Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q99PJ1

- PCD15_MOUSE

UniProt

Q99PJ1 - PCD15_MOUSE

Protein

Protocadherin-15

Gene

Pcdh15

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 115 (01 Oct 2014)
      Sequence version 3 (26 Jun 2013)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Calcium-dependent cell-adhesion protein. Required for inner ear neuroepithelial cell elaboration and cochlear function. Probably involved in the maintenance of normal retinal function.

    GO - Molecular functioni

    1. calcium ion binding Source: InterPro
    2. protein binding Source: IntAct

    GO - Biological processi

    1. actin filament organization Source: MGI
    2. adult walking behavior Source: MGI
    3. auditory receptor cell differentiation Source: MGI
    4. auditory receptor cell stereocilium organization Source: MGI
    5. detection of mechanical stimulus involved in equilibrioception Source: MGI
    6. detection of mechanical stimulus involved in sensory perception of sound Source: MGI
    7. homophilic cell adhesion Source: InterPro
    8. inner ear development Source: MGI
    9. locomotory behavior Source: MGI
    10. morphogenesis of an epithelium Source: MGI
    11. multicellular organism growth Source: MGI
    12. nonmotile primary cilium assembly Source: MGI
    13. righting reflex Source: MGI
    14. sensory perception of sound Source: MGI
    15. startle response Source: MGI
    16. visual perception Source: MGI

    Keywords - Biological processi

    Cell adhesion, Hearing

    Keywords - Ligandi

    Calcium

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Protocadherin-15
    Gene namesi
    Name:Pcdh15
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 10

    Organism-specific databases

    MGIiMGI:1891428. Pcdh15.

    Subcellular locationi

    Cell membrane 2 Publications; Single-pass membrane protein 2 Publications
    Note: Efficient localization to the plasma membrane requires the presence of LHFPL5.

    GO - Cellular componenti

    1. cytoplasm Source: MGI
    2. extracellular region Source: UniProtKB-SubCell
    3. integral component of membrane Source: MGI
    4. photoreceptor outer segment Source: MGI
    5. plasma membrane Source: MGI
    6. stereocilium Source: HGNC

    Keywords - Cellular componenti

    Cell membrane, Membrane, Secreted

    Pathology & Biotechi

    Involvement in diseasei

    Defects in Pcdh15 are the cause of the Ames waltzer (av) phenotype. It is characterized by deafness and a balance disorder, associated with the degeneration of inner ear neuroepithelia.

    Mutagenesis

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Mutagenesisi48 – 481I → A: Strongly reduced interaction with CDH23. 1 Publication
    Mutagenesisi139 – 1391R → G: Impaired interaction with CDH23. 1 Publication

    Keywords - Diseasei

    Deafness

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 2626Sequence AnalysisAdd
    BLAST
    Chaini27 – 19431917Protocadherin-15PRO_0000003999Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Disulfide bondi37 ↔ 1251 Publication
    Glycosylationi57 – 571N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi102 – 1021N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi206 – 2061N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi424 – 4241N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi564 – 5641N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi667 – 6671N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi729 – 7291N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi773 – 7731N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi826 – 8261N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi856 – 8561N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi1069 – 10691N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi1089 – 10891N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi1180 – 11801N-linked (GlcNAc...)Sequence Analysis

    Keywords - PTMi

    Disulfide bond, Glycoprotein

    Proteomic databases

    PRIDEiQ99PJ1.

    PTM databases

    PhosphoSiteiQ99PJ1.

    Expressioni

    Tissue specificityi

    Expressed in brain and sensory epithelium of the developing inner ear. Expressed in the retina, in the photoreceptor inner segments, the outer plexiform layer, the inner nuclei layer and the ganglion cell layer and, more diffusely in the inner plexiform layer (at protein level). Not detected in the retinal pigment epithelium (at protein level). Expressed in the spleen, dorsal root ganglion, dorsal aspect of neural tube, floor plate and ependymal cells adjacent to the neural canal.4 Publications

    Developmental stagei

    Highest level of expression is detected at embryonic day 16. Alternative splicing isoforms have different spatiotemporal expression patterns. In cochlear cultures at the equivalent of postnatal day 3, isoforms belonging to the CD1 (isoforms 1 through 9) and CD3 (isoforms 18 through 20) groups are highly expressed in hair bundles in the basal coils and moderately in those in the middle of the apical coil; they are hardly detectable in those at the apical end of the apical coil (at protein level). At the base of the cultured cochlea, in the more mature hair bundles, CD3 group isoforms are restricted to the tips of the shorter stereocilia in both inner and outer hair cells. By contrast, at the same stage, isoforms belonging to the CD2 group (isoforms 10 through 17) are highly expressed in hair bundles in the apex of the cochlea and, at lower levels, in those in the middle of the apical coil; they are hardly detectable at the base of the cochlea (at protein level). In mature hair bundles, CD1 group isoforms are distributed fairly evenly along most of the length of the stereocilia on auditory hair cells, whereas they are concentrated toward the upper third of the hair bundle in vestibular hair cells. In both the auditory and the vestibular organs, these isoforms are excluded from a region at the very tip of each stereocilium (at protein level). In contrast, CD2 group isoforms are undetectable in adult cochlear hair cells (at protein level). These isoforms are expressed in the entire hair bundle of the immature cells in the sensory epithelium of the early postnatal vestibule and only in the kinocilium in the more mature hair bundles (at protein level). CD3 group isoforms are detected in immature vestibular hair bundles, concentrated toward the tip of each stereocilium, as early as 15.5 dpc. They also localize to the tips of the shorter stereocilia in the mature vestibular hair bundles and are not detected at the tips of the stereocilia in the tallest row (at protein level).1 Publication

    Gene expression databases

    CleanExiMM_PCDH15.
    GenevestigatoriQ99PJ1.

    Interactioni

    Subunit structurei

    antiparallel heterodimer with CDH23. Interacts with MYO7A. Interacts with USH1G; this interaction may recruit USH1G to the plasma membrane. Interacts with LHFPL5/TMHS; this interaction is required for efficient localization to hair bundles.5 Publications

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    Ush1cQ9ES643EBI-6556746,EBI-7418968

    Protein-protein interaction databases

    BioGridi198282. 3 interactions.
    DIPiDIP-42151N.
    IntActiQ99PJ1. 2 interactions.
    MINTiMINT-1895732.
    STRINGi10090.ENSMUSP00000101066.

    Structurei

    Secondary structure

    1
    1943
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Turni27 – 304
    Helixi31 – 344
    Beta strandi38 – 414
    Beta strandi45 – 528
    Beta strandi60 – 634
    Beta strandi67 – 693
    Beta strandi71 – 755
    Beta strandi77 – 848
    Helixi86 – 883
    Beta strandi90 – 934
    Turni94 – 974
    Beta strandi98 – 1014
    Turni112 – 1143
    Beta strandi118 – 12710
    Turni128 – 1303
    Beta strandi133 – 14311
    Beta strandi151 – 1555
    Beta strandi157 – 1626
    Beta strandi170 – 1723
    Turni174 – 1796
    Beta strandi180 – 1823
    Beta strandi184 – 1863
    Helixi187 – 1904
    Beta strandi192 – 1976
    Helixi205 – 2084
    Turni214 – 2163
    Beta strandi219 – 2213
    Turni227 – 2293
    Beta strandi232 – 24110
    Helixi246 – 2483
    Beta strandi251 – 2599

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    4APXX-ray1.65B27-259[»]
    4AQ8X-ray2.63C/D27-259[»]
    4AQAX-ray1.96B27-259[»]
    4AQEX-ray2.27B27-259[»]
    4AXWX-ray2.23B27-259[»]
    ProteinModelPortaliQ99PJ1.
    SMRiQ99PJ1. Positions 27-260.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini27 – 13811355ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini1403 – 1943541CytoplasmicSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei1382 – 140221HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini45 – 152108Cadherin 1PROSITE-ProRule annotationAdd
    BLAST
    Domaini153 – 270118Cadherin 2PROSITE-ProRule annotationAdd
    BLAST
    Domaini283 – 400118Cadherin 3PROSITE-ProRule annotationAdd
    BLAST
    Domaini401 – 514114Cadherin 4PROSITE-ProRule annotationAdd
    BLAST
    Domaini515 – 621107Cadherin 5PROSITE-ProRule annotationAdd
    BLAST
    Domaini622 – 722101Cadherin 6PROSITE-ProRule annotationAdd
    BLAST
    Domaini724 – 824101Cadherin 7PROSITE-ProRule annotationAdd
    BLAST
    Domaini825 – 931107Cadherin 8PROSITE-ProRule annotationAdd
    BLAST
    Domaini932 – 1040109Cadherin 9PROSITE-ProRule annotationAdd
    BLAST
    Domaini1042 – 1149108Cadherin 10PROSITE-ProRule annotationAdd
    BLAST
    Domaini1150 – 1264115Cadherin 11PROSITE-ProRule annotationAdd
    BLAST

