (PubMed:25467981). Interacts with LHFPL5/TMHS; this interaction is required for efficient localization to hair bundles (PubMed:23217710). Interacts with MYO7A (PubMed:16481439). Interacts with USH1G; this interaction may recruit USH1G to the plasma membrane (PubMed:21436032).6 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
Ush1cQ9ES643EBI-6556746,EBI-7418968
Ush1cQ9ES64-32EBI-6556746,EBI-7418919

Protein-protein interaction databases

BioGridi198282. 3 interactors.
DIPiDIP-42151N.
IntActiQ99PJ1. 2 interactors.
MINTiMINT-1895732.
STRINGi10090.ENSMUSP00000101066.

Structurei

Secondary structure

11943
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Turni27 – 30Combined sources4
Helixi31 – 34Combined sources4
Beta strandi38 – 41Combined sources4
Beta strandi45 – 52Combined sources8
Beta strandi60 – 63Combined sources4
Beta strandi67 – 69Combined sources3
Beta strandi71 – 75Combined sources5
Beta strandi77 – 84Combined sources8
Helixi86 – 88Combined sources3
Beta strandi90 – 93Combined sources4
Turni94 – 97Combined sources4
Beta strandi98 – 101Combined sources4
Turni112 – 114Combined sources3
Beta strandi118 – 127Combined sources10
Turni128 – 130Combined sources3
Beta strandi133 – 143Combined sources11
Beta strandi151 – 155Combined sources5
Beta strandi157 – 162Combined sources6
Beta strandi170 – 172Combined sources3
Turni174 – 179Combined sources6
Beta strandi180 – 182Combined sources3
Beta strandi184 – 186Combined sources3
Helixi187 – 190Combined sources4
Beta strandi192 – 197Combined sources6
Helixi205 – 208Combined sources4
Turni214 – 216Combined sources3
Beta strandi219 – 221Combined sources3
Turni227 – 229Combined sources3
Beta strandi232 – 241Combined sources10
Helixi246 – 248Combined sources3
Beta strandi251 – 259Combined sources9

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4APXX-ray1.65B27-259[»]
4AQ8X-ray2.63C/D27-259[»]
4AQAX-ray1.96B27-259[»]
4AQEX-ray2.27B27-259[»]
4AXWX-ray2.23B27-259[»]
4XXWX-ray2.26A/B36-259[»]
ProteinModelPortaliQ99PJ1.
SMRiQ99PJ1.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini45 – 152Cadherin 1PROSITE-ProRule annotationAdd BLAST108
Domaini153 – 270Cadherin 2PROSITE-ProRule annotationAdd BLAST118
Domaini283 – 400Cadherin 3PROSITE-ProRule annotationAdd BLAST118
Domaini401 – 514Cadherin 4PROSITE-ProRule annotationAdd BLAST114
Domaini515 – 621Cadherin 5PROSITE-ProRule annotationAdd BLAST107
Domaini622 – 722Cadherin 6PROSITE-ProRule annotationAdd BLAST101
Domaini724 – 824Cadherin 7PROSITE-ProRule annotationAdd BLAST101
Domaini825 – 931Cadherin 8PROSITE-ProRule annotationAdd BLAST107
Domaini932 – 1040Cadherin 9PROSITE-ProRule annotationAdd BLAST109
Domaini1042 – 1149Cadherin 10PROSITE-ProRule annotationAdd BLAST108
Domaini1150 – 1264Cadherin 11PROSITE-ProRule annotationAdd BLAST115

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi1437 – 1448Poly-ProAdd BLAST12
Compositional biasi1772 – 1778Poly-Pro7
Compositional biasi1804 – 1812Poly-Pro9

Domaini

Cadherin repeats 1 and 2 mediate calcium-dependent heterophilic interaction with CDH23.1 Publication
Three calcium ions are usually bound at the interface of each cadherin domain and rigidify the connections, imparting a strong curvature to the full-length ectodomain.1 Publication

Sequence similaritiesi

Contains 11 cadherin domains.PROSITE-ProRule annotation

Keywords - Domaini

Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG3594. Eukaryota.
ENOG410XQHI. LUCA.
GeneTreeiENSGT00850000132356.
HOGENOMiHOG000186027.
HOVERGENiHBG053521.
InParanoidiQ99PJ1.
KOiK16500.
OrthoDBiEOG091G0MMW.
TreeFamiTF326779.

Family and domain databases

Gene3Di2.60.40.60. 10 hits.
InterProiIPR002126. Cadherin.
IPR015919. Cadherin-like.
IPR020894. Cadherin_CS.
IPR030718. Protocadherin-15.
[Graphical view]
PANTHERiPTHR24028:SF11. PTHR24028:SF11. 3 hits.
PfamiPF00028. Cadherin. 8 hits.
[Graphical view]
PRINTSiPR00205. CADHERIN.
SMARTiSM00112. CA. 11 hits.
[Graphical view]
SUPFAMiSSF49313. SSF49313. 10 hits.
PROSITEiPS00232. CADHERIN_1. 4 hits.
PS50268. CADHERIN_2. 11 hits.
[Graphical view]

Sequences (26)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 26 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q99PJ1-1) [UniParc]FASTAAdd to basket
Also known as: CD1-1

