Reviewed,
UniProtKB/Swiss-Prot Q99MI9 (ANM7_CRILO)
Last modified
October 13, 2009.
Version 34.
History...
Clusters with 100%,
90%,
50% identity |
Documents (1) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Protein arginine N-methyltransferase 7 EC=2.1.1.- Alternative name(s): Histone-arginine N-methyltransferase PRMT7 EC=2.1.1.125 [Myelin basic protein]-arginine N-methyltransferase PRMT7 EC=2.1.1.126 | ||
| Gene names |
| ||
| Organism | Cricetulus longicaudatus (Long-tailed hamster) (Chinese hamster) | ||
| Taxonomic identifier | 10030 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Cricetidae › Cricetinae › Cricetulus |
Protein attributes
| Sequence length | 692 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Arginine methyltransferase that can both catalyze the formation of omega-N monomethylarginine (MMA) and symmetrical dimethylarginine (sDMA), with a preference for the formation of MMA. Specifically mediates the symmetrical dimethylation of arginine residues in the small nuclear ribonucleoproteins Sm D1 (SNRPD1) and Sm D3 (SNRPD3); such methylation being required for the assembly and biogenesis of snRNP core particles. Specifically mediates the symmetric dimethylation of histone H4 'Arg-3' to form H4R3sme2. Plays a role in gene imprinting by being recruited by CTCFL at the H19 imprinted control region (ICR) and methylating histone H4 to form H4R3sme2, possibly leading to recruit DNA methyltransferases at these sites. May also play a role in embryonic stem cell (ESC) pluripotency. Also able to mediate the arginine methylation of histone H2A and myelin basic protein (MBP) in vitro; the relevance of such results is however unclear in vivo By similarity. |
| Catalytic activity | S-adenosyl-L-methionine + histone-arginine = S-adenosyl-L-homocysteine + histone-N(omega)-methyl-arginine. S-adenosyl-L-methionine + [myelin basic protein]-arginine = S-adenosyl-L-homocysteine + [myelin basic protein]-N(omega)-methyl-arginine. |
| Subunit structure | Interacts with CTCFL, PRMT5 and SNRPD3 By similarity. Homodimer and heterodimer. |
| Subcellular location | |
| Miscellaneous | Confers resistance or sensitivity to DNA-damaging agents. Down-regulation confers increased sensitivity to the Top1 inhibitor camptothecin (CPT). |
| Sequence similarities | Belongs to the protein arginine N-methyltransferase family. PRMT7 subfamily. |
Ontologies
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q99MI9-2) Also known as: Alpha; p77; p78; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q99MI9-1) Also known as: Beta; p82; The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MAAALAASGMLPTADLFLRRKLTRPHFCANIEELVGNM | ||||||
| Isoform 3 (identifier: Q99MI9-3) The sequence of this isoform differs from the canonical sequence as follows: 1-37: Missing. | ||||||
| Isoform 4 (identifier: Q99MI9-4) The sequence of this isoform differs from the canonical sequence as follows: 1-94: MKVFCGRANP...AGADFCYAIE → MFRVKLWDQSQ |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||
Molecule processing | ||||||||
|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 692 | 692 | Protein arginine N-methyltransferase 7 | PRO_0000212334 | ||||
Natural variations | ||||||||
| Alternative sequence | 1 – 94 | 94 | MKVFC…CYAIE → MFRVKLWDQSQ in isoform 4. | VSP_037251 | ||||
| Alternative sequence | 1 – 37 | 37 | Missing in isoform 3. | VSP_037252 | ||||
| Alternative sequence | 1 | 1 | M → MAAALAASGMLPTADLFLRR KLTRPHFCANIEELVGNM in isoform 2. | VSP_005212 | ||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| [1] | "Identification of new drug sensitivity genes using genetic suppressor elements: protein arginine N-methyltransferase mediates cell sensitivity to DNA-damaging agents." Gros L., Delaporte C., Frey S., Decesse J., de Saint-Vincent B.R., Cavarec L., Dubart A., Gudkov A.V., Jacquemin-Sablon A. Cancer Res. 63:164-171(2003) [PubMed: 12517794] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3 AND 4). Tissue: Lung. |
| [2] | "Characterization of prmt7alpha and beta isozymes from Chinese hamster cells sensitive and resistant to topoisomerase II inhibitors." Gros L., Renodon-Corniere A., de Saint Vincent B.R., Feder M., Bujnicki J.M., Jacquemin-Sablon A. Biochim. Biophys. Acta 1760:1646-1656(2006) [PubMed: 17049166] [Abstract] Cited for: SUBUNIT, SUBCELLULAR LOCATION. |
| [3] | "Protein arginine (N)-methyl transferase 7 (PRMT7) as a potential target for the sensitization of tumor cells to camptothecins." Verbiest V., Montaudon D., Tautu M.T., Moukarzel J., Portail J.-P., Markovits J., Robert J., Ichas F., Pourquier P. FEBS Lett. 582:1483-1489(2008) [PubMed: 18381071] [Abstract] Cited for: INCREASED SENSITIVITY TO CAMPTOTHECIN. |
Cross-references
Sequence databases | |
|---|---|
| AF336043 mRNA. Translation: AAK20884.1. AF336044 mRNA. Translation: AAK20885.1. AY781113 mRNA. Translation: AAV52835.1. AY781114 mRNA. Translation: AAV52836.1. AY781115 mRNA. Translation: AAV52837.1. AY781116 mRNA. Translation: AAV52838.1. | |
3D structure databases | |
| ModBase | Search... |
Phylogenomic databases | |
| HOVERGEN | Q99MI9. |
Family and domain databases | |
| InterPro | IPR014644. Arg_N-MeTrfase. [Graphical view] |
| PIRSF | PIRSF036946. Arg_N-mtase. 1 hit. |
| ProtoNet | Search... |
Entry information
| Entry name | ANM7_CRILO | ||||||||
| Accession | Primary (citable) accession number: Q99MI9 Secondary accession number(s): Q5S3S4 Q99MJ0 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||

Clusters with


