Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Suppressor of tumorigenicity 7 protein

Gene

St7

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at transcript leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Suppressor of tumorigenicity 7 protein
Alternative name(s):
mRay
Gene namesi
Name:St7
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 6

Organism-specific databases

MGIiMGI:1927450. St7.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transmembranei15 – 35HelicalSequence analysisAdd BLAST21
Transmembranei62 – 82HelicalSequence analysisAdd BLAST21
Transmembranei512 – 532HelicalSequence analysisAdd BLAST21
Transmembranei539 – 559HelicalSequence analysisAdd BLAST21

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003392071 – 577Suppressor of tumorigenicity 7 proteinAdd BLAST577

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi47N-linked (GlcNAc...)Sequence analysis1
Modified residuei386PhosphoserineBy similarity1

Keywords - PTMi

Glycoprotein, Phosphoprotein

Proteomic databases

PaxDbiQ99M96.
PRIDEiQ99M96.

PTM databases

iPTMnetiQ99M96.
PhosphoSitePlusiQ99M96.

Expressioni

Gene expression databases

BgeeiENSMUSG00000029534.
ExpressionAtlasiQ99M96. baseline and differential.
GenevisibleiQ99M96. MM.

Interactioni

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000057326.

Structurei

3D structure databases

ProteinModelPortaliQ99M96.
SMRiQ99M96.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the ST7 family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG3807. Eukaryota.
ENOG410XQ2Z. LUCA.
GeneTreeiENSGT00390000000873.
HOVERGENiHBG054916.
InParanoidiQ99M96.
OMAiVFAKAMI.
OrthoDBiEOG091G05WJ.
PhylomeDBiQ99M96.
TreeFamiTF314162.

Family and domain databases

Gene3Di1.25.40.10. 1 hit.
InterProiIPR007311. ST7.
IPR011990. TPR-like_helical_dom.
[Graphical view]
PANTHERiPTHR12745. PTHR12745. 2 hits.
PfamiPF04184. ST7. 1 hit.
[Graphical view]

Sequences (9)i

Sequence statusi: Complete.

This entry describes 9 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q99M96-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAEAGAGFLE QLKSCIVWSW TYLWTVWFFL VLFLVYILRV PLRINDNLST
60 70 80 90 100
VSMFLNTLTP KFYVALTGTS SLISGLILIF EWWYFRKYGT SFIEQVSVSH
110 120 130 140 150
LRPLLGGVDN NSSNNSNSSN GDSDSNRQSV SECKVWRNPL NLFRGAEYNR
160 170 180 190 200
YTWVTGREPL TYYDMNLSAQ DHQTFFTCDS DHLRPADAIM QKAWRERNPQ
210 220 230 240 250
ARISAAHEAL EINEIRSRVE VPLIASSTIW EIKLLPKCAT AYILLAEEEA
260 270 280 290 300
TTIAEAEKLF KQALKAGDGC YRRSQQLQHH GSQYEAQHRR DTNVLVYIKR
310 320 330 340 350
RLAMCARRLG RTREAVKMMR DLMKEFPLLS MFNIHENLLE ALLELQAYAD
360 370 380 390 400
VQAVLAKYDD ISLPKSATIC YTAALLKARA VSDKFSPEAA SRRGLSTAEM
410 420 430 440 450
NAVEAIHRAV EFNPHVPKYL LEMKSLILPP EHILKRGDSE AIAYAFFHLA
460 470 480 490 500
HWKRVEGALN LLHCTWEGTF RMIPYPLEKG HLFYPYPICT ETADRELLPS
510 520 530 540 550
FHEVSVYPKK ELPFFILFTA GLCSFTAMLA LLTHQFPELM GVFAKAFLST
560 570
LFAPLNFVME KVESILPSSL WHQLTRI
Length:577
Mass (Da):66,095
Last modified:June 1, 2001 - v1
Checksum:i23E90053FAEBB71F
GO
Isoform 2 (identifier: Q99M96-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     464-469: CTWEGT → S

Show »
Length:572
Mass (Da):65,505
Checksum:i800B3B7052A20B1C
GO
Isoform 3 (identifier: Q99M96-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     215-237: Missing.

Show »
Length:554
Mass (Da):63,464
Checksum:iA65B3610D2525701
GO
Isoform 4 (identifier: Q99M96-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-51: MAEAGAGFLE...LRINDