Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein bicaudal C homolog 1

Gene

Bicc1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Putative RNA-binding protein. May be involved in regulating gene expression during embryonic development.

GO - Molecular functioni

GO - Biological processi

  • determination of left/right symmetry Source: MGI
  • heart development Source: MGI
  • negative regulation of canonical Wnt signaling pathway Source: MGI
Complete GO annotation...

Keywords - Molecular functioni

Developmental protein

Keywords - Ligandi

RNA-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Protein bicaudal C homolog 1
Short name:
Bic-C
Gene namesi
Name:Bicc1
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 10

Organism-specific databases

MGIiMGI:1933388. Bicc1.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 977977Protein bicaudal C homolog 1PRO_0000267715Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei27 – 271PhosphoserineCombined sources
Modified residuei32 – 321PhosphoserineCombined sources
Modified residuei45 – 451PhosphoserineCombined sources
Modified residuei400 – 4001N6-acetyllysineBy similarity
Modified residuei614 – 6141PhosphoserineCombined sources
Modified residuei681 – 6811PhosphoserineCombined sources

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

MaxQBiQ99MQ1.
PaxDbiQ99MQ1.
PRIDEiQ99MQ1.

PTM databases

iPTMnetiQ99MQ1.
PhosphoSiteiQ99MQ1.

Expressioni

Tissue specificityi

In the adult, predominantly expressed in heart and kidney. In 8 week old mice, expressed in growing primary oocytes and in the stromal cells of the theca.1 Publication

Developmental stagei

In the developing embryo, first detected at the rostral tip of the primitive streak, Hensen's node, at the late streak stage. At the late headfold stage, expression demarcates the layer of the node from which definitive endoderm and midline mesoderm arises. At 6-8 somite stage observed in the definitive endoderm. Strong expression is detected in the caudal intestinal portal. At 12-15 somite stage is still present in the hindgut, but transient expression is also seen in tissues of neural and mesodermal origins. At E13 present around all sites of cartilage formation, such as cervical vertebral bodies, ribs and Merckel's cartilage. Additionally, expressed in the derivatives of the pleuroperitoneal membrane, the diaphragm and the pericardium, as well as the mesenchyme of the developing lung. Expressed in both the mesonephros and metanephros.

Gene expression databases

BgeeiQ99MQ1.
CleanExiMM_BICC1.
ExpressionAtlasiQ99MQ1. baseline and differential.
GenevisibleiQ99MQ1. MM.

Interactioni

Subunit structurei

Interacts (via KH domains) with ANKS6 (via SAM domain) in an RNA-dependent manner. Interacts with ANKS3 (PubMed:25671767).2 Publications

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000123201.

Structurei

3D structure databases

ProteinModelPortaliQ99MQ1.
SMRiQ99MQ1. Positions 879-936.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini134 – 20168KH 1PROSITE-ProRule annotationAdd
BLAST
Domaini286 – 35065KH 2PROSITE-ProRule annotationAdd
BLAST
Domaini875 – 93864SAMPROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Belongs to the BicC family.Curated
Contains 2 KH domains.PROSITE-ProRule annotation
Contains 1 SAM (sterile alpha motif) domain.PROSITE-ProRule annotation

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiKOG2208. Eukaryota.
KOG4374. Eukaryota.
ENOG410XQFV. LUCA.
GeneTreeiENSGT00720000108747.
HOGENOMiHOG000068054.
HOVERGENiHBG058964.
InParanoidiQ99MQ1.
KOiK18756.
OMAiGSNIKHI.
OrthoDBiEOG7HQN7K.
PhylomeDBiQ99MQ1.
TreeFamiTF323767.

