Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Kv channel-interacting protein 4

Gene

Kcnip4

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Regulatory subunit of Kv4/D (Shal)-type voltage-gated rapidly inactivating A-type potassium channels, such as KCND2/Kv4.2 and KCND3/Kv4.3. Modulates channel expression at the cell membrane, gating characteristics, inactivation kinetics and rate of recovery from inactivation in a calcium-dependent and isoform-specific manner.3 Publications

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Calcium bindingi133 – 144121PROSITE-ProRule annotationAdd
BLAST
Calcium bindingi169 – 180122PROSITE-ProRule annotationAdd
BLAST
Calcium bindingi217 – 228123PROSITE-ProRule annotationAdd
BLAST

GO - Molecular functioni

GO - Biological processi

  • protein localization to plasma membrane Source: UniProtKB
  • regulation of potassium ion transmembrane transport Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Ion channel, Potassium channel, Voltage-gated channel

Keywords - Biological processi

Ion transport, Potassium transport, Transport

Keywords - Ligandi

Calcium, Metal-binding, Potassium

Names & Taxonomyi

Protein namesi
Recommended name:
Kv channel-interacting protein 4
Short name:
KChIP4
Alternative name(s):
A-type potassium channel modulatory protein 4
Potassium channel-interacting protein 4
Gene namesi
Name:Kcnip4
Synonyms:Kchip4
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
Proteomesi
  • UP000002494 Componenti: Unplaced

Organism-specific databases

RGDi708539. Kcnip4.

Subcellular locationi

  • Cell membrane 1 Publication; Peripheral membrane protein 1 Publication
  • Cytoplasmcytosol 1 Publication

GO - Cellular componenti

  • cytosol Source: UniProtKB
  • dendrite Source: RGD
  • membrane Source: RGD
  • neuronal cell body Source: RGD
  • plasma membrane Source: UniProtKB
  • voltage-gated potassium channel complex Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 250250Kv channel-interacting protein 4PRO_0000073828Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei17 – 171PhosphoserineBy similarity
Modified residuei56 – 561PhosphoserineBy similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ99MG9.

PTM databases

iPTMnetiQ99MG9.
PhosphoSiteiQ99MG9.

Expressioni

Tissue specificityi

Expressed in brain. Colocalizes with KCND2 in excitatory neurons including cortical and hippocampal CA1 pyramidal cells.2 Publications

Interactioni

Subunit structurei

Component of heteromultimeric potassium channels. Identified in potassium channel complexes containing KCND1, KCND2, KCND3, KCNIP1, KCNIP2, KCNIP3, KCNIP4, DPP6 and DPP10 (By similarity). Interacts with the C-terminus of PSEN2 and probably PSEN1 (By similarity). Interacts with KCND2 and KCND3 (By similarity).By similarity2 Publications

Protein-protein interaction databases

STRINGi10116.ENSRNOP00000042016.

Structurei

3D structure databases

ProteinModelPortaliQ99MG9.
SMRiQ99MG9. Positions 53-250.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini61 – 11757EF-hand 1; degeneratePROSITE-ProRule annotationAdd
BLAST
Domaini120 – 15536EF-hand 2PROSITE-ProRule annotationAdd
BLAST
Domaini156 – 19136EF-hand 3PROSITE-ProRule annotationAdd
BLAST
Domaini204 – 23936EF-hand 4PROSITE-ProRule annotationAdd
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni2 – 4443KISBy similarityAdd
BLAST
Regioni237 – 25014Interaction with KCND2By similarityAdd
BLAST

Domaini

The KIS (K-channel inactivation suppressor) domain is required for converting A-type Kv4 current to a slowly inactivating delayed rectifier potassium current.By similarity

Sequence similaritiesi

Belongs to the recoverin family.Curated
Contains 4 EF-hand domains.PROSITE-ProRule annotation

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiKOG0044. Eukaryota.
COG5126. LUCA.
HOGENOMiHOG000233019.
HOVERGENiHBG108179.
InParanoidiQ99MG9.
PhylomeDBiQ99MG9.

Family and domain databases

Gene3Di1.10.238.10. 3 hits.
InterProiIPR011992. EF-hand-dom_pair.
IPR018247. EF_Hand_1_Ca_BS.
IPR002048. EF_hand_dom.
IPR028846. Recoverin.
[Graphical view]
PANTHERiPTHR23055. PTHR23055. 1 hit.
PfamiPF13499. EF-hand_7. 1 hit.
PF13833. EF-hand_8. 1 hit.
[Graphical view]
SMARTiSM00054. EFh. 3 hits.
[Graphical view]
SUPFAMiSSF47473. SSF47473. 1 hit.
PROSITEiPS00018. EF_HAND_1. 3 hits.
PS50222. EF_HAND_2. 3 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q99MG9-1) [UniParc]FASTAAdd to basket