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MFLQFAVWKC LPHGILIASL LVVSWGQYDD DWQYEDCKLA RGGPPATIVA
60 70 80 90 100
IDEESRNGTI LVDNMLIKGT AGGPDPTIEL SLKDNVDYWV LLDPVKQMLF
110 120 130 140 150
LNSTGRVLDR DPPMNIHSIV VQVQCVNKKV GTVIYHEVRI VVRDRNDNSP
160 170 180 190 200
TFKHESYYAT VNELTPVGTT IFTGFSGDNG ATDIDDGPNG QIEYVIQYNP
210 220 230 240 250
EDPTSNDTFE IPLMLTGNVV LRKRLNYEDK TRYYVIIQAN DRAQNLNERR
260 270 280 290 300
TTTTTLTVDV LDGDDLGPMF LPCVLVPNTR DCRPLTYQAA IPELRTPEEL
310 320 330 340 350
NPILVTPPIQ AIDQDRNIQP PSDRPGILYS ILVGTPEDYP RFFHMHPRTA
360 370 380 390 400
ELTLLEPVNR DFHQKFDLVI KAEQDNGHPL PAFASLHIEI LDENNQSPYF
410 420 430 440 450
TMPSYQGYIL ESAPVGATIS ESLNLTTPLR IVALDKDIED TKDPELHLFL
460 470 480 490 500
NDYTSVFTVT PTGITRYLTL LQPVDREEQQ TYTFLITAFD GVQESEPVVV
510 520 530 540 550
NIRVMDANDN TPTFPEISYD VYVYTDMSPG DSVIQLTAVD ADEGSNGEIS
560 570 580 590 600
YEILVGGKGD FVINKTTGLV SIAPGVELIV GQTYALTVQA SDNAPPAERR
610 620 630 640 650
HSICTVYIEV LPPNNQSPPR FPQLMYSLEV SEAMRIGAIL LNLQATDREG
660 670 680 690 700
DPITYAIENG DPQRVFNLSE TTGILSLGKA LDRESTDRYI LIVTASDGRP
710 720 730 740 750
DGTSTATVNI VVTDVNDNAP VFDPYLPRNL SVVEEEANAF VGQVRATDPD
760 770 780 790 800
AGINGQVHYS LGNFNNLFRI TSNGSIYTAV KLNREARDHY ELVVVATDGA
810 820 830 840 850
VHPRHSTLTL YIKVLDIDDN SPVFTNSTYT VVVEENLPAG TSFLQIEAKD
860 870 880 890 900
VDLGANVSYR IRSPEVKHLF ALHPFTGELS LLRSLDYEAF PDQEASITFL
910 920 930 940 950
VEAFDIYGTM PPGIATVTVI VKDMNDYPPV FSKRIYKGMV APDAVKGTPI
960 970 980 990 1000
TTVYAEDADP PGMPASRVRY RVDDVQFPYP ASIFDVEEDS GRVVTRVNLN
1010 1020 1030 1040 1050
EEPTTIFKLV VVAFDDGEPV MSSSATVRIL VLHPGEIPRF TQEEYRPPPV
1060 1070 1080 1090 1100
SELAARGTVV GVISAAAINQ SIVYSIVAGN EEDKFGINNV TGVIYVNSPL
1110 1120 1130 1140 1150
DYETRTSYVL RVQADSLEVV LANLRVPSKS NTAKVYIEIQ DENDHPPVFQ
1160 1170 1180 1190 1200
KKFYIGGVSE DARMFASVLR VKATDRDTGN YSAMAYRLII PPIKEGKEGF
1210 1220 1230 1240 1250
VVETYTGLIK TAMLFHNMRR SYFKFQVIAT DDYGKGLSGK ADVLVSVVNQ
1260 1270 1280 1290 1300
LDMQVIVSNV PPTLVEKKIE DLTEILDRYV QEQIPGAKVV VESIGARRHG
1310 1320 1330 1340 1350
DAYSLEDYSK CDLTVYAIDP QTNRAIDRNE LFKFLDGKLL DINKDFQPYY
1360 1370 1380 1390 1400
GEGGRILEIR TPEAVTSIKK RGESLGYTEG ALLALAFIII LCCIPAILVV
1410 1420 1430 1440 1450
LVSYRQFKVR QAECTKTARI QSAMPAAKPA APVPAAPAPP PPPPPPPPGA
1460 1470 1480 1490 1500
HLYEELGESA MHNLFLLYHF EQSRGNNSVP EDRSSHRDGM AFSSSTTESH
1510 1520 1530 1540 1550
EPAHVEGPLK ESQPNPARTF SFVPDEDNLS THNPLYMESI GQRSTNSDLQ
1560 1570 1580 1590 1600
PRTDFEELLA PRTQVKSQSL RGPREKIQRV WNQSVSFPRR LMWKAPNRPE
1610 1620 1630 1640 1650
TIDLVEWQIT NQRAECESAR CHPSQRGSSN VLLATEDAHE SEKEGGHRDT
1660 1670 1680 1690 1700
LIVQQTEQLK SLSSGSSFSS SWSHFSFSTL PTISRAVELG SEPNVVTSPA
1710 1720 1730 1740 1750
DCTLELSPPL RPRILNSLSS KRETPTCASD TEPKRNSFEI APHPPSISAP
1760 1770 1780 1790 1800
LPHPPLPRPP IAFTTFPLPL SPPNPPPPQL VTFSLPISTP PTSSLPLPPP
1810 1820 1830 1840 1850
LSLPPPPRPP APRLFPQPPS TSIPSTDSIS APAAKCTASA THARETTSTT
1860 1870 1880 1890 1900
QPPASNPQWG AEPHRHPKGI LRHVKNLAEL EKSVSNMYSH IEKNCPPADP
1910 1920 1930 1940
SKLHTFCPAE KTGMKITHDQ SQETLVRVVE GIDVQPHSQS TSL
Length:1,943
Mass (Da):214,738
Last modified:June 26, 2013 - v3
Checksum:i6FD6836082655855
GO
Isoform 2 (identifier: Q99PJ1-2) [UniParc]FASTAAdd to basket
Also known as: CD1-2

The sequence of this isoform differs from the canonical sequence as follows:
     31-35: Missing.

Show »
Length:1,938
Mass (Da):214,016
Checksum:i40B0EB13DF4E5EFC
GO
Isoform 3 (identifier: Q99PJ1-3) [UniParc]FASTAAdd to basket
Also known as: CD1-3/5

The sequence of this isoform differs from the canonical sequence as follows:
     31-35: Missing.
     645-689: ATDREGDPIT...ALDRESTDRY → HRDSQPREGS...HCEHSGDGRQ
     690-1943: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:684
Mass (Da):76,656
Checksum:i9042A0B5CB766F1F
GO
Isoform 4 (identifier: Q99PJ1-4) [UniParc]FASTAAdd to basket
Also known as: CD1-4

The sequence of this isoform differs from the canonical sequence as follows:
     31-35: Missing.
     1461-1463: MHN → I

Show »
Length:1,936
Mass (Da):213,747
Checksum:i3740C7F23545D42B
GO
Isoform 5 (identifier: Q99PJ1-5) [UniParc]FASTAAdd to basket
Also known as: CD1-6

The sequence of this isoform differs from the canonical sequence as follows:
     31-35: Missing.
     600-671: RHSICTVYIEVLPPNNQSPPRFPQLMYSLEVSEAMRIGAILLNLQATDREGDPITYAIENGDPQRVFNLSET → S

Show »
Length:1,867
Mass (Da):205,990
Checksum:iEC9AFA9363BE7757
GO
Isoform 6 (identifier: Q99PJ1-6) [UniParc]FASTAAdd to basket
Also known as: CD1-7

The sequence of this isoform differs from the canonical sequence as follows:
     31-35: Missing.
     1407-1409: Missing.
     1461-1463: MHN → I

Show »
Length:1,933
Mass (Da):213,372
Checksum:iC708CC475A755E15
GO
Isoform 7 (identifier: Q99PJ1-7) [UniParc]FASTAAdd to basket
Also known as: CD1-8

The sequence of this isoform differs from the canonical sequence as follows:
     31-35: Missing.
     204-240: Missing.
     1407-1409: Missing.
     1461-1463: MHN → I

Show »
Length:1,896
Mass (Da):209,000
Checksum:iCAA46E2AA740CA6A
GO
Isoform 8 (identifier: Q99PJ1-8) [UniParc]FASTAAdd to basket
Also known as: CD1-9

The sequence of this isoform differs from the canonical sequence as follows:
     31-57: Missing.

Show »
Length:1,916
Mass (Da):211,721
Checksum:iA416619EE89EABC8
GO
Isoform 9 (identifier: Q99PJ1-9) [UniParc]FASTAAdd to basket
Also known as: CD1-10

The sequence of this isoform differs from the canonical sequence as follows:
     31-57: Missing.
     1407-1409: Missing.