Family and domain databases

Gene3Di1.10.150.50. 1 hit.
3.30.1370.10. 3 hits.
InterProiIPR004087. KH_dom.
IPR004088. KH_dom_type_1.
IPR001660. SAM.
IPR013761. SAM/pointed.
[Graphical view]
PfamiPF00013. KH_1. 2 hits.
PF00536. SAM_1. 1 hit.
[Graphical view]
SMARTiSM00322. KH. 3 hits.
SM00454. SAM. 1 hit.
[Graphical view]
SUPFAMiSSF47769. SSF47769. 1 hit.
SSF54791. SSF54791. 3 hits.
PROSITEiPS50084. KH_TYPE_1. 2 hits.
PS50105. SAM_DOMAIN. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q99MQ1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MASQSEPGYL AAAQSDPGSN SERSTDSPVA GSEDDLVAAA PLLHSPEWSE
60 70 80 90 100
ERFRVDRKKL EAMLQAAAEG KGRSGEDFFQ KIMEETNTQI AWPSKLKIGA
110 120 130 140 150
KSKKDPHIKV SGKKEDVKEA KEMIMSVLDT KSNRVTLKMD VSHTEHSHVI
160 170 180 190 200
GKGGNNIKKV MEDTGCHIHF PDSNRNNQAE KSNQVSIAGQ PAGVESARAR
210 220 230 240 250
IRELLPLVLM FELPIAGILQ PVPDPNTPSI QHISQTYSVS VSFKQRSRMY
260 270 280 290 300
GATVTVRGSQ NNTNAVKEGT AMLLEHLAGS LASAIPVSTQ LDIAAQHHLF
310 320 330 340 350
MMGRNGSNVK HIMQRTGAQI HFPDPSNPQK KSTVYLQGTI ESVCLARQYL
360 370 380 390 400
MGCLPLVLMF DMKEDIEVDP QVIAQLMEQL DVFISIKPKP KQPSKSVIVK
410 420 430 440 450
SVERNALNMY EARKCLLGLE SSGVSIATSL SPASCPAGLA CPSLDILASA
460 470 480 490 500
GLGLTGLGLL GPTTLSLNTS ATPNSLLNAL NTSVSPLQSS SSGTPSPTLW
510 520 530 540 550
APPIANTASA TGFSTIPHLM LPSTAQATLT NILLSGVPTY GHTAPSPPPG
560 570 580 590 600
LTPVDVHINS MQTEGKNISA SINGHVQPAN MKYGPLSTSS LGEKVLSSNH
610 620 630 640 650
GDPSMQTAGP EQASPKSNSV EGCNDAFVEV GMPRSPSHSG NAGDLKQMLG
660 670 680 690 700
ASKVSCAKRQ TVELLQGTKN SHLHGTDRLL SDPELSATES PLADKKAPGS
710 720 730 740 750
ERAAERAAAA QQKSERARLA SQPTYVHMQA FDYEQKKLLA TKAMLKKPVV
760 770 780 790 800
TEVRTPTNTW SGLGFSKSMP AETIKELRRA NHVSYKPTMT TAYEGSSLSL
810 820 830 840 850
SRSSSREHLA SGSESDNWRD RNGIGPMGHS EFSAPIGSPK RKQNKSREHY
860 870 880 890 900
LSSSNYMDCI SSLTGSNGCN LNSCFKGSDL PELFSKLGLG KYTDVFQQQE
910 920 930 940 950
IDLQTFLTLT DQDLKELGIT TFGARRKMLL AISELSKNRR KLFEPPNASC
960 970
TSFLEGGASG RLPRQYHSDI ASVSGRW
Length:977
Mass (Da):105,037
Last modified:June 1, 2001 - v1
Checksum:i3A5A7B7F2CA84918
GO
Isoform 2 (identifier: Q99MQ1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-82: Missing.
     934-977: ELSKNRRKLFEPPNASCTSFLEGGASGRLPRQYHSDIASVSGRW → VCDSVQIRNKILRAARIL

Show »
Length:869
Mass (Da):93,406
Checksum:iA817C4F4A2B8655B
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti276 – 2761H → R in BAC40732 (PubMed:16141072).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 8282Missing in isoform 2. 1 PublicationVSP_021950Add
BLAST
Alternative sequencei934 – 97744ELSKN…VSGRW → VCDSVQIRNKILRAARIL in isoform 2. 1 PublicationVSP_021951Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF319464 mRNA. Translation: AAK27347.1.
AK089066 mRNA. Translation: BAC40732.1.
BC062174 mRNA. Translation: AAH62174.1.
BC111523 mRNA. Translation: AAI11524.1.
CCDSiCCDS23915.1. [Q99MQ1-1]
RefSeqiNP_113574.1. NM_031397.2. [Q99MQ1-1]
UniGeneiMm.286834.
Mm.458090.