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi1437 – 144812Poly-ProAdd
    BLAST
    Compositional biasi1772 – 17787Poly-Pro
    Compositional biasi1804 – 18129Poly-Pro

    Domaini

    Cadherin repeats 1 and 2 mediate calcium-dependent heterophilic interaction with CDH23.1 Publication
    Three calcium ions are usually bound at the interface of each cadherin domain and rigidify the connections, imparting a strong curvature to the full-length ectodomain.1 Publication

    Sequence similaritiesi

    Contains 11 cadherin domains.PROSITE-ProRule annotation

    Keywords - Domaini

    Repeat, Signal, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG253862.
    GeneTreeiENSGT00750000117340.
    HOGENOMiHOG000230919.
    HOVERGENiHBG053521.
    InParanoidiQ99PJ1.
    KOiK16500.
    OMAiCESARCH.
    OrthoDBiEOG7ZWD0W.
    TreeFamiTF326779.

    Family and domain databases

    Gene3Di2.60.40.60. 10 hits.
    InterProiIPR002126. Cadherin.
    IPR015919. Cadherin-like.
    IPR020894. Cadherin_CS.
    [Graphical view]
    PfamiPF00028. Cadherin. 8 hits.
    [Graphical view]
    PRINTSiPR00205. CADHERIN.
    SMARTiSM00112. CA. 11 hits.
    [Graphical view]
    SUPFAMiSSF49313. SSF49313. 10 hits.
    PROSITEiPS00232. CADHERIN_1. 4 hits.
    PS50268. CADHERIN_2. 11 hits.
    [Graphical view]

    Sequences (26)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 26 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q99PJ1-1) [UniParc]FASTAAdd to Basket

    Also known as: CD1-1

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MFLQFAVWKC LPHGILIASL LVVSWGQYDD DWQYEDCKLA RGGPPATIVA     50
    IDEESRNGTI LVDNMLIKGT AGGPDPTIEL SLKDNVDYWV LLDPVKQMLF 100
    LNSTGRVLDR DPPMNIHSIV VQVQCVNKKV GTVIYHEVRI VVRDRNDNSP 150
    TFKHESYYAT VNELTPVGTT IFTGFSGDNG ATDIDDGPNG QIEYVIQYNP 200
    EDPTSNDTFE IPLMLTGNVV LRKRLNYEDK TRYYVIIQAN DRAQNLNERR 250
    TTTTTLTVDV LDGDDLGPMF LPCVLVPNTR DCRPLTYQAA IPELRTPEEL 300
    NPILVTPPIQ AIDQDRNIQP PSDRPGILYS ILVGTPEDYP RFFHMHPRTA 350
    ELTLLEPVNR DFHQKFDLVI KAEQDNGHPL PAFASLHIEI LDENNQSPYF 400
    TMPSYQGYIL ESAPVGATIS ESLNLTTPLR IVALDKDIED TKDPELHLFL 450
    NDYTSVFTVT PTGITRYLTL LQPVDREEQQ TYTFLITAFD GVQESEPVVV 500
    NIRVMDANDN TPTFPEISYD VYVYTDMSPG DSVIQLTAVD ADEGSNGEIS 550
    YEILVGGKGD FVINKTTGLV SIAPGVELIV GQTYALTVQA SDNAPPAERR 600
    HSICTVYIEV LPPNNQSPPR FPQLMYSLEV SEAMRIGAIL LNLQATDREG 650
    DPITYAIENG DPQRVFNLSE TTGILSLGKA LDRESTDRYI LIVTASDGRP 700
    DGTSTATVNI VVTDVNDNAP VFDPYLPRNL SVVEEEANAF VGQVRATDPD 750
    AGINGQVHYS LGNFNNLFRI TSNGSIYTAV KLNREARDHY ELVVVATDGA 800
    VHPRHSTLTL YIKVLDIDDN SPVFTNSTYT VVVEENLPAG TSFLQIEAKD 850
    VDLGANVSYR IRSPEVKHLF ALHPFTGELS LLRSLDYEAF PDQEASITFL 900
    VEAFDIYGTM PPGIATVTVI VKDMNDYPPV FSKRIYKGMV APDAVKGTPI 950
    TTVYAEDADP PGMPASRVRY RVDDVQFPYP ASIFDVEEDS GRVVTRVNLN 1000
    EEPTTIFKLV VVAFDDGEPV MSSSATVRIL VLHPGEIPRF TQEEYRPPPV 1050
    SELAARGTVV GVISAAAINQ SIVYSIVAGN EEDKFGINNV TGVIYVNSPL 1100
    DYETRTSYVL RVQADSLEVV LANLRVPSKS NTAKVYIEIQ DENDHPPVFQ 1150
    KKFYIGGVSE DARMFASVLR VKATDRDTGN YSAMAYRLII PPIKEGKEGF 1200
    VVETYTGLIK TAMLFHNMRR SYFKFQVIAT DDYGKGLSGK ADVLVSVVNQ 1250
    LDMQVIVSNV PPTLVEKKIE DLTEILDRYV QEQIPGAKVV VESIGARRHG 1300
    DAYSLEDYSK CDLTVYAIDP QTNRAIDRNE LFKFLDGKLL DINKDFQPYY 1350
    GEGGRILEIR TPEAVTSIKK RGESLGYTEG ALLALAFIII LCCIPAILVV 1400
    LVSYRQFKVR QAECTKTARI QSAMPAAKPA APVPAAPAPP PPPPPPPPGA 1450
    HLYEELGESA MHNLFLLYHF EQSRGNNSVP EDRSSHRDGM AFSSSTTESH 1500
    EPAHVEGPLK ESQPNPARTF SFVPDEDNLS THNPLYMESI GQRSTNSDLQ 1550
    PRTDFEELLA PRTQVKSQSL RGPREKIQRV WNQSVSFPRR LMWKAPNRPE 1600
    TIDLVEWQIT NQRAECESAR CHPSQRGSSN VLLATEDAHE SEKEGGHRDT 1650
    LIVQQTEQLK SLSSGSSFSS SWSHFSFSTL PTISRAVELG SEPNVVTSPA 1700
    DCTLELSPPL RPRILNSLSS KRETPTCASD TEPKRNSFEI APHPPSISAP 1750
    LPHPPLPRPP IAFTTFPLPL SPPNPPPPQL VTFSLPISTP PTSSLPLPPP 1800
    LSLPPPPRPP APRLFPQPPS TSIPSTDSIS APAAKCTASA THARETTSTT 1850
    QPPASNPQWG AEPHRHPKGI LRHVKNLAEL EKSVSNMYSH IEKNCPPADP 1900
    SKLHTFCPAE KTGMKITHDQ SQETLVRVVE GIDVQPHSQS TSL 1943
    Length:1,943
    Mass (Da):214,738
    Last modified:June 26, 2013 - v3
    Checksum:i6FD6836082655855
    GO
    Isoform 2 (identifier: Q99PJ1-2) [UniParc]FASTAAdd to Basket

    Also known as: CD1-2

    The sequence of this isoform differs from the canonical sequence as follows:
         31-35: Missing.

    Show »
    Length:1,938
    Mass (Da):214,016
    Checksum:i40B0EB13DF4E5EFC
    GO
    Isoform 3 (identifier: Q99PJ1-3) [UniParc]FASTAAdd to Basket

    Also known as: CD1-3/5

    The sequence of this isoform differs from the canonical sequence as follows:
         31-35: Missing.
         645-689: ATDREGDPIT...ALDRESTDRY → HRDSQPREGS...HCEHSGDGRQ
         690-1943: Missing.

    Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.

    Show »
    Length:684
    Mass (Da):76,656
    Checksum:i9042A0B5CB766F1F
    GO
    Isoform 4 (identifier: Q99PJ1-4) [UniParc]FASTAAdd to Basket

    Also known as: CD1-4

    The sequence of this isoform differs from the canonical sequence as follows:
         31-35: Missing.
         1461-1463: MHN → I

    Show »
    Length:1,936
    Mass (Da):213,747
    Checksum:i3740C7F23545D42B
    GO
    Isoform 5 (identifier: Q99PJ1-5) [UniParc]FASTAAdd to Basket

    Also known as: CD1-6

    The sequence of this isoform differs from the canonical sequence as follows:
         31-35: Missing.
         600-671: RHSICTVYIEVLPPNNQSPPRFPQLMYSLEVSEAMRIGAILLNLQATDREGDPITYAIENGDPQRVFNLSET → S

    Show »
    Length:1,867
    Mass (Da):205,990
    Checksum:iEC9AFA9363BE7757
    GO
    Isoform 6 (identifier: Q99PJ1-6) [UniParc]FASTAAdd to Basket

    Also known as: CD1-7

    The sequence of this isoform differs from the canonical sequence as follows:
         31-35: Missing.
         1407-1409: Missing.
         1461-1463: MHN → I

    Show »
    Length:1,933
    Mass (Da):213,372
    Checksum:iC708CC475A755E15
    GO
    Isoform 7 (identifier: Q99PJ1-7) [UniParc]FASTAAdd to Basket

    Also known as: CD1-8

    The sequence of this isoform differs from the canonical sequence as follows:
         31-35: Missing.
         204-240: Missing.
         1407-1409: Missing.
         1461-1463: MHN → I

    Show »
    Length:1,896
    Mass (Da):209,000
    Checksum:iCAA46E2AA740CA6A
    GO
    Isoform 8 (identifier: Q99PJ1-8) [UniParc]FASTAAdd to Basket

    Also known as: CD1-9

    The sequence of this isoform differs from the canonical sequence as follows:
         31-57: Missing.

    Show »
    Length:1,916
    Mass (Da):211,721
    Checksum:iA416619EE89EABC8
    GO
    Isoform 9 (identifier: Q99PJ1-9) [UniParc]FASTAAdd to Basket

    Also known as: CD1-10

    The sequence of this isoform differs from the canonical sequence as follows:
         31-57: Missing.
         1407-1409: Missing.

    Show »
    Length:1,913
    Mass (Da):211,347
    Checksum:iFB42EBAEE0565806
    GO
    Isoform 10 (identifier: Q99PJ1-10) [UniParc]FASTAAdd to Basket

    Also known as: CD2-1

    The sequence of this isoform differs from the canonical sequence as follows:
         440-440: D → DVPPGGVP
         1463-1943: NLFLLYHFEQ...VQPHSQSTSL → KYEMPQYGSR...ANSEGYNTAL

    Show »
    Length:1,790
    Mass (Da):198,941
    Checksum:i5731151E416F5119
    GO
    Isoform 11 (identifier: Q99PJ1-11) [UniParc]FASTAAdd to Basket

    Also known as: CD2-2

    The sequence of this isoform differs from the canonical sequence as follows:
         31-35: Missing.
         1463-1523: NLFLLYHFEQ...PNPARTFSFV → KSYPWNLGLI...KLKRNMKKKR
         1524-1943: Missing.

    Show »
    Length:1,518
    Mass (Da):168,209
    Checksum:i31FC7C15E9D26B80
    GO
    Isoform 12 (identifier: Q99PJ1-12) [UniParc]FASTAAdd to Basket

    Also known as: CD2-3

    The sequence of this isoform differs from the canonical sequence as follows:
         1-401: Missing.
         440-440: D → DVPPGGVP
         1463-1523: NLFLLYHFEQ...PNPARTFSFV → KSYPWNLGLI...KLKRNMKKKR
         1524-1943: Missing.

    Show »
    Length:1,129
    Mass (Da):124,249
    Checksum:i1B8BAD179452BA79
    GO
    Isoform 13 (identifier: Q99PJ1-13) [UniParc]FASTAAdd to Basket

    Also known as: CD2-4

    The sequence of this isoform differs from the canonical sequence as follows:
         31-35: Missing.
         298-331: EELNPILVTPPIQAIDQDRNIQPPSDRPGILYSI → DFGSLRSGANSWCQGCGGVHRCPSPWRRLLPRRL
         332-1943: Missing.

    Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.

    Show »
    Length:326
    Mass (Da):36,453
    Checksum:iFA6863C72C1324C2
    GO
    Isoform 14 (identifier: Q99PJ1-14) [UniParc]FASTAAdd to Basket

    Also known as: CD2-5

    The sequence of this isoform differs from the canonical sequence as follows:
         31-35: Missing.
         335-339: TPEDY → RARES
         340-1943: Missing.

    Show »
    Length:334
    Mass (Da):37,309
    Checksum:i8A4A6FECF06B3883
    GO
    Isoform 15 (identifier: Q99PJ1-15) [UniParc]FASTAAdd to Basket

    Also known as: CD2-6

    The sequence of this isoform differs from the canonical sequence as follows:
         31-35: Missing.
         372-655: AEQDNGHPLP...TDREGDPITY → VEPEKVKKPK...ANSEGYNTAL
         656-1943: Missing.

    Show »
    Length:650
    Mass (Da):73,340
    Checksum:i0E288A38E5D417FF
    GO
    Isoform 16 (identifier: Q99PJ1-16) [UniParc]FASTAAdd to Basket

    Also known as: CD2-7

    The sequence of this isoform differs from the canonical sequence as follows:
         31-35: Missing.
         441-725: TKDPELHLFL...NDNAPVFDPY → VEPEKVKKPK...ANSEGYNTAL
         726-1943: Missing.

    Show »
    Length:719
    Mass (Da):80,894
    Checksum:iFFC3D62480CD3DED
    GO
    Isoform 17 (identifier: Q99PJ1-17) [UniParc]FASTAAdd to Basket

    Also known as: CD2-8

    The sequence of this isoform differs from the canonical sequence as follows:
         31-35: Missing.
         703-986: TSTATVNIVV...FPYPASIFDV → VEPEKVKKPK...ANSEGYNTAL
         987-1943: Missing.

    Show »
    Length:981
    Mass (Da):109,606
    Checksum:i56619B194F1C4501
    GO
    Isoform 18 (identifier: Q99PJ1-18) [UniParc]FASTAAdd to Basket

    Also known as: CD3-1

    The sequence of this isoform differs from the canonical sequence as follows:
         1463-1682: NLFLLYHFEQ...SHFSFSTLPT → KYEMPQYGSR...NSLHIPMTKL
         1683-1943: Missing.

    Show »
    Length:1,682
    Mass (Da):186,541
    Checksum:i820F564D0CF70A21
    GO
    Isoform 19 (identifier: Q99PJ1-19) [UniParc]FASTAAdd to Basket

    Also known as: CD3-2

    The sequence of this isoform differs from the canonical sequence as follows:
         31-35: Missing.
         1463-1682: NLFLLYHFEQ...SHFSFSTLPT → KYEMPQYGSR...NSLHIPMTKL
         1683-1943: Missing.

    Show »
    Length:1,677
    Mass (Da):185,819
    Checksum:i2823260AD289185F
    GO
    Isoform 20 (identifier: Q99PJ1-20) [UniParc]FASTAAdd to Basket

    Also known as: CD3-3

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1252: Missing.
         1407-1667: FKVRQAECTK...QLKSLSSGSS → GGFAPEHQLL...NSLHIPMTKL
         1668-1943: Missing.

    Show »
    Length:415
    Mass (Da):46,543
    Checksum:i58702C92B3B8A8B1
    GO
    Isoform 21 (identifier: Q99PJ1-21) [UniParc]FASTAAdd to Basket

    Also known as: SI-1

    The sequence of this isoform differs from the canonical sequence as follows:
         1131-1176: NTAKVYIEIQ...SVLRVKATDR → LSVIPCSWRT...STRAASVPIH
         1177-1943: Missing.

    Show »
    Length:1,176
    Mass (Da):129,853
    Checksum:i694D3FBB2455620D
    GO
    Isoform 22 (identifier: Q99PJ1-22) [UniParc]FASTAAdd to Basket

    Also known as: SI-2

    The sequence of this isoform differs from the canonical sequence as follows:
         31-35: Missing.
         1131-1176: NTAKVYIEIQ...SVLRVKATDR → LSVIPCSWRT...STRAASVPIH
         1177-1943: Missing.

    Show »
    Length:1,171
    Mass (Da):129,132
    Checksum:iF1F9A2CAA115DEA2
    GO
    Isoform 23 (identifier: Q99PJ1-23) [UniParc]FASTAAdd to Basket

    Also known as: SI-3

    The sequence of this isoform differs from the canonical sequence as follows:
         31-35: Missing.
         441-961: Missing.
         1131-1176: NTAKVYIEIQ...SVLRVKATDR → LSVIPCSWRT...STRAASVPIH
         1177-1943: Missing.

    Show »
    Length:650
    Mass (Da):72,054
    Checksum:iE3300DA7C9F333FB
    GO
    Isoform 24 (identifier: Q99PJ1-24) [UniParc]FASTAAdd to Basket

    Also known as: C

    The sequence of this isoform differs from the canonical sequence as follows:
         31-600: Missing.
         1464-1473: Missing.

    Note: Produced by aberrant splicing sites.

    Show »
    Length:1,363
    Mass (Da):149,922
    Checksum:i5047B631063401AD
    GO
    Isoform 25 (identifier: Q99PJ1-25) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1462-1943: HNLFLLYHFE...VQPHSQSTSL → YEMPQYGSRR...ANSEGYNTAL

    Show »
    Length:1,781
    Mass (Da):198,072
    Checksum:iEE3878002ED66B31
    GO
    Isoform 26 (identifier: Q99PJ1-26) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1407-1409: Missing.
         1462-1943: HNLFLLYHFE...VQPHSQSTSL → YEMPQYGSRR...NSLHIPMTKL

    Show »
    Length:1,677
    Mass (Da):185,901
    Checksum:i924FA442271BE3F4
    GO

