Q99N11 (DUS22_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 29, 2013.
Version 87.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Dual specificity protein phosphatase 22 EC=3.1.3.16 EC=3.1.3.48 Alternative name(s): Low molecular weight dual specificity phosphatase 2 Short name=LMW-DSP2 | ||
| Gene names |
| ||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||
| Taxonomic identifier | 10090 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 184 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Activates the Jnk signaling pathway. Dephosphorylates and deactivates p38 and stress-activated protein kinase/c-Jun N-terminal kinase (SAPK/JNK). Ref.1 |
| Catalytic activity | Protein tyrosine phosphate + H2O = protein tyrosine + phosphate. A phosphoprotein + H2O = a protein + phosphate. |
| Subunit structure | Monomer By similarity. |
| Subcellular location | |
| Tissue specificity | Specifically expressed in the testis. Ref.1 |
| Post-translational modification | Myristoylation regulates subcellular location, and is necessary for activation of JNK By similarity. |
| Sequence similarities | Belongs to the protein-tyrosine phosphatase family. Non-receptor class dual specificity subfamily. Contains 1 tyrosine-protein phosphatase domain. |
| Sequence caution | The sequence CAI24592.1 differs from that shown. Reason: Erroneous gene model prediction. |
Ontologies
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q99N11-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q99N11-2) The sequence of this isoform differs from the canonical sequence as follows: 170-184: AAPGILKYWAFLRRL → GKYKEQGRMEPRPSSRRWSSFSTLPPLTYNNYTTET |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Initiator methionine | 1 | 1 | Removed By similarity | ||||||
| Chain | 2 – 184 | 183 | Dual specificity protein phosphatase 22 | PRO_0000244752 | |||||
Regions | |||||||||
| Domain | 65 – 133 | 69 | Tyrosine-protein phosphatase | ||||||
Sites | |||||||||
| Active site | 88 | 1 | Phosphocysteine intermediate | ||||||
Amino acid modifications | |||||||||
| Lipidation | 2 | 1 | N-myristoyl glycine By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 170 – 184 | 15 | AAPGI…FLRRL → GKYKEQGRMEPRPSSRRWSS FSTLPPLTYNNYTTET in isoform 2. | VSP_019615 | |||||
Experimental info | |||||||||
| Mutagenesis | 57 | 1 | D → A: Great decrease in activity. Ref.1 | ||||||
| Mutagenesis | 88 | 1 | C → S: Complete loss of activity. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Molecular cloning and characterization of a novel dual specificity phosphatase, LMW-DSP2, that lacks the cdc25 homology domain." Aoyama K., Nagata M., Oshima K., Matsuda T., Aoki N. J. Biol. Chem. 276:27575-27583(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, MUTAGENESIS OF ASP-57 AND CYS-88. Tissue: Testis. |
| [2] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Strain: C57BL/6J. Tissue: Retina. |
| [3] | "Lineage-specific biology revealed by a finished genome assembly of the mouse." Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S. Ponting C.P.PLoS Biol. 7:E1000112-E1000112(2009) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: C57BL/6J. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Strain: NMRI. Tissue: Mammary tumor. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF237619 mRNA. Translation: AAK15038.1. AK149363 mRNA. Translation: BAE28836.1. AL731659 Genomic DNA. Translation: CAI24592.1. Sequence problems. AL731659 Genomic DNA. Translation: CAI24593.1. AL731659 Genomic DNA. Translation: CAI24594.1. BC108362 mRNA. Translation: AAI08363.1. |
| IPI | IPI00117982. IPI00515139. |
| RefSeq | NP_001033044.1. NM_001037955.3. NP_598829.1. NM_134068.2. |
| UniGene | Mm.289646. |
3D structure databases | |
| ProteinModelPortal | Q99N11. |
| SMR | Q99N11. Positions 1-154. |
| ModBase | Search... |
Proteomic databases | |
| PaxDb | Q99N11. |
| PRIDE | Q99N11. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSMUST00000091672; ENSMUSP00000089260; ENSMUSG00000069255. ENSMUST00000095914; ENSMUSP00000093603; ENSMUSG00000069255. |
| GeneID | 105352. |
| KEGG | mmu:105352. |
| UCSC | uc007pyx.1. mouse. uc007pyy.1. mouse. |
Organism-specific databases | |
| CTD | 56940. |
| MGI | MGI:1915926. Dusp22. |
Phylogenomic databases | |
| eggNOG | COG2453. |
| GeneTree | ENSGT00680000099678. |
| HOGENOM | HOG000007880. |
| HOVERGEN | HBG054344. |
| KO | K04459. |
| OMA | WLREEYG. |
| OrthoDB | EOG4RFKT3. |
Gene expression databases | |
| Bgee | Q99N11. |
| CleanEx | MM_DUSP22. |
| Genevestigator | Q99N11. |
| GermOnline | ENSMUSG00000069255. Mus musculus. |
Family and domain databases | |
| InterPro | IPR020417. Atypical_DUSP. IPR000340. Dual-sp_phosphatase_cat-dom. IPR020422. Dual-sp_phosphatase_subgr_cat. IPR024950. DUSP. IPR000387. Tyr/Dual-sp_Pase. [Graphical view] |
| PANTHER | PTHR10159. PTHR10159. 1 hit. |
| Pfam | PF00782. DSPc. 1 hit. [Graphical view] |
| PRINTS | PR01908. ADSPHPHTASE. |
| SMART | SM00195. DSPc. 1 hit. [Graphical view] |
| PROSITE | PS00383. TYR_PHOSPHATASE_1. False negative. PS50056. TYR_PHOSPHATASE_2. 1 hit. PS50054. TYR_PHOSPHATASE_DUAL. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 357626. |
| SOURCE | Search... |
Entry information
| Entry name | DUS22_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q99N11 Secondary accession number(s): Q5SQN9, Q5SQP0 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