Also known as: KChIP4bl

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MNVRRVESIS AQLEEASSTG GFLYAQNNTK RSIKERLMKL LPCSAAKTSS
60 70 80 90 100
PAIQNSVEDE LEMATVRHRP EALELLEAQS KFTKKELQIL YRGFKNECPS
110 120 130 140 150
GVVNEETFKE IYSQFFPQGD STTYAHFLFN AFDTDHNGAV SFEDFIKGLS
160 170 180 190 200
ILLRGTVQEK LNWAFNLYDI NKDGYITKEE MLDIMKAIYD MMGKCTYPVL
210 220 230 240 250
KEDAPRQHVE TFFQKMDKNK DGVVTIDEFI ESCQKDENIM RSMQLFENVI
Length:250
Mass (Da):28,756
Last modified:June 1, 2001 - v1
Checksum:i56542298021192BF
GO
Isoform 2 (identifier: Q99MG9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     21-55: GFLYAQNNTKRSIKERLMKLLPCSAAKTSSPAIQN → D

Show »
Length:216
Mass (Da):25,008
Checksum:i17C4AFD3B4CFF23C
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei21 – 5535GFLYA…PAIQN → D in isoform 2. 1 PublicationVSP_015072Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF345444 mRNA. Translation: AAK28291.1.
AF345445 mRNA. Translation: AAK28292.1.
AF453245 mRNA. Translation: AAL86768.1.
RefSeqiNP_852030.1. NM_181365.2. [Q99MG9-1]
UniGeneiRn.205864.

Genome annotation databases

GeneIDi259243.
KEGGirno:259243.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF345444 mRNA. Translation: AAK28291.1.
AF345445 mRNA. Translation: AAK28292.1.
AF453245 mRNA. Translation: AAL86768.1.
RefSeqiNP_852030.1. NM_181365.2. [Q99MG9-1]
UniGeneiRn.205864.

3D structure databases

ProteinModelPortaliQ99MG9.
SMRiQ99MG9. Positions 53-250.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10116.ENSRNOP00000042016.

PTM databases

iPTMnetiQ99MG9.
PhosphoSiteiQ99MG9.

Proteomic databases

PaxDbiQ99MG9.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

GeneIDi259243.
KEGGirno:259243.

Organism-specific databases

CTDi80333.
RGDi708539. Kcnip4.

Phylogenomic databases

eggNOGiKOG0044. Eukaryota.
COG5126. LUCA.
HOGENOMiHOG000233019.
HOVERGENiHBG108179.
InParanoidiQ99MG9.
PhylomeDBiQ99MG9.

Miscellaneous databases

PROiQ99MG9.

Family and domain databases

Gene3Di1.10.238.10. 3 hits.
InterProiIPR011992. EF-hand-dom_pair.
IPR018247. EF_Hand_1_Ca_BS.
IPR002048. EF_hand_dom.
IPR028846. Recoverin.
[Graphical view]
PANTHERiPTHR23055. PTHR23055. 1 hit.
PfamiPF13499. EF-hand_7. 1 hit.
PF13833. EF-hand_8. 1 hit.
[Graphical view]
SMARTiSM00054. EFh. 3 hits.
[Graphical view]
SUPFAMiSSF47473. SSF47473. 1 hit.
PROSITEiPS00018. EF_HAND_1. 3 hits.
PS50222. EF_HAND_2. 3 hits.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Regulation of KChIP2 potassium channel beta subunit gene expression underlies the gradient of transient outward current in canine and human ventricle."
    Rosati B., Pan Z., Lypen S., Wang H.S., Cohen I., Dixon J.E., McKinnon D.
    J. Physiol. (Lond.) 533:119-125(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2).
  2. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, INTERACTION WITH KCND3, TISSUE SPECIFICITY.
    Strain: Sprague-Dawley.
  3. "Molecular cloning and characterization of CALP/KChIP4, a novel EF-hand protein interacting with presenilin 2 and voltage-gated potassium channel subunit Kv4."
    Morohashi Y., Hatano N., Ohya S., Takikawa R., Watabiki T., Takasugi N., Imaizumi Y., Tomita T., Iwatsubo T.
    J. Biol. Chem. 277:14965-14975(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH KCND2.
  4. "KChIPs and Kv4 alpha subunits as integral components of A-type potassium channels in mammalian brain."
    Rhodes K.J., Carroll K.I., Sung M.A., Doliveira L.C., Monaghan M.M., Burke S.L., Strassle B.W., Buchwalder L., Menegola M., Cao J., An W.F., Trimmer J.S.
    J. Neurosci. 24:7903-7915(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: TISSUE SPECIFICITY.
  5. "Convergent modulation of Kv4.2 channel alpha subunits by structurally distinct DPPX and KChIP auxiliary subunits."
    Seikel E., Trimmer J.S.
    Biochemistry 48:5721-5730(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, SUBCELLULAR LOCATION.
  6. "Quantitative maps of protein phosphorylation sites across 14 different rat organs and tissues."
    Lundby A., Secher A., Lage K., Nordsborg N.B., Dmytriyev A., Lundby C., Olsen J.V.
    Nat. Commun. 3:876-876(2012) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  7. "The stoichiometry and biophysical properties of the Kv4 potassium channel complex with K+ channel-interacting protein (KChIP) subunits are variable, depending on the relative expression level."
    Kitazawa M., Kubo Y., Nakajo K.
    J. Biol. Chem. 289:17597-17609(2014) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, SUBCELLULAR LOCATION, INTERACTION WITH KCND2.

Entry informationi

Entry nameiKCIP4_RAT
AccessioniPrimary (citable) accession number: Q99MG9
Secondary accession number(s): Q99MG8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 16, 2005
Last sequence update: June 1, 2001
Last modified: June 8, 2016
This is version 106 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.