Show »
Length:1,913
Mass (Da):211,347
Checksum:iFB42EBAEE0565806
GO
Isoform 10 (identifier: Q99PJ1-10) [UniParc]FASTAAdd to basket
Also known as: CD2-1

The sequence of this isoform differs from the canonical sequence as follows:
     440-440: D → DVPPGGVP
     1463-1943: NLFLLYHFEQ...VQPHSQSTSL → KYEMPQYGSR...ANSEGYNTAL

Show »
Length:1,790
Mass (Da):198,941
Checksum:i5731151E416F5119
GO
Isoform 11 (identifier: Q99PJ1-11) [UniParc]FASTAAdd to basket
Also known as: CD2-2

The sequence of this isoform differs from the canonical sequence as follows:
     31-35: Missing.
     1463-1523: NLFLLYHFEQ...PNPARTFSFV → KSYPWNLGLI...KLKRNMKKKR
     1524-1943: Missing.

Show »
Length:1,518
Mass (Da):168,209
Checksum:i31FC7C15E9D26B80
GO
Isoform 12 (identifier: Q99PJ1-12) [UniParc]FASTAAdd to basket
Also known as: CD2-3

The sequence of this isoform differs from the canonical sequence as follows:
     1-401: Missing.
     440-440: D → DVPPGGVP
     1463-1523: NLFLLYHFEQ...PNPARTFSFV → KSYPWNLGLI...KLKRNMKKKR
     1524-1943: Missing.

Show »
Length:1,129
Mass (Da):124,249
Checksum:i1B8BAD179452BA79
GO
Isoform 13 (identifier: Q99PJ1-13) [UniParc]FASTAAdd to basket
Also known as: CD2-4

The sequence of this isoform differs from the canonical sequence as follows:
     31-35: Missing.
     298-331: EELNPILVTPPIQAIDQDRNIQPPSDRPGILYSI → DFGSLRSGANSWCQGCGGVHRCPSPWRRLLPRRL
     332-1943: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:326
Mass (Da):36,453
Checksum:iFA6863C72C1324C2
GO
Isoform 14 (identifier: Q99PJ1-14) [UniParc]FASTAAdd to basket
Also known as: CD2-5

The sequence of this isoform differs from the canonical sequence as follows:
     31-35: Missing.
     335-339: TPEDY → RARES
     340-1943: Missing.

Show »
Length:334
Mass (Da):37,309
Checksum:i8A4A6FECF06B3883
GO
Isoform 15 (identifier: Q99PJ1-15) [UniParc]FASTAAdd to basket
Also known as: CD2-6

The sequence of this isoform differs from the canonical sequence as follows:
     31-35: Missing.
     372-655: AEQDNGHPLP...TDREGDPITY → VEPEKVKKPK...ANSEGYNTAL
     656-1943: Missing.

Show »
Length:650
Mass (Da):73,340
Checksum:i0E288A38E5D417FF
GO
Isoform 16 (identifier: Q99PJ1-16) [UniParc]FASTAAdd to basket
Also known as: CD2-7

The sequence of this isoform differs from the canonical sequence as follows:
     31-35: Missing.
     441-725: TKDPELHLFL...NDNAPVFDPY → VEPEKVKKPK...ANSEGYNTAL
     726-1943: Missing.

Show »
Length:719
Mass (Da):80,894
Checksum:iFFC3D62480CD3DED
GO
Isoform 17 (identifier: Q99PJ1-17) [UniParc]FASTAAdd to basket
Also known as: CD2-8

The sequence of this isoform differs from the canonical sequence as follows:
     31-35: Missing.
     703-986: TSTATVNIVV...FPYPASIFDV → VEPEKVKKPK...ANSEGYNTAL
     987-1943: Missing.

Show »
Length:981
Mass (Da):109,606
Checksum:i56619B194F1C4501
GO
Isoform 18 (identifier: Q99PJ1-18) [UniParc]FASTAAdd to basket
Also known as: CD3-1

The sequence of this isoform differs from the canonical sequence as follows:
     1463-1682: NLFLLYHFEQ...SHFSFSTLPT → KYEMPQYGSR...NSLHIPMTKL
     1683-1943: Missing.

Show »
Length:1,682
Mass (Da):186,541
Checksum:i820F564D0CF70A21
GO
Isoform 19 (identifier: Q99PJ1-19) [UniParc]FASTAAdd to basket
Also known as: CD3-2

The sequence of this isoform differs from the canonical sequence as follows:
     31-35: Missing.
     1463-1682: NLFLLYHFEQ...SHFSFSTLPT → KYEMPQYGSR...NSLHIPMTKL
     1683-1943: Missing.

Show »
Length:1,677
Mass (Da):185,819
Checksum:i2823260AD289185F
GO
Isoform 20 (identifier: Q99PJ1-20) [UniParc]FASTAAdd to basket
Also known as: CD3-3

The sequence of this isoform differs from the canonical sequence as follows:
     1-1252: Missing.
     1407-1667: FKVRQAECTK...QLKSLSSGSS → GGFAPEHQLL...NSLHIPMTKL
     1668-1943: Missing.

Show »
Length:415
Mass (Da):46,543
Checksum:i58702C92B3B8A8B1
GO
Isoform 21 (identifier: Q99PJ1-21) [UniParc]FASTAAdd to basket
Also known as: SI-1

The sequence of this isoform differs from the canonical sequence as follows:
     1131-1176: NTAKVYIEIQ...SVLRVKATDR → LSVIPCSWRT...STRAASVPIH
     1177-1943: Missing.

Show »
Length:1,176
Mass (Da):129,853
Checksum:i694D3FBB2455620D
GO
Isoform 22 (identifier: Q99PJ1-22) [UniParc]FASTAAdd to basket
Also known as: SI-2

The sequence of this isoform differs from the canonical sequence as follows:
     31-35: Missing.
     1131-1176: NTAKVYIEIQ...SVLRVKATDR → LSVIPCSWRT...STRAASVPIH
     1177-1943: Missing.

Show »
Length:1,171
Mass (Da):129,132
Checksum:iF1F9A2CAA115DEA2
GO
Isoform 23 (identifier: Q99PJ1-23) [UniParc]FASTAAdd to basket
Also known as: SI-3

The sequence of this isoform differs from the canonical sequence as follows:
     31-35: Missing.
     441-961: Missing.
     1131-1176: NTAKVYIEIQ...SVLRVKATDR → LSVIPCSWRT...STRAASVPIH
     1177-1943: Missing.

Show »
Length:650
Mass (Da):72,054
Checksum:iE3300DA7C9F333FB
GO
Isoform 24 (identifier: Q99PJ1-24) [UniParc]FASTAAdd to basket
Also known as: C

The sequence of this isoform differs from the canonical sequence as follows:
     31-600: Missing.
     1464-1473: Missing.