    Sequence cautioni

    The sequence ABC79270.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti608 – 6081I → T in AAG53891. (PubMed:11138007)Curated
    Sequence conflicti608 – 6081I → T in AAY24693. (PubMed:16799054)Curated
    Sequence conflicti608 – 6081I → T in ABC79259. (PubMed:16807332)Curated
    Sequence conflicti608 – 6081I → T in ABC79260. (PubMed:16807332)Curated
    Sequence conflicti608 – 6081I → T in ABC79261. (PubMed:16807332)Curated
    Sequence conflicti608 – 6081I → T in ABC79262. (PubMed:16807332)Curated
    Sequence conflicti608 – 6081I → T in ABC79264. (PubMed:16807332)Curated
    Sequence conflicti608 – 6081I → T in ABC79265. (PubMed:16807332)Curated
    Sequence conflicti608 – 6081I → T in ABC79266. (PubMed:16807332)Curated
    Sequence conflicti608 – 6081I → T in ABC79267. (PubMed:16807332)Curated
    Sequence conflicti608 – 6081I → T in ABC79268. (PubMed:16807332)Curated
    Sequence conflicti608 – 6081I → T in ABC79269. (PubMed:16807332)Curated
    Sequence conflicti608 – 6081I → T in ABC79270. (PubMed:16807332)Curated
    Sequence conflicti608 – 6081I → T in ABC79276. (PubMed:16807332)Curated
    Sequence conflicti608 – 6081I → T in ABC79277. (PubMed:16807332)Curated
    Sequence conflicti901 – 9011V → A in AAG53891. (PubMed:11138007)Curated
    Sequence conflicti901 – 9011V → A in AAY24693. (PubMed:16799054)Curated
    Sequence conflicti901 – 9011V → A in ABC79259. (PubMed:16807332)Curated
    Sequence conflicti901 – 9011V → A in ABC79261. (PubMed:16807332)Curated
    Sequence conflicti901 – 9011V → A in ABC79263. (PubMed:16807332)Curated
    Sequence conflicti901 – 9011V → A in ABC79264. (PubMed:16807332)Curated
    Sequence conflicti901 – 9011V → A in ABC79265. (PubMed:16807332)Curated
    Sequence conflicti901 – 9011V → A in ABC79266. (PubMed:16807332)Curated
    Sequence conflicti901 – 9011V → A in ABC79267. (PubMed:16807332)Curated
    Sequence conflicti901 – 9011V → A in ABC79268. (PubMed:16807332)Curated
    Sequence conflicti901 – 9011V → A in ABC79269. (PubMed:16807332)Curated
    Sequence conflicti901 – 9011V → A in ABC79270. (PubMed:16807332)Curated
    Sequence conflicti901 – 9011V → A in ABC79276. (PubMed:16807332)Curated
    Sequence conflicti901 – 9011V → A in ABC79277. (PubMed:16807332)Curated
    Sequence conflicti1748 – 17481S → F in AAG53891. (PubMed:11138007)Curated
    Sequence conflicti1748 – 17481S → F in AAY24693. (PubMed:16799054)Curated
    Sequence conflicti1748 – 17481S → F in ABC79259. (PubMed:16807332)Curated
    Sequence conflicti1748 – 17481S → F in ABC79261. (PubMed:16807332)Curated
    Sequence conflicti1748 – 17481S → F in ABC79263. (PubMed:16807332)Curated
    Sequence conflicti1748 – 17481S → F in ABC79264. (PubMed:16807332)Curated
    Sequence conflicti1748 – 17481S → F in ABC79265. (PubMed:16807332)Curated
    Sequence conflicti1748 – 17481S → F in ABC79266. (PubMed:16807332)Curated
    Sequence conflicti1748 – 17481S → F in ABC79267. (PubMed:16807332)Curated
    Sequence conflicti1848 – 18481S → F in AAG53891. (PubMed:11138007)Curated
    Sequence conflicti1848 – 18481S → F in AAY24693. (PubMed:16799054)Curated
    Sequence conflicti1848 – 18481S → F in ABC79259. (PubMed:16807332)Curated
    Sequence conflicti1848 – 18481S → F in ABC79261. (PubMed:16807332)Curated
    Sequence conflicti1848 – 18481S → F in ABC79263. (PubMed:16807332)Curated
    Sequence conflicti1848 – 18481S → F in ABC79264. (PubMed:16807332)Curated
    Sequence conflicti1848 – 18481S → F in ABC79265. (PubMed:16807332)Curated
    Sequence conflicti1848 – 18481S → F in ABC79266. (PubMed:16807332)Curated
    Sequence conflicti1848 – 18481S → F in ABC79267. (PubMed:16807332)Curated
    Sequence conflicti1859 – 18591W → G in BAE24546. (PubMed:16141072)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 12521252Missing in isoform 20. 1 PublicationVSP_046576Add
    BLAST
    Alternative sequencei1 – 401401Missing in isoform 12. 1 PublicationVSP_046577Add
    BLAST
    Alternative sequencei31 – 600570Missing in isoform 24. 1 PublicationVSP_046578Add
    BLAST
    Alternative sequencei31 – 5727Missing in isoform 8 and isoform 9. 1 PublicationVSP_046579Add
    BLAST
    Alternative sequencei31 – 355Missing in isoform 2, isoform 3, isoform 4, isoform 5, isoform 6, isoform 7, isoform 11, isoform 13, isoform 14, isoform 15, isoform 16, isoform 17, isoform 19, isoform 22 and isoform 23. 1 PublicationVSP_046580
    Alternative sequencei204 – 24037Missing in isoform 7. 1 PublicationVSP_046581Add
    BLAST
    Alternative sequencei298 – 33134EELNP…ILYSI → DFGSLRSGANSWCQGCGGVH RCPSPWRRLLPRRL in isoform 13. 1 PublicationVSP_046582Add
    BLAST
    Alternative sequencei332 – 19431612Missing in isoform 13. 1 PublicationVSP_046583Add
    BLAST
    Alternative sequencei335 – 3395TPEDY → RARES in isoform 14. 1 PublicationVSP_046584
    Alternative sequencei340 – 19431604Missing in isoform 14. 1 PublicationVSP_046585Add
    BLAST
    Alternative sequencei372 – 655284AEQDN…DPITY → VEPEKVKKPKVEIREPSEEE VVVTVEKPPAAEPTYPTWKR ARIFPMIFKKVRGLAEKRGI DLEGEEWRRRLDEEDKDYLQ LTLDQEEATESTVESEEESS DYTEYTETESEFSESETTEE SESETPSEEAEESSTPESEE SESTESEGEKARKNIVLARR RPVVEEIQEVKGKREEPPVE EEEEPPLEEEERAEEGEESE AAPMDESTDLEAQDVPEEGS AESVSMERGVESEESESELS SSSSTSESLSGGPWGFQVPE YDRRKDEEPKKSPGANSEGY NTAL in isoform 15. 1 PublicationVSP_046587Add
    BLAST
    Alternative sequencei440 – 4401D → DVPPGGVP in isoform 10 and isoform 12. 1 PublicationVSP_046588
    Alternative sequencei441 – 961521Missing in isoform 23. 1 PublicationVSP_046589Add
    BLAST
    Alternative sequencei441 – 725285TKDPE…VFDPY → VEPEKVKKPKVEIREPSEEE VVVTVEKPPAAEPTYPTWKR ARIFPMIFKKVRGLAEKRGI DLEGEEWRRRLDEEDKDYLQ LTLDQEEATESTVESEEESS DYTEYTETESEFSESETTEE SESETPSEEAEESSTPESEE SESTESEGEKARKNIVLARR RPVVEEIQEVKGKREEPPVE EEEEPPLEEEERAEEGEESE AAPMDESTDLEAQDVPEEGS AESVSMERGVESEESESELS SSSSTSESLSGGPWGFQVPE YDRRKDEEPKKSPGANSEGY NTAL in isoform 16. 1 PublicationVSP_046590Add
    BLAST
    Alternative sequencei600 – 67172RHSIC…NLSET → S in isoform 5. 1 PublicationVSP_046591Add
    BLAST
    Alternative sequencei645 – 68945ATDRE…STDRY → HRDSQPREGSRPREHRPLHP HRHSLRWQTGWNLNCHCEHS GDGRQ in isoform 3. 1 PublicationVSP_046592Add
    BLAST
    Alternative sequencei656 – 19431288Missing in isoform 15. 1 PublicationVSP_046593Add
    BLAST
    Alternative sequencei690 – 19431254Missing in isoform 3. 1 PublicationVSP_046594Add
    BLAST
    Alternative sequencei703 – 986284TSTAT…SIFDV → VEPEKVKKPKVEIREPSEEE VVVTVEKPPAAEPTYPTWKR ARIFPMIFKKVRGLAEKRGI DLEGEEWRRRLDEEDKDYLQ LTLDQEEATESTVESEEESS DYTEYTETESEFSESETTEE SESETPSEEAEESSTPESEE SESTESEGEKARKNIVLARR RPVVEEIQEVKGKREEPPVE EEEEPPLEEEERAEEGEESE AAPMDESTDLEAQDVPEEGS AESVSMERGVESEESESELS SSSSTSESLSGGPWGFQVPE YDRRKDEEPKKSPGANSEGY NTAL in isoform 17. 1 PublicationVSP_046595Add
    BLAST