Genome annotation databases

EnsembliENSMUST00000131445; ENSMUSP00000119137; ENSMUSG00000014329. [Q99MQ1-2]
ENSMUST00000143791; ENSMUSP00000123201; ENSMUSG00000014329. [Q99MQ1-1]
GeneIDi83675.
KEGGimmu:83675.
UCSCiuc007fog.2. mouse. [Q99MQ1-1]
uc033fpy.1. mouse. [Q99MQ1-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF319464 mRNA. Translation: AAK27347.1.
AK089066 mRNA. Translation: BAC40732.1.
BC062174 mRNA. Translation: AAH62174.1.
BC111523 mRNA. Translation: AAI11524.1.
CCDSiCCDS23915.1. [Q99MQ1-1]
RefSeqiNP_113574.1. NM_031397.2. [Q99MQ1-1]
UniGeneiMm.286834.
Mm.458090.

3D structure databases

ProteinModelPortaliQ99MQ1.
SMRiQ99MQ1. Positions 879-936.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000123201.

PTM databases

iPTMnetiQ99MQ1.
PhosphoSiteiQ99MQ1.

Proteomic databases

MaxQBiQ99MQ1.
PaxDbiQ99MQ1.
PRIDEiQ99MQ1.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000131445; ENSMUSP00000119137; ENSMUSG00000014329. [Q99MQ1-2]
ENSMUST00000143791; ENSMUSP00000123201; ENSMUSG00000014329. [Q99MQ1-1]
GeneIDi83675.
KEGGimmu:83675.
UCSCiuc007fog.2. mouse. [Q99MQ1-1]
uc033fpy.1. mouse. [Q99MQ1-2]

Organism-specific databases

CTDi80114.
MGIiMGI:1933388. Bicc1.

Phylogenomic databases

eggNOGiKOG2208. Eukaryota.
KOG4374. Eukaryota.
ENOG410XQFV. LUCA.
GeneTreeiENSGT00720000108747.
HOGENOMiHOG000068054.
HOVERGENiHBG058964.
InParanoidiQ99MQ1.
KOiK18756.
OMAiGSNIKHI.
OrthoDBiEOG7HQN7K.
PhylomeDBiQ99MQ1.
TreeFamiTF323767.

Miscellaneous databases

PROiQ99MQ1.
SOURCEiSearch...

Gene expression databases

BgeeiQ99MQ1.
CleanExiMM_BICC1.
ExpressionAtlasiQ99MQ1. baseline and differential.
GenevisibleiQ99MQ1. MM.

Family and domain databases

Gene3Di1.10.150.50. 1 hit.
3.30.1370.10. 3 hits.
InterProiIPR004087. KH_dom.
IPR004088. KH_dom_type_1.
IPR001660. SAM.
IPR013761. SAM/pointed.
[Graphical view]
PfamiPF00013. KH_1. 2 hits.
PF00536. SAM_1. 1 hit.
[Graphical view]
SMARTiSM00322. KH. 3 hits.
SM00454. SAM. 1 hit.
[Graphical view]
SUPFAMiSSF47769. SSF47769. 1 hit.
SSF54791. SSF54791. 3 hits.
PROSITEiPS50084. KH_TYPE_1. 2 hits.
PS50105. SAM_DOMAIN. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Identification and expression of the mammalian homologue of Bicaudal-C."
    Wessely O., Tran U., Zakin L., De Robertis E.M.
    Mech. Dev. 101:267-270(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY.
    Strain: FVB/N-3.
  2. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Strain: NOD.
    Tissue: Thymus.
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Bone.
  4. "The polycystic kidney disease-related proteins Bicc1 and SamCystin interact."
    Stagner E.E., Bouvrette D.J., Cheng J., Bryda E.C.
    Biochem. Biophys. Res. Commun. 383:16-21(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUBCELLULAR LOCATION, INTERACTION WITH ANKS6.
  5. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-27; SER-32; SER-45; SER-614 AND SER-681, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Kidney, Lung, Spleen and Testis.
  6. "Anks3 interacts with nephronophthisis proteins and is required for normal renal development."
    Yakulov T.A., Yasunaga T., Ramachandran H., Engel C., Mueller B., Hoff S., Dengjel J., Lienkamp S.S., Walz G.
    Kidney Int. 87:1191-1200(2015) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH ANKS3.

Entry informationi

Entry nameiBICC1_MOUSE
AccessioniPrimary (citable) accession number: Q99MQ1
Secondary accession number(s): Q6P6K3, Q8C286
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 12, 2006
Last sequence update: June 1, 2001
Last modified: June 8, 2016
This is version 104 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.