Note: Produced by aberrant splicing sites.
Show »
Length:1,363
Mass (Da):149,922
Checksum:i5047B631063401AD
GO
Isoform 25 (identifier: Q99PJ1-25) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1462-1943: HNLFLLYHFE...VQPHSQSTSL → YEMPQYGSRR...ANSEGYNTAL

Show »
Length:1,781
Mass (Da):198,072
Checksum:iEE3878002ED66B31
GO
Isoform 26 (identifier: Q99PJ1-26) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1407-1409: Missing.
     1462-1943: HNLFLLYHFE...VQPHSQSTSL → YEMPQYGSRR...NSLHIPMTKL

Show »
Length:1,677
Mass (Da):185,901
Checksum:i924FA442271BE3F4
GO

Sequence cautioni

The sequence ABC79270 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti608I → T in AAG53891 (PubMed:11138007).Curated1
Sequence conflicti608I → T in AAY24693 (PubMed:16799054).Curated1
Sequence conflicti608I → T in ABC79259 (PubMed:16807332).Curated1
Sequence conflicti608I → T in ABC79260 (PubMed:16807332).Curated1
Sequence conflicti608I → T in ABC79261 (PubMed:16807332).Curated1
Sequence conflicti608I → T in ABC79262 (PubMed:16807332).Curated1
Sequence conflicti608I → T in ABC79264 (PubMed:16807332).Curated1
Sequence conflicti608I → T in ABC79265 (PubMed:16807332).Curated1
Sequence conflicti608I → T in ABC79266 (PubMed:16807332).Curated1
Sequence conflicti608I → T in ABC79267 (PubMed:16807332).Curated1
Sequence conflicti608I → T in ABC79268 (PubMed:16807332).Curated1
Sequence conflicti608I → T in ABC79269 (PubMed:16807332).Curated1
Sequence conflicti608I → T in ABC79270 (PubMed:16807332).Curated1
Sequence conflicti608I → T in ABC79276 (PubMed:16807332).Curated1
Sequence conflicti608I → T in ABC79277 (PubMed:16807332).Curated1
Sequence conflicti901V → A in AAG53891 (PubMed:11138007).Curated1
Sequence conflicti901V → A in AAY24693 (PubMed:16799054).Curated1
Sequence conflicti901V → A in ABC79259 (PubMed:16807332).Curated1
Sequence conflicti901V → A in ABC79261 (PubMed:16807332).Curated1
Sequence conflicti901V → A in ABC79263 (PubMed:16807332).Curated1
Sequence conflicti901V → A in ABC79264 (PubMed:16807332).Curated1
Sequence conflicti901V → A in ABC79265 (PubMed:16807332).Curated1
Sequence conflicti901V → A in ABC79266 (PubMed:16807332).Curated1
Sequence conflicti901V → A in ABC79267 (PubMed:16807332).Curated1
Sequence conflicti901V → A in ABC79268 (PubMed:16807332).Curated1
Sequence conflicti901V → A in ABC79269 (PubMed:16807332).Curated1
Sequence conflicti901V → A in ABC79270 (PubMed:16807332).Curated1
Sequence conflicti901V → A in ABC79276 (PubMed:16807332).Curated1
Sequence conflicti901V → A in ABC79277 (PubMed:16807332).Curated1
Sequence conflicti1748S → F in AAG53891 (PubMed:11138007).Curated1
Sequence conflicti1748S → F in AAY24693 (PubMed:16799054).Curated1
Sequence conflicti1748S → F in ABC79259 (PubMed:16807332).Curated1
Sequence conflicti1748S → F in ABC79261 (PubMed:16807332).Curated1
Sequence conflicti1748S → F in ABC79263 (PubMed:16807332).Curated1
Sequence conflicti1748S → F in ABC79264 (PubMed:16807332).Curated1
Sequence conflicti1748S → F in ABC79265 (PubMed:16807332).Curated1
Sequence conflicti1748S → F in ABC79266 (PubMed:16807332).Curated1
Sequence conflicti1748S → F in ABC79267 (PubMed:16807332).Curated1
Sequence conflicti1848S → F in AAG53891 (PubMed:11138007).Curated1
Sequence conflicti1848S → F in AAY24693 (PubMed:16799054).Curated1
Sequence conflicti1848S → F in ABC79259 (PubMed:16807332).Curated1
Sequence conflicti1848S → F in ABC79261 (PubMed:16807332).Curated1
Sequence conflicti1848S → F in ABC79263 (PubMed:16807332).Curated1
Sequence conflicti1848S → F in ABC79264 (PubMed:16807332).Curated1
Sequence conflicti1848S → F in ABC79265 (PubMed:16807332).Curated1
Sequence conflicti1848S → F in ABC79266 (PubMed:16807332).Curated1
Sequence conflicti1848S → F in ABC79267 (PubMed:16807332).Curated1
Sequence conflicti1859W → G in BAE24546 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0465761 – 1252Missing in isoform 20. 1 PublicationAdd BLAST1252
Alternative sequenceiVSP_0465771 – 401Missing in isoform 12. 1 PublicationAdd BLAST401
Alternative sequenceiVSP_04657831 – 600Missing in isoform 24. 1 PublicationAdd BLAST570
Alternative sequenceiVSP_04657931 – 57Missing in isoform 8 and isoform 9. 1 PublicationAdd BLAST27
Alternative sequenceiVSP_04658031 – 35Missing in isoform 2, isoform 3, isoform 4, isoform 5, isoform 6, isoform 7, isoform 11, isoform 13, isoform 14, isoform 15, isoform 16, isoform 17, isoform 19, isoform 22 and isoform 23. 1 Publication5
Alternative sequenceiVSP_046581204 – 240Missing in isoform 7. 1 PublicationAdd BLAST37
Alternative sequenceiVSP_046582298 – 331EELNP…ILYSI → DFGSLRSGANSWCQGCGGVH RCPSPWRRLLPRRL in isoform 13. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_046583332 – 1943Missing in isoform 13. 1 PublicationAdd BLAST1612
Alternative sequenceiVSP_046584335 – 339TPEDY → RARES in isoform 14. 1 Publication5
Alternative sequenceiVSP_046585340 – 1943Missing in isoform 14. 1 PublicationAdd BLAST1604