    Alternative sequencei726 – 19431218Missing in isoform 16. 1 PublicationVSP_046596Add
    BLAST
    Alternative sequencei987 – 1943957Missing in isoform 17. 1 PublicationVSP_046597Add
    BLAST
    Alternative sequencei1131 – 117646NTAKV…KATDR → LSVIPCSWRTQVSKSLGLEL GVPVSHSVESGTRTGSSTRA ASVPIH in isoform 21, isoform 22 and isoform 23. 2 PublicationsVSP_046598Add
    BLAST
    Alternative sequencei1177 – 1943767Missing in isoform 21, isoform 22 and isoform 23. 2 PublicationsVSP_046599Add
    BLAST
    Alternative sequencei1407 – 1667261FKVRQ…SSGSS → GGFAPEHQLLRPSLLKPEEL SMESGIDPGQEYGQDYYSYE HGYEMPQYGSRRRLLPPAGQ EEYGEVIGEAEEEYEEEEWA RKRMIKLVVDREYESSSPGE DSAPESQRSRTHKPSGRSNV NGNIYIAQNGSVVRTRRACV ADNLKVPSPGLLGRHLKKLD TLAGTREENVPLNTLFKGPF STEKAKRTPTLVTFAPCPVV AEHSAVKPSGTRLKHTAEQE SMVDSRLSRESMEFHGDSAP SDEEELWMGPWNSLHIPMTK L in isoform 20. 1 PublicationVSP_046600Add
    BLAST
    Alternative sequencei1407 – 14093Missing in isoform 6, isoform 7, isoform 9 and isoform 26. 2 PublicationsVSP_046601
    Alternative sequencei1461 – 14633MHN → I in isoform 4, isoform 6 and isoform 7. 1 PublicationVSP_046602
    Alternative sequencei1462 – 1943482HNLFL…QSTSL → YEMPQYGSRRRLLPPAGQEE YGEVIGEAEEEYEEEEVEPE KVKKPKVEIREPSEEEVVVT VEKPPAAEPTYPTWKRARIF PMIFKKVRGLAEKRGIDLEG EEWRRRLDEEDKDYLQLTLD QEEATESTVESEEESSDYTE YTETESEFSESETTEESESE TPSEEAEESSTPESEESEST ESEGEKARKNIVLARRRPVV EEIQEVKGKREEPPVEEEEE PPLEEEERAEEGEESEAAPM DESTDLEAQDVPEEGSAESV SMERGVESEESESELSSSSS TSESLSGGPWGFQVPEYDRR KDEEPKKSPGANSEGYNTAL in isoform 25. 1 PublicationVSP_046603Add
    BLAST
    Alternative sequencei1462 – 1943482HNLFL…QSTSL → YEMPQYGSRRRLLPPAGQEE YGEVIGEAEEEYEEEEWARK RMIKLVVDREYESSSPGEDS APESQRSRTHKPSGRSNVNG NIYIAQNGSVVRTRRACVAD NLKVPSPGLLGRHLKKLDTL AGTREENVPLNTLFKGPFST EKAKRTPTLVTFAPCPVVAE HSAVKPSGTRLKHTAEQESM VDSRLSRESMEFHGDSAPSD EEELWMGPWNSLHIPMTKL in isoform 26. 1 PublicationVSP_046604Add
    BLAST
    Alternative sequencei1463 – 1943481NLFLL…QSTSL → KYEMPQYGSRRRLLPPAGQE EYGEVIGEAEEEYEEEEVEP EKVKKPKVEIREPSEEEVVV TVEKPPAAEPTYPTWKRARI FPMIFKKVRGLAEKRGIDLE GEEWRRRLDEEDKDYLQLTL DQEEATESTVESEEESSDYT EYTETESEFSESETTEESES ETPSEEAEESSTPESEESES TESEGEKARKNIVLARRRPV VEEIQEVKGKREEPPVEEEE EPPLEEEERAEEGEESEAAP MDESTDLEAQDVPEEGSAES VSMERGVESEESESELSSSS STSESLSGGPWGFQVPEYDR RKDEEPKKSPGANSEGYNTA L in isoform 10. 1 PublicationVSP_046605Add
    BLAST
    Alternative sequencei1463 – 1682220NLFLL…STLPT → KYEMPQYGSRRRLLPPAGQE EYGEVIGEAEEEYEEEEWAR KRMIKLVVDREYESSSPGED SAPESQRSRTHKPSGRSNVN GNIYIAQNGSVVRTRRACVA DNLKVPSPGLLGRHLKKLDT LAGTREENVPLNTLFKGPFS TEKAKRTPTLVTFAPCPVVA EHSAVKPSGTRLKHTAEQES MVDSRLSRESMEFHGDSAPS DEEELWMGPWNSLHIPMTKL in isoform 18 and isoform 19. 1 PublicationVSP_046606Add
    BLAST
    Alternative sequencei1463 – 152361NLFLL…TFSFV → KSYPWNLGLILARNMDKIIT VMSMGMRCPSMEVAVDCCHL LDRRNTAKSLVKLKRNMKKK R in isoform 11 and isoform 12. 1 PublicationVSP_046607Add
    BLAST
    Alternative sequencei1464 – 147310Missing in isoform 24. 1 PublicationVSP_046608
    Alternative sequencei1524 – 1943420Missing in isoform 11 and isoform 12. 1 PublicationVSP_046609Add
    BLAST
    Alternative sequencei1668 – 1943276Missing in isoform 20. 1 PublicationVSP_046610Add
    BLAST
    Alternative sequencei1683 – 1943261Missing in isoform 18 and isoform 19. 1 PublicationVSP_046611Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF281899 mRNA. Translation: AAG53891.1.
    AY949849 mRNA. Translation: AAY24693.1.
    DQ354396 mRNA. Translation: ABC79259.1.
    DQ354397 mRNA. Translation: ABC79260.1.
    DQ354398 mRNA. Translation: ABC79261.1.
    DQ354399 mRNA. Translation: ABC79262.1.
    DQ354400 mRNA. Translation: ABC79263.1.
    DQ354401 mRNA. Translation: ABC79264.1.
    DQ354402 mRNA. Translation: ABC79265.1.
    DQ354403 mRNA. Translation: ABC79266.1.
    DQ354404 mRNA. Translation: ABC79267.1.
    DQ354405 mRNA. Translation: ABC79268.1.
    DQ354406 mRNA. Translation: ABC79269.1.
    DQ354407 mRNA. Translation: ABC79270.1. Different initiation.
    DQ354408 mRNA. Translation: ABC79271.1.
    DQ354409 mRNA. Translation: ABC79272.1.
    DQ354410 mRNA. Translation: ABC79273.1.
    DQ354411 mRNA. Translation: ABC79274.1.
    DQ354412 mRNA. Translation: ABC79275.1.
    DQ354413 mRNA. Translation: ABC79276.1.
    DQ354414 mRNA. Translation: ABC79277.1.
    DQ354415 mRNA. Translation: ABC79278.1.
    DQ354416 mRNA. Translation: ABC79279.1.
    DQ354417 mRNA. Translation: ABC79280.1.
    DQ354418 mRNA. Translation: ABC79281.1.
    AK139154 mRNA. Translation: BAE23903.1.
    AK141024 mRNA. Translation: BAE24546.1.
    AC108392 Genomic DNA. No translation available.
    AC119894 Genomic DNA. No translation available.
    AC121142 Genomic DNA. No translation available.
    AC121602 Genomic DNA. No translation available.
    AC121832 Genomic DNA. No translation available.
    AC123032 Genomic DNA. No translation available.
    AC123809 Genomic DNA. No translation available.
    AC144802 Genomic DNA. No translation available.
    AC147721 Genomic DNA. No translation available.
    AC153858 Genomic DNA. No translation available.
    AC158800 Genomic DNA. No translation available.
    AC159477 Genomic DNA. No translation available.
    AC186813 Genomic DNA. No translation available.
    AC188091 Genomic DNA. No translation available.
    CAAA01110489 Genomic DNA. No translation available.
    HQ404375 mRNA. Translation: ADP09331.1.
    HQ420254 mRNA. Translation: ADT91308.1.
    CCDSiCCDS35934.1. [Q99PJ1-1]
    CCDS48594.1. [Q99PJ1-6]
    CCDS48595.1. [Q99PJ1-7]
    CCDS56711.1. [Q99PJ1-10]
    CCDS56712.1. [Q99PJ1-21]
    CCDS56713.1. [Q99PJ1-18]
    CCDS56714.1. [Q99PJ1-22]
    CCDS56715.1. [Q99PJ1-2]
    CCDS56716.1. [Q99PJ1-11]
    CCDS56717.1. [Q99PJ1-19]
    CCDS56718.1. [Q99PJ1-4]
    CCDS56719.1. [Q99PJ1-5]
    CCDS56720.1. [Q99PJ1-8]
    CCDS56721.1. [Q99PJ1-9]
    RefSeqiNP_001136207.1. NM_001142735.1. [Q99PJ1-2]
    NP_001136208.1. NM_001142736.1. [Q99PJ1-4]
    NP_001136209.1. NM_001142737.1. [Q99PJ1-5]
    NP_001136210.1. NM_001142738.1. [Q99PJ1-7]
    NP_001136211.1. NM_001142739.1. [Q99PJ1-8]
    NP_001136212.1. NM_001142740.1. [Q99PJ1-6]
    NP_001136213.1. NM_001142741.1. [Q99PJ1-9]
    NP_001136214.1. NM_001142742.1. [Q99PJ1-10]
    NP_001136215.1. NM_001142743.1. [Q99PJ1-11]
    NP_001136218.1. NM_001142746.1. [Q99PJ1-18]
    NP_001136219.1. NM_001142747.1. [Q99PJ1-21]
    NP_001136220.1. NM_001142748.1. [Q99PJ1-22]
    NP_001136232.1. NM_001142760.1. [Q99PJ1-19]
    NP_075604.2. NM_023115.3. [Q99PJ1-1]
    XP_006513206.1. XM_006513143.1. [Q99PJ1-1]
    XP_006513207.1. XM_006513144.1. [Q99PJ1-1]
    XP_006513208.1. XM_006513145.1. [Q99PJ1-1]
    XP_006513209.1. XM_006513146.1. [Q99PJ1-1]
    XP_006513210.1. XM_006513147.1. [Q99PJ1-1]
    XP_006513213.1. XM_006513150.1. [Q99PJ1-2]
    XP_006513219.1. XM_006513156.1. [Q99PJ1-26]
    UniGeneiMm.338933.