Alternative sequenceiVSP_046587372 – 655AEQDN…DPITY → VEPEKVKKPKVEIREPSEEE VVVTVEKPPAAEPTYPTWKR ARIFPMIFKKVRGLAEKRGI DLEGEEWRRRLDEEDKDYLQ LTLDQEEATESTVESEEESS DYTEYTETESEFSESETTEE SESETPSEEAEESSTPESEE SESTESEGEKARKNIVLARR RPVVEEIQEVKGKREEPPVE EEEEPPLEEEERAEEGEESE AAPMDESTDLEAQDVPEEGS AESVSMERGVESEESESELS SSSSTSESLSGGPWGFQVPE YDRRKDEEPKKSPGANSEGY NTAL in isoform 15. 1 PublicationAdd BLAST284
Alternative sequenceiVSP_046588440D → DVPPGGVP in isoform 10 and isoform 12. 1 Publication1
Alternative sequenceiVSP_046589441 – 961Missing in isoform 23. 1 PublicationAdd BLAST521
Alternative sequenceiVSP_046590441 – 725TKDPE…VFDPY → VEPEKVKKPKVEIREPSEEE VVVTVEKPPAAEPTYPTWKR ARIFPMIFKKVRGLAEKRGI DLEGEEWRRRLDEEDKDYLQ LTLDQEEATESTVESEEESS DYTEYTETESEFSESETTEE SESETPSEEAEESSTPESEE SESTESEGEKARKNIVLARR RPVVEEIQEVKGKREEPPVE EEEEPPLEEEERAEEGEESE AAPMDESTDLEAQDVPEEGS AESVSMERGVESEESESELS SSSSTSESLSGGPWGFQVPE YDRRKDEEPKKSPGANSEGY NTAL in isoform 16. 1 PublicationAdd BLAST285
Alternative sequenceiVSP_046591600 – 671RHSIC…NLSET → S in isoform 5. 1 PublicationAdd BLAST72
Alternative sequenceiVSP_046592645 – 689ATDRE…STDRY → HRDSQPREGSRPREHRPLHP HRHSLRWQTGWNLNCHCEHS GDGRQ in isoform 3. 1 PublicationAdd BLAST45
Alternative sequenceiVSP_046593656 – 1943Missing in isoform 15. 1 PublicationAdd BLAST1288
Alternative sequenceiVSP_046594690 – 1943Missing in isoform 3. 1 PublicationAdd BLAST1254
Alternative sequenceiVSP_046595703 – 986TSTAT…SIFDV → VEPEKVKKPKVEIREPSEEE VVVTVEKPPAAEPTYPTWKR ARIFPMIFKKVRGLAEKRGI DLEGEEWRRRLDEEDKDYLQ LTLDQEEATESTVESEEESS DYTEYTETESEFSESETTEE SESETPSEEAEESSTPESEE SESTESEGEKARKNIVLARR RPVVEEIQEVKGKREEPPVE EEEEPPLEEEERAEEGEESE AAPMDESTDLEAQDVPEEGS AESVSMERGVESEESESELS SSSSTSESLSGGPWGFQVPE YDRRKDEEPKKSPGANSEGY NTAL in isoform 17. 1 PublicationAdd BLAST284
Alternative sequenceiVSP_046596726 – 1943Missing in isoform 16. 1 PublicationAdd BLAST1218
Alternative sequenceiVSP_046597987 – 1943Missing in isoform 17. 1 PublicationAdd BLAST957
Alternative sequenceiVSP_0465981131 – 1176NTAKV…KATDR → LSVIPCSWRTQVSKSLGLEL GVPVSHSVESGTRTGSSTRA ASVPIH in isoform 21, isoform 22 and isoform 23. 2 PublicationsAdd BLAST46
Alternative sequenceiVSP_0465991177 – 1943Missing in isoform 21, isoform 22 and isoform 23. 2 PublicationsAdd BLAST767
Alternative sequenceiVSP_0466001407 – 1667FKVRQ…SSGSS → GGFAPEHQLLRPSLLKPEEL SMESGIDPGQEYGQDYYSYE HGYEMPQYGSRRRLLPPAGQ EEYGEVIGEAEEEYEEEEWA RKRMIKLVVDREYESSSPGE DSAPESQRSRTHKPSGRSNV NGNIYIAQNGSVVRTRRACV ADNLKVPSPGLLGRHLKKLD TLAGTREENVPLNTLFKGPF STEKAKRTPTLVTFAPCPVV AEHSAVKPSGTRLKHTAEQE SMVDSRLSRESMEFHGDSAP SDEEELWMGPWNSLHIPMTK L in isoform 20. 1 PublicationAdd BLAST261
Alternative sequenceiVSP_0466011407 – 1409Missing in isoform 6, isoform 7, isoform 9 and isoform 26. 2 Publications3
Alternative sequenceiVSP_0466021461 – 1463MHN → I in isoform 4, isoform 6 and isoform 7. 1 Publication3
Alternative sequenceiVSP_0466031462 – 1943HNLFL…QSTSL → YEMPQYGSRRRLLPPAGQEE YGEVIGEAEEEYEEEEVEPE KVKKPKVEIREPSEEEVVVT VEKPPAAEPTYPTWKRARIF PMIFKKVRGLAEKRGIDLEG EEWRRRLDEEDKDYLQLTLD QEEATESTVESEEESSDYTE YTETESEFSESETTEESESE TPSEEAEESSTPESEESEST ESEGEKARKNIVLARRRPVV EEIQEVKGKREEPPVEEEEE PPLEEEERAEEGEESEAAPM DESTDLEAQDVPEEGSAESV SMERGVESEESESELSSSSS TSESLSGGPWGFQVPEYDRR KDEEPKKSPGANSEGYNTAL in isoform 25. 1 PublicationAdd BLAST482
Alternative sequenceiVSP_0466041462 – 1943HNLFL…QSTSL → YEMPQYGSRRRLLPPAGQEE YGEVIGEAEEEYEEEEWARK RMIKLVVDREYESSSPGEDS APESQRSRTHKPSGRSNVNG NIYIAQNGSVVRTRRACVAD NLKVPSPGLLGRHLKKLDTL AGTREENVPLNTLFKGPFST EKAKRTPTLVTFAPCPVVAE HSAVKPSGTRLKHTAEQESM VDSRLSRESMEFHGDSAPSD EEELWMGPWNSLHIPMTKL in isoform 26. 1 PublicationAdd BLAST482
Alternative sequenceiVSP_0466051463 – 1943NLFLL…QSTSL → KYEMPQYGSRRRLLPPAGQE EYGEVIGEAEEEYEEEEVEP EKVKKPKVEIREPSEEEVVV TVEKPPAAEPTYPTWKRARI FPMIFKKVRGLAEKRGIDLE GEEWRRRLDEEDKDYLQLTL DQEEATESTVESEEESSDYT EYTETESEFSESETTEESES ETPSEEAEESSTPESEESES TESEGEKARKNIVLARRRPV VEEIQEVKGKREEPPVEEEE EPPLEEEERAEEGEESEAAP MDESTDLEAQDVPEEGSAES VSMERGVESEESESELSSSS STSESLSGGPWGFQVPEYDR RKDEEPKKSPGANSEGYNTA L in isoform 10. 1 PublicationAdd BLAST481
Alternative sequenceiVSP_0466061463 – 1682NLFLL…STLPT → KYEMPQYGSRRRLLPPAGQE EYGEVIGEAEEEYEEEEWAR KRMIKLVVDREYESSSPGED SAPESQRSRTHKPSGRSNVN GNIYIAQNGSVVRTRRACVA DNLKVPSPGLLGRHLKKLDT LAGTREENVPLNTLFKGPFS TEKAKRTPTLVTFAPCPVVA EHSAVKPSGTRLKHTAEQES MVDSRLSRESMEFHGDSAPS DEEELWMGPWNSLHIPMTKL in isoform 18 and isoform 19. 1 PublicationAdd BLAST220
Alternative sequenceiVSP_0466071463 – 1523NLFLL…TFSFV → KSYPWNLGLILARNMDKIIT VMSMGMRCPSMEVAVDCCHL LDRRNTAKSLVKLKRNMKKK R in isoform 11 and isoform 12. 1 PublicationAdd BLAST61
Alternative sequenceiVSP_0466081464 – 1473Missing in isoform 24. 1 Publication10
Alternative sequenceiVSP_0466091524 – 1943Missing in isoform 11 and isoform 12. 1 PublicationAdd BLAST420
Alternative sequenceiVSP_0466101668 – 1943Missing in isoform 20. 1 PublicationAdd BLAST276
Alternative sequenceiVSP_0466111683 – 1943Missing in isoform 18 and isoform 19. 1 PublicationAdd BLAST261

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF281899 mRNA. Translation: AAG53891.1.
AY949849 mRNA. Translation: AAY24693.1.
DQ354396 mRNA. Translation: ABC79259.1.
DQ354397 mRNA. Translation: ABC79260.1.
DQ354398 mRNA. Translation: ABC79261.1.
DQ354399 mRNA. Translation: ABC79262.1.
DQ354400 mRNA. Translation: ABC79263.1.
DQ354401 mRNA. Translation: ABC79264.1.
DQ354402 mRNA. Translation: ABC79265.1.
DQ354403 mRNA. Translation: ABC79266.1.
DQ354404 mRNA. Translation: ABC79267.1.
DQ354405 mRNA. Translation: ABC79268.1.
DQ354406 mRNA. Translation: ABC79269.1.
DQ354407 mRNA. Translation: ABC79270.1. Different initiation.
DQ354408 mRNA. Translation: ABC79271.1.
DQ354409 mRNA. Translation: ABC79272.1.
DQ354410 mRNA. Translation: ABC79273.1.
DQ354411 mRNA. Translation: ABC79274.1.
DQ354412 mRNA. Translation: ABC79275.1.
DQ354413 mRNA. Translation: ABC79276.1.
DQ354414 mRNA. Translation: ABC79277.1.
DQ354415 mRNA. Translation: ABC79278.1.
DQ354416 mRNA. Translation: ABC79279.1.
DQ354417 mRNA. Translation: ABC79280.1.
DQ354418 mRNA. Translation: ABC79281.1.
AK139154 mRNA. Translation: BAE23903.1.
AK141024 mRNA. Translation: BAE24546.1.
AC108392 Genomic DNA. No translation available.
AC119894 Genomic DNA. No translation available.
AC121142 Genomic DNA. No translation available.
AC121602 Genomic DNA. No translation available.
AC121832 Genomic DNA. No translation available.
AC123032 Genomic DNA. No translation available.
AC123809 Genomic DNA. No translation available.
AC144802 Genomic DNA. No translation available.
AC147721 Genomic DNA. No translation available.
AC153858 Genomic DNA. No translation available.
AC158800 Genomic DNA. No translation available.
AC159477 Genomic DNA. No translation available.
AC186813 Genomic DNA. No translation available.
AC188091 Genomic DNA. No translation available.
CAAA01110489 Genomic DNA. No translation available.
HQ404375 mRNA. Translation: ADP09331.1.
HQ420254 mRNA. Translation: ADT91308.1.
CCDSiCCDS35934.1. [Q99PJ1-1]
CCDS48594.1. [Q99PJ1-6]
CCDS48595.1. [Q99PJ1-7]
CCDS56711.1. [Q99PJ1-10]
CCDS56712.1. [Q99PJ1-21]
CCDS56713.1. [Q99PJ1-18]
CCDS56714.1. [Q99PJ1-22]
CCDS56715.1. [Q99PJ1-2]
CCDS56716.1. [Q99PJ1-11]
CCDS56717.1. [Q99PJ1-19]
CCDS56718.1. [Q99PJ1-4]
CCDS56719.1. [Q99PJ1-5]
CCDS56720.1. [Q99PJ1-8]
CCDS56721.1. [Q99PJ1-9]
RefSeqiNP_001136207.1. NM_001142735.1. [Q99PJ1-2]
NP_001136208.1. NM_001142736.1. [Q99PJ1-4]
NP_001136209.1. NM_001142737.1. [Q99PJ1-5]
NP_001136210.1. NM_001142738.1. [Q99PJ1-7]
NP_001136211.1. NM_001142739.1. [Q99PJ1-8]
NP_001136212.1. NM_001142740.1. [Q99PJ1-6]
NP_001136213.1. NM_001142741.1. [Q99PJ1-9]
NP_001136214.1. NM_001142742.1. [Q99PJ1-10]
NP_001136215.1. NM_001142743.1. [Q99PJ1-11]
NP_001136218.1. NM_001142746.1. [Q99PJ1-18]
NP_001136219.1. NM_001142747.1. [Q99PJ1-21]
NP_001136220.1. NM_001142748.1. [Q99PJ1-22]
NP_001136232.1. NM_001142760.1. [Q99PJ1-19]
NP_075604.2. NM_023115.3. [Q99PJ1-1]
XP_006513219.1. XM_006513156.3. [Q99PJ1-26]
UniGeneiMm.338933.