    Genome annotation databases

    EnsembliENSMUST00000092420; ENSMUSP00000090076; ENSMUSG00000052613. [Q99PJ1-6]
    ENSMUST00000105424; ENSMUSP00000101064; ENSMUSG00000052613. [Q99PJ1-2]
    ENSMUST00000105426; ENSMUSP00000101066; ENSMUSG00000052613. [Q99PJ1-1]
    ENSMUST00000105429; ENSMUSP00000101069; ENSMUSG00000052613. [Q99PJ1-5]
    ENSMUST00000124046; ENSMUSP00000121130; ENSMUSG00000052613. [Q99PJ1-12]
    ENSMUST00000125006; ENSMUSP00000120056; ENSMUSG00000052613. [Q99PJ1-22]
    ENSMUST00000125055; ENSMUSP00000114326; ENSMUSG00000052613. [Q99PJ1-3]
    ENSMUST00000125517; ENSMUSP00000115399; ENSMUSG00000052613. [Q99PJ1-16]
    ENSMUST00000126920; ENSMUSP00000121939; ENSMUSG00000052613. [Q99PJ1-8]
    ENSMUST00000129404; ENSMUSP00000117731; ENSMUSG00000052613. [Q99PJ1-9]
    ENSMUST00000131321; ENSMUSP00000122911; ENSMUSG00000052613. [Q99PJ1-4]
    ENSMUST00000131724; ENSMUSP00000122466; ENSMUSG00000052613. [Q99PJ1-11]
    ENSMUST00000134009; ENSMUSP00000120618; ENSMUSG00000052613. [Q99PJ1-23]
    ENSMUST00000136096; ENSMUSP00000121534; ENSMUSG00000052613. [Q99PJ1-3]
    ENSMUST00000144302; ENSMUSP00000122606; ENSMUSG00000052613. [Q99PJ1-13]
    ENSMUST00000146682; ENSMUSP00000134863; ENSMUSG00000052613. [Q99PJ1-20]
    ENSMUST00000147189; ENSMUSP00000122940; ENSMUSG00000052613. [Q99PJ1-7]
    ENSMUST00000149977; ENSMUSP00000118833; ENSMUSG00000052613. [Q99PJ1-19]
    ENSMUST00000151116; ENSMUSP00000119662; ENSMUSG00000052613. [Q99PJ1-10]
    ENSMUST00000152655; ENSMUSP00000118201; ENSMUSG00000052613. [Q99PJ1-17]
    ENSMUST00000152819; ENSMUSP00000123647; ENSMUSG00000052613. [Q99PJ1-15]
    ENSMUST00000155701; ENSMUSP00000135495; ENSMUSG00000052613. [Q99PJ1-14]
    ENSMUST00000177107; ENSMUSP00000135501; ENSMUSG00000052613. [Q99PJ1-18]
    ENSMUST00000177420; ENSMUSP00000135849; ENSMUSG00000052613. [Q99PJ1-21]
    GeneIDi11994.
    KEGGimmu:11994.
    UCSCiuc007fpf.2. mouse.
    uc007fpg.2. mouse.
    uc007fpo.2. mouse.
    uc007fpq.2. mouse.
    uc011xfz.1. mouse.
    uc011xgd.1. mouse.
    uc011xge.1. mouse.
    uc011xgf.1. mouse.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF281899 mRNA. Translation: AAG53891.1 .
    AY949849 mRNA. Translation: AAY24693.1 .
    DQ354396 mRNA. Translation: ABC79259.1 .
    DQ354397 mRNA. Translation: ABC79260.1 .
    DQ354398 mRNA. Translation: ABC79261.1 .
    DQ354399 mRNA. Translation: ABC79262.1 .
    DQ354400 mRNA. Translation: ABC79263.1 .
    DQ354401 mRNA. Translation: ABC79264.1 .
    DQ354402 mRNA. Translation: ABC79265.1 .
    DQ354403 mRNA. Translation: ABC79266.1 .
    DQ354404 mRNA. Translation: ABC79267.1 .
    DQ354405 mRNA. Translation: ABC79268.1 .
    DQ354406 mRNA. Translation: ABC79269.1 .
    DQ354407 mRNA. Translation: ABC79270.1 . Different initiation.
    DQ354408 mRNA. Translation: ABC79271.1 .
    DQ354409 mRNA. Translation: ABC79272.1 .
    DQ354410 mRNA. Translation: ABC79273.1 .
    DQ354411 mRNA. Translation: ABC79274.1 .
    DQ354412 mRNA. Translation: ABC79275.1 .
    DQ354413 mRNA. Translation: ABC79276.1 .
    DQ354414 mRNA. Translation: ABC79277.1 .
    DQ354415 mRNA. Translation: ABC79278.1 .
    DQ354416 mRNA. Translation: ABC79279.1 .
    DQ354417 mRNA. Translation: ABC79280.1 .
    DQ354418 mRNA. Translation: ABC79281.1 .
    AK139154 mRNA. Translation: BAE23903.1 .
    AK141024 mRNA. Translation: BAE24546.1 .
    AC108392 Genomic DNA. No translation available.
    AC119894 Genomic DNA. No translation available.
    AC121142 Genomic DNA. No translation available.
    AC121602 Genomic DNA. No translation available.
    AC121832 Genomic DNA. No translation available.
    AC123032 Genomic DNA. No translation available.
    AC123809 Genomic DNA. No translation available.
    AC144802 Genomic DNA. No translation available.
    AC147721 Genomic DNA. No translation available.
    AC153858 Genomic DNA. No translation available.
    AC158800 Genomic DNA. No translation available.
    AC159477 Genomic DNA. No translation available.
    AC186813 Genomic DNA. No translation available.
    AC188091 Genomic DNA. No translation available.
    CAAA01110489 Genomic DNA. No translation available.
    HQ404375 mRNA. Translation: ADP09331.1 .
    HQ420254 mRNA. Translation: ADT91308.1 .
    CCDSi CCDS35934.1. [Q99PJ1-1 ]
    CCDS48594.1. [Q99PJ1-6 ]
    CCDS48595.1. [Q99PJ1-7 ]
    CCDS56711.1. [Q99PJ1-10 ]
    CCDS56712.1. [Q99PJ1-21 ]
    CCDS56713.1. [Q99PJ1-18 ]
    CCDS56714.1. [Q99PJ1-22 ]
    CCDS56715.1. [Q99PJ1-2 ]
    CCDS56716.1. [Q99PJ1-11 ]
    CCDS56717.1. [Q99PJ1-19 ]
    CCDS56718.1. [Q99PJ1-4 ]
    CCDS56719.1. [Q99PJ1-5 ]
    CCDS56720.1. [Q99PJ1-8 ]
    CCDS56721.1. [Q99PJ1-9 ]
    RefSeqi NP_001136207.1. NM_001142735.1. [Q99PJ1-2 ]
    NP_001136208.1. NM_001142736.1. [Q99PJ1-4 ]
    NP_001136209.1. NM_001142737.1. [Q99PJ1-5 ]
    NP_001136210.1. NM_001142738.1. [Q99PJ1-7 ]
    NP_001136211.1. NM_001142739.1. [Q99PJ1-8 ]
    NP_001136212.1. NM_001142740.1. [Q99PJ1-6 ]
    NP_001136213.1. NM_001142741.1. [Q99PJ1-9 ]
    NP_001136214.1. NM_001142742.1. [Q99PJ1-10 ]
    NP_001136215.1. NM_001142743.1. [Q99PJ1-11 ]
    NP_001136218.1. NM_001142746.1. [Q99PJ1-18 ]
    NP_001136219.1. NM_001142747.1. [Q99PJ1-21 ]
    NP_001136220.1. NM_001142748.1. [Q99PJ1-22 ]
    NP_001136232.1. NM_001142760.1. [Q99PJ1-19 ]
    NP_075604.2. NM_023115.3. [Q99PJ1-1 ]
    XP_006513206.1. XM_006513143.1. [Q99PJ1-1 ]
    XP_006513207.1. XM_006513144.1. [Q99PJ1-1 ]
    XP_006513208.1. XM_006513145.1. [Q99PJ1-1 ]
    XP_006513209.1. XM_006513146.1. [Q99PJ1-1 ]
    XP_006513210.1. XM_006513147.1. [Q99PJ1-1 ]
    XP_006513213.1. XM_006513150.1. [Q99PJ1-2 ]
    XP_006513219.1. XM_006513156.1. [Q99PJ1-26 ]
    UniGenei Mm.338933.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    4APX X-ray 1.65 B 27-259 [» ]
    4AQ8 X-ray 2.63 C/D 27-259 [» ]
    4AQA X-ray 1.96 B 27-259 [» ]
    4AQE X-ray 2.27 B 27-259 [» ]
    4AXW X-ray 2.23 B 27-259 [» ]
    ProteinModelPortali Q99PJ1.
    SMRi Q99PJ1. Positions 27-260.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 198282. 3 interactions.
    DIPi DIP-42151N.
    IntActi Q99PJ1. 2 interactions.
    MINTi MINT-1895732.
    STRINGi 10090.ENSMUSP00000101066.

    PTM databases

    PhosphoSitei Q99PJ1.

    Proteomic databases

    PRIDEi Q99PJ1.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000092420 ; ENSMUSP00000090076 ; ENSMUSG00000052613 . [Q99PJ1-6 ]
    ENSMUST00000105424 ; ENSMUSP00000101064 ; ENSMUSG00000052613 . [Q99PJ1-2 ]
    ENSMUST00000105426 ; ENSMUSP00000101066 ; ENSMUSG00000052613 . [Q99PJ1-1 ]
    ENSMUST00000105429 ; ENSMUSP00000101069 ; ENSMUSG00000052613 . [Q99PJ1-5 ]
    ENSMUST00000124046 ; ENSMUSP00000121130 ; ENSMUSG00000052613 . [Q99PJ1-12 ]
    ENSMUST00000125006 ; ENSMUSP00000120056 ; ENSMUSG00000052613 . [Q99PJ1-22 ]
    ENSMUST00000125055 ; ENSMUSP00000114326 ; ENSMUSG00000052613 . [Q99PJ1-3 ]
    ENSMUST00000125517 ; ENSMUSP00000115399 ; ENSMUSG00000052613 . [Q99PJ1-16 ]
    ENSMUST00000126920 ; ENSMUSP00000121939 ; ENSMUSG00000052613 . [Q99PJ1-8 ]
    ENSMUST00000129404 ; ENSMUSP00000117731 ; ENSMUSG00000052613 . [Q99PJ1-9 ]
    ENSMUST00000131321 ; ENSMUSP00000122911 ; ENSMUSG00000052613 . [Q99PJ1-4 ]
    ENSMUST00000131724 ; ENSMUSP00000122466 ; ENSMUSG00000052613 . [Q99PJ1-11 ]
    ENSMUST00000134009 ; ENSMUSP00000120618 ; ENSMUSG00000052613 . [Q99PJ1-23 ]
    ENSMUST00000136096 ; ENSMUSP00000121534 ; ENSMUSG00000052613 . [Q99PJ1-3 ]
    ENSMUST00000144302 ; ENSMUSP00000122606 ; ENSMUSG00000052613 . [Q99PJ1-13 ]
    ENSMUST00000146682 ; ENSMUSP00000134863 ; ENSMUSG00000052613 . [Q99PJ1-20 ]
    ENSMUST00000147189 ; ENSMUSP00000122940 ; ENSMUSG00000052613 . [Q99PJ1-7 ]
    ENSMUST00000149977 ; ENSMUSP00000118833 ; ENSMUSG00000052613 . [Q99PJ1-19 ]
    ENSMUST00000151116 ; ENSMUSP00000119662 ; ENSMUSG00000052613 . [Q99PJ1-10 ]
    ENSMUST00000152655 ; ENSMUSP00000118201 ; ENSMUSG00000052613 . [Q99PJ1-17 ]
    ENSMUST00000152819 ; ENSMUSP00000123647 ; ENSMUSG00000052613 . [Q99PJ1-15 ]
    ENSMUST00000155701 ; ENSMUSP00000135495 ; ENSMUSG00000052613 . [Q99PJ1-14 ]
    ENSMUST00000177107 ; ENSMUSP00000135501 ; ENSMUSG00000052613 . [Q99PJ1-18 ]
    ENSMUST00000177420 ; ENSMUSP00000135849 ; ENSMUSG00000052613 . [Q99PJ1-21 ]
    GeneIDi 11994.
    KEGGi mmu:11994.
    UCSCi uc007fpf.2. mouse.
    uc007fpg.2. mouse.
    uc007fpo.2. mouse.
    uc007fpq.2. mouse.
    uc011xfz.1. mouse.
    uc011xgd.1. mouse.
    uc011xge.1. mouse.
    uc011xgf.1. mouse.