Genome annotation databases

EnsembliENSMUST00000092420; ENSMUSP00000090076; ENSMUSG00000052613. [Q99PJ1-6]
ENSMUST00000105424; ENSMUSP00000101064; ENSMUSG00000052613. [Q99PJ1-2]
ENSMUST00000105426; ENSMUSP00000101066; ENSMUSG00000052613. [Q99PJ1-4]
ENSMUST00000105429; ENSMUSP00000101069; ENSMUSG00000052613. [Q99PJ1-5]
ENSMUST00000124046; ENSMUSP00000121130; ENSMUSG00000052613. [Q99PJ1-12]
ENSMUST00000125006; ENSMUSP00000120056; ENSMUSG00000052613. [Q99PJ1-22]
ENSMUST00000125055; ENSMUSP00000114326; ENSMUSG00000052613. [Q99PJ1-3]
ENSMUST00000125517; ENSMUSP00000115399; ENSMUSG00000052613. [Q99PJ1-16]
ENSMUST00000126920; ENSMUSP00000121939; ENSMUSG00000052613. [Q99PJ1-8]
ENSMUST00000129404; ENSMUSP00000117731; ENSMUSG00000052613. [Q99PJ1-9]
ENSMUST00000131321; ENSMUSP00000122911; ENSMUSG00000052613. [Q99PJ1-4]
ENSMUST00000131724; ENSMUSP00000122466; ENSMUSG00000052613. [Q99PJ1-11]
ENSMUST00000134009; ENSMUSP00000120618; ENSMUSG00000052613. [Q99PJ1-23]
ENSMUST00000136096; ENSMUSP00000121534; ENSMUSG00000052613. [Q99PJ1-3]
ENSMUST00000144302; ENSMUSP00000122606; ENSMUSG00000052613. [Q99PJ1-13]
ENSMUST00000146682; ENSMUSP00000134863; ENSMUSG00000052613. [Q99PJ1-20]
ENSMUST00000147189; ENSMUSP00000122940; ENSMUSG00000052613. [Q99PJ1-7]
ENSMUST00000151116; ENSMUSP00000119662; ENSMUSG00000052613. [Q99PJ1-10]
ENSMUST00000152655; ENSMUSP00000118201; ENSMUSG00000052613. [Q99PJ1-17]
ENSMUST00000152819; ENSMUSP00000123647; ENSMUSG00000052613. [Q99PJ1-15]
ENSMUST00000155701; ENSMUSP00000135495; ENSMUSG00000052613. [Q99PJ1-14]
ENSMUST00000177107; ENSMUSP00000135501; ENSMUSG00000052613. [Q99PJ1-18]
ENSMUST00000177420; ENSMUSP00000135849; ENSMUSG00000052613. [Q99PJ1-21]
ENSMUST00000191709; ENSMUSP00000142313; ENSMUSG00000052613. [Q99PJ1-25]
ENSMUST00000191854; ENSMUSP00000141973; ENSMUSG00000052613. [Q99PJ1-19]
ENSMUST00000193361; ENSMUSP00000141792; ENSMUSG00000052613. [Q99PJ1-1]
ENSMUST00000193739; ENSMUSP00000142173; ENSMUSG00000052613. [Q99PJ1-26]
GeneIDi11994.
KEGGimmu:11994.
UCSCiuc007fpf.2. mouse. [Q99PJ1-21]
uc007fpg.2. mouse. [Q99PJ1-22]
uc007fph.2. mouse. [Q99PJ1-10]
uc007fpi.2. mouse. [Q99PJ1-8]
uc007fpj.2. mouse. [Q99PJ1-9]
uc007fpk.2. mouse. [Q99PJ1-1]
uc007fpl.2. mouse. [Q99PJ1-4]
uc007fpn.2. mouse. [Q99PJ1-6]
uc007fpo.2. mouse. [Q99PJ1-17]
uc007fpq.2. mouse. [Q99PJ1-20]
uc007fpr.2. mouse. [Q99PJ1-11]
uc011xfz.1. mouse. [Q99PJ1-23]
uc011xgb.1. mouse. [Q99PJ1-7]
uc011xgc.1. mouse. [Q99PJ1-5]
uc011xgd.1. mouse. [Q99PJ1-15]
uc011xge.1. mouse. [Q99PJ1-16]
uc011xgf.1. mouse. [Q99PJ1-14]
uc011xgg.1. mouse. [Q99PJ1-18]
uc011xgh.1. mouse. [Q99PJ1-19]
uc033fqa.1. mouse. [Q99PJ1-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF281899 mRNA. Translation: AAG53891.1.
AY949849 mRNA. Translation: AAY24693.1.
DQ354396 mRNA. Translation: ABC79259.1.
DQ354397 mRNA. Translation: ABC79260.1.
DQ354398 mRNA. Translation: ABC79261.1.
DQ354399 mRNA. Translation: ABC79262.1.
DQ354400 mRNA. Translation: ABC79263.1.
DQ354401 mRNA. Translation: ABC79264.1.
DQ354402 mRNA. Translation: ABC79265.1.
DQ354403 mRNA. Translation: ABC79266.1.
DQ354404 mRNA. Translation: ABC79267.1.
DQ354405 mRNA. Translation: ABC79268.1.
DQ354406 mRNA. Translation: ABC79269.1.
DQ354407 mRNA. Translation: ABC79270.1. Different initiation.
DQ354408 mRNA. Translation: ABC79271.1.
DQ354409 mRNA. Translation: ABC79272.1.
DQ354410 mRNA. Translation: ABC79273.1.
DQ354411 mRNA. Translation: ABC79274.1.
DQ354412 mRNA. Translation: ABC79275.1.
DQ354413 mRNA. Translation: ABC79276.1.
DQ354414 mRNA. Translation: ABC79277.1.
DQ354415 mRNA. Translation: ABC79278.1.
DQ354416 mRNA. Translation: ABC79279.1.
DQ354417 mRNA. Translation: ABC79280.1.
DQ354418 mRNA. Translation: ABC79281.1.
AK139154 mRNA. Translation: BAE23903.1.
AK141024 mRNA. Translation: BAE24546.1.
AC108392 Genomic DNA. No translation available.
AC119894 Genomic DNA. No translation available.
AC121142 Genomic DNA. No translation available.
AC121602 Genomic DNA. No translation available.
AC121832 Genomic DNA. No translation available.
AC123032 Genomic DNA. No translation available.
AC123809 Genomic DNA. No translation available.
AC144802 Genomic DNA. No translation available.
AC147721 Genomic DNA. No translation available.
AC153858 Genomic DNA. No translation available.
AC158800 Genomic DNA. No translation available.
AC159477 Genomic DNA. No translation available.
AC186813 Genomic DNA. No translation available.
AC188091 Genomic DNA. No translation available.
CAAA01110489 Genomic DNA. No translation available.
HQ404375 mRNA. Translation: ADP09331.1.
HQ420254 mRNA. Translation: ADT91308.1.
CCDSiCCDS35934.1. [Q99PJ1-1]
CCDS48594.1. [Q99PJ1-6]
CCDS48595.1. [Q99PJ1-7]
CCDS56711.1. [Q99PJ1-10]
CCDS56712.1. [Q99PJ1-21]
CCDS56713.1. [Q99PJ1-18]
CCDS56714.1. [Q99PJ1-22]
CCDS56715.1. [Q99PJ1-2]
CCDS56716.1. [Q99PJ1-11]
CCDS56717.1. [Q99PJ1-19]
CCDS56718.1. [Q99PJ1-4]
CCDS56719.1. [Q99PJ1-5]
CCDS56720.1. [Q99PJ1-8]
CCDS56721.1. [Q99PJ1-9]
RefSeqiNP_001136207.1. NM_001142735.1. [Q99PJ1-2]
NP_001136208.1. NM_001142736.1. [Q99PJ1-4]
NP_001136209.1. NM_001142737.1. [Q99PJ1-5]
NP_001136210.1. NM_001142738.1. [Q99PJ1-7]
NP_001136211.1. NM_001142739.1. [Q99PJ1-8]
NP_001136212.1. NM_001142740.1. [Q99PJ1-6]
NP_001136213.1. NM_001142741.1. [Q99PJ1-9]
NP_001136214.1. NM_001142742.1. [Q99PJ1-10]
NP_001136215.1. NM_001142743.1. [Q99PJ1-11]
NP_001136218.1. NM_001142746.1. [Q99PJ1-18]
NP_001136219.1. NM_001142747.1. [Q99PJ1-21]
NP_001136220.1. NM_001142748.1. [Q99PJ1-22]
NP_001136232.1. NM_001142760.1. [Q99PJ1-19]
NP_075604.2. NM_023115.3. [Q99PJ1-1]
XP_006513219.1. XM_006513156.3. [Q99PJ1-26]
UniGeneiMm.338933.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4APXX-ray1.65B27-259[»]
4AQ8X-ray2.63C/D27-259[»]
4AQAX-ray1.96B27-259[»]
4AQEX-ray2.27B27-259[»]
4AXWX-ray2.23B27-259[»]
4XXWX-ray2.26A/B36-259[»]
ProteinModelPortaliQ99PJ1.
SMRiQ99PJ1.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi198282. 3 interactors.
DIPiDIP-42151N.
IntActiQ99PJ1. 2 interactors.
MINTiMINT-1895732.
STRINGi10090.ENSMUSP00000101066.

PTM databases

iPTMnetiQ99PJ1.
PhosphoSitePlusiQ99PJ1.

Proteomic databases

PaxDbiQ99PJ1.
PRIDEiQ99PJ1.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000092420; ENSMUSP00000090076; ENSMUSG00000052613. [Q99PJ1-6]
ENSMUST00000105424; ENSMUSP00000101064; ENSMUSG00000052613. [Q99PJ1-2]
ENSMUST00000105426; ENSMUSP00000101066; ENSMUSG00000052613. [Q99PJ1-4]
ENSMUST00000105429; ENSMUSP00000101069; ENSMUSG00000052613. [Q99PJ1-5]
ENSMUST00000124046; ENSMUSP00000121130; ENSMUSG00000052613. [Q99PJ1-12]
ENSMUST00000125006; ENSMUSP00000120056; ENSMUSG00000052613. [Q99PJ1-22]
ENSMUST00000125055; ENSMUSP00000114326; ENSMUSG00000052613. [Q99PJ1-3]
ENSMUST00000125517; ENSMUSP00000115399; ENSMUSG00000052613. [Q99PJ1-16]
ENSMUST00000126920; ENSMUSP00000121939; ENSMUSG00000052613. [Q99PJ1-8]
ENSMUST00000129404; ENSMUSP00000117731; ENSMUSG00000052613. [Q99PJ1-9]
ENSMUST00000131321; ENSMUSP00000122911; ENSMUSG00000052613. [Q99PJ1-4]
ENSMUST00000131724; ENSMUSP00000122466; ENSMUSG00000052613. [Q99PJ1-11]
ENSMUST00000134009; ENSMUSP00000120618; ENSMUSG00000052613. [Q99PJ1-23]
ENSMUST00000136096; ENSMUSP00000121534; ENSMUSG00000052613. [Q99PJ1-3]
ENSMUST00000144302; ENSMUSP00000122606; ENSMUSG00000052613. [Q99PJ1-13]
ENSMUST00000146682; ENSMUSP00000134863; ENSMUSG00000052613. [Q99PJ1-20]
ENSMUST00000147189; ENSMUSP00000122940; ENSMUSG00000052613. [Q99PJ1-7]
ENSMUST00000151116; ENSMUSP00000119662; ENSMUSG00000052613. [Q99PJ1-10]
ENSMUST00000152655; ENSMUSP00000118201; ENSMUSG00000052613. [Q99PJ1-17]
ENSMUST00000152819; ENSMUSP00000123647; ENSMUSG00000052613. [Q99PJ1-15]
ENSMUST00000155701; ENSMUSP00000135495; ENSMUSG00000052613. [Q99PJ1-14]
ENSMUST00000177107; ENSMUSP00000135501; ENSMUSG00000052613. [Q99PJ1-18]
ENSMUST00000177420; ENSMUSP00000135849; ENSMUSG00000052613. [Q99PJ1-21]
ENSMUST00000191709; ENSMUSP00000142313; ENSMUSG00000052613. [Q99PJ1-25]
ENSMUST00000191854; ENSMUSP00000141973; ENSMUSG00000052613. [Q99PJ1-19]
ENSMUST00000193361; ENSMUSP00000141792; ENSMUSG00000052613. [Q99PJ1-1]
ENSMUST00000193739; ENSMUSP00000142173; ENSMUSG00000052613. [Q99PJ1-26]
GeneIDi11994.
KEGGimmu:11994.
UCSCiuc007fpf.2. mouse. [Q99PJ1-21]
uc007fpg.2. mouse. [Q99PJ1-22]
uc007fph.2. mouse. [Q99PJ1-10]
uc007fpi.2. mouse. [Q99PJ1-8]
uc007fpj.2. mouse. [Q99PJ1-9]
uc007fpk.2. mouse. [Q99PJ1-1]
uc007fpl.2. mouse. [Q99PJ1-4]
uc007fpn.2. mouse. [Q99PJ1-6]
uc007fpo.2. mouse. [Q99PJ1-17]
uc007fpq.2. mouse. [Q99PJ1-20]
uc007fpr.2. mouse. [Q99PJ1-11]
uc011xfz.1. mouse. [Q99PJ1-23]
uc011xgb.1. mouse. [Q99PJ1-7]
uc011xgc.1. mouse. [Q99PJ1-5]
uc011xgd.1. mouse. [Q99PJ1-15]
uc011xge.1. mouse. [Q99PJ1-16]
uc011xgf.1. mouse. [Q99PJ1-14]
uc011xgg.1. mouse. [Q99PJ1-18]
uc011xgh.1. mouse. [Q99PJ1-19]
uc033fqa.1. mouse. [Q99PJ1-2]

Organism-specific databases

CTDi65217.
MGIiMGI:1891428. Pcdh15.

Phylogenomic databases

eggNOGiKOG3594. Eukaryota.
ENOG410XQHI. LUCA.
GeneTreeiENSGT00850000132356.
HOGENOMiHOG000186027.
HOVERGENiHBG053521.
InParanoidiQ99PJ1.
KOiK16500.
OrthoDBiEOG091G0MMW.
TreeFamiTF326779.

Miscellaneous databases

ChiTaRSiPcdh15. mouse.
PROiQ99PJ1.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000052613.
CleanExiMM_PCDH15.
ExpressionAtlasiQ99PJ1. baseline and differential.
GenevisibleiQ99PJ1. MM.

Family and domain databases

Gene3Di2.60.40.60. 10 hits.
InterProiIPR002126. Cadherin.
IPR015919. Cadherin-like.
IPR020894. Cadherin_CS.
IPR030718. Protocadherin-15.
[Graphical view]
PANTHERiPTHR24028:SF11. PTHR24028:SF11. 3 hits.
PfamiPF00028. Cadherin. 8 hits.
[Graphical view]
PRINTSiPR00205. CADHERIN.
SMARTiSM00112. CA. 11 hits.
[Graphical view]
SUPFAMiSSF49313. SSF49313. 10 hits.
PROSITEiPS00232. CADHERIN_1. 4 hits.
PS50268. CADHERIN_2. 11 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiPCD15_MOUSE
AccessioniPrimary (citable) accession number: Q99PJ1
Secondary accession number(s): D6RCH0
, E9Q7D7, E9Q7R1, E9Q7R2, F6KJX4, F6KKG6, F6R5Z7, F6RBV2, F6U3Q6, F6UPC9, F6VPR3, F6WUN7, F6X715, F6XPA1, F6Y0A5, F6YP25, F6YZQ9, F7ASH0, F7CIN1, F7D5J8, F7DFU0, F8VQ61, H3BKS0, Q0ZM15, Q0ZM16, Q0ZM18, Q0ZM19, Q0ZM20, Q0ZM21, Q0ZM22, Q0ZM23, Q0ZM24, Q0ZM25, Q0ZM26, Q0ZM27, Q0ZM28, Q0ZM29, Q0ZM30, Q0ZM31, Q0ZM32, Q0ZM33, Q0ZM34, Q0ZM35, Q0ZM37, Q2VQG7, Q3URZ1, Q3UTS7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 31, 2002
Last sequence update: June 26, 2013
Last modified: November 30, 2016
This is version 135 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.