    Organism-specific databases

    CTDi 65217.
    MGIi MGI:1891428. Pcdh15.

    Phylogenomic databases

    eggNOGi NOG253862.
    GeneTreei ENSGT00750000117340.
    HOGENOMi HOG000230919.
    HOVERGENi HBG053521.
    InParanoidi Q99PJ1.
    KOi K16500.
    OMAi CESARCH.
    OrthoDBi EOG7ZWD0W.
    TreeFami TF326779.

    Miscellaneous databases

    NextBioi 280177.
    PROi Q99PJ1.
    SOURCEi Search...

    Gene expression databases

    CleanExi MM_PCDH15.
    Genevestigatori Q99PJ1.

    Family and domain databases

    Gene3Di 2.60.40.60. 10 hits.
    InterProi IPR002126. Cadherin.
    IPR015919. Cadherin-like.
    IPR020894. Cadherin_CS.
    [Graphical view ]
    Pfami PF00028. Cadherin. 8 hits.
    [Graphical view ]
    PRINTSi PR00205. CADHERIN.
    SMARTi SM00112. CA. 11 hits.
    [Graphical view ]
    SUPFAMi SSF49313. SSF49313. 10 hits.
    PROSITEi PS00232. CADHERIN_1. 4 hits.
    PS50268. CADHERIN_2. 11 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "The mouse Ames waltzer hearing-loss mutant is caused by mutation of Pcdh15, a novel protocadherin gene."
      Alagramam K.N., Murcia C.L., Kwon H.Y., Pawlowski K.S., Wright C.G., Woychik R.P.
      Nat. Genet. 27:99-102(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    2. "Ames Waltzer deaf mice have reduced electroretinogram amplitudes and complex alternative splicing of Pcdh15 transcripts."
      Haywood-Watson R.J. II, Ahmed Z.M., Kjellstrom S., Bush R.A., Takada Y., Hampton L.L., Battey J.F., Sieving P.A., Friedman T.B.
      Invest. Ophthalmol. Vis. Sci. 47:3074-3084(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 24), TISSUE SPECIFICITY.
      Tissue: Retina.
    3. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2; 3; 4; 5; 6; 7; 8; 9; 10; 11; 12; 13; 14; 15; 16; 17; 18; 19; 20; 21; 22 AND 23), DEVELOPMENTAL STAGE.
      Strain: C57BL/6J.
      Tissue: Inner ear.
    4. "The transcriptional landscape of the mammalian genome."
      Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
      , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
      Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 21), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1763-1943 (ISOFORMS 1/2/4/5/6/7/8/9).
      Strain: C57BL/6J.
      Tissue: Cerebellum.
    5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
      Strain: C57BL/6J.
    6. "Usher type 1G protein sans is a critical component of the tip-link complex, a structure controlling actin polymerization in stereocilia."
      Caberlotto E., Michel V., Foucher I., Bahloul A., Goodyear R.J., Pepermans E., Michalski N., Perfettini I., Alegria-Prevot O., Chardenoux S., Do Cruzeiro M., Hardelin J.P., Richardson G.P., Avan P., Weil D., Petit C.
      Proc. Natl. Acad. Sci. U.S.A. 108:5825-5830(2011) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1368-1943 (ISOFORMS 25 AND 26), INTERACTION WITH USH1G, SUBCELLULAR LOCATION.
      Strain: Swiss.
      Tissue: Cochlea.
    7. Lubec G., Kang S.U.
      Submitted (APR-2007) to UniProtKB
      Cited for: PROTEIN SEQUENCE OF 1876-1882, IDENTIFICATION BY MASS SPECTROMETRY.
      Strain: C57BL/6.
      Tissue: Brain.
    8. "Expression of Pcdh15 in the inner ear, nervous system and various epithelia of the developing embryo."
      Murcia C.L., Woychik R.P.
      Mech. Dev. 105:163-166(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: TISSUE SPECIFICITY.
    9. "Physical and functional interaction between protocadherin 15 and myosin VIIa in mechanosensory hair cells."
      Senften M., Schwander M., Kazmierczak P., Lillo C., Shin J.B., Hasson T., Geleoc G.S., Gillespie P.G., Williams D., Holt J.R., Muller U.
      J. Neurosci. 26:2060-2071(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH MYO7A, TISSUE SPECIFICITY.
    10. "Cadherin 23 and protocadherin 15 interact to form tip-link filaments in sensory hair cells."
      Kazmierczak P., Sakaguchi H., Tokita J., Wilson-Kubalek E.M., Milligan R.A., Muller U., Kachar B.
      Nature 449:87-91(2007) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH CDH23, TISSUE SPECIFICITY.
    11. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Liver.
    12. "TMHS is an integral component of the mechanotransduction machinery of cochlear hair cells."
      Xiong W., Grillet N., Elledge H.M., Wagner T.F., Zhao B., Johnson K.R., Kazmierczak P., Muller U.
      Cell 151:1283-1295(2012) [PubMed] [Europe PMC] [Abstract]
      Cited for: SUBCELLULAR LOCATION, INTERACTION WITH LHFPL5.
    13. "Structure of a force-conveying cadherin bond essential for inner-ear mechanotransduction."
      Sotomayor M., Weihofen W.A., Gaudet R., Corey D.P.
      Nature 492:128-132(2012) [PubMed] [Europe PMC] [Abstract]
      Cited for: X-RAY CRYSTALLOGRAPHY (1.65 ANGSTROMS) OF 27-259 IN COMPLEX WITH CALCIUM IONS AND CDH23, SUBUNIT, DISULFIDE BOND, MUTAGENESIS OF ILE-48 AND ARG-139.

    Entry informationi

    Entry nameiPCD15_MOUSE
    AccessioniPrimary (citable) accession number: Q99PJ1
    Secondary accession number(s): D6RCH0
    , E9Q7D7, E9Q7R1, E9Q7R2, F6KJX4, F6KKG6, F6R5Z7, F6RBV2, F6U3Q6, F6UPC9, F6VPR3, F6WUN7, F6X715, F6XPA1, F6Y0A5, F6YP25, F6YZQ9, F7ASH0, F7CIN1, F7D5J8, F7DFU0, F8VQ61, H3BKS0, Q0ZM15, Q0ZM16, Q0ZM18, Q0ZM19, Q0ZM20, Q0ZM21, Q0ZM22, Q0ZM23, Q0ZM24, Q0ZM25, Q0ZM26, Q0ZM27, Q0ZM28, Q0ZM29, Q0ZM30, Q0ZM31, Q0ZM32, Q0ZM33, Q0ZM34, Q0ZM35, Q0ZM37, Q2VQG7, Q3URZ1, Q3UTS7
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: January 31, 2002
    Last sequence update: June 26, 2013
    Last modified: October 1, 2014
    This is version 115 of the entry and version 3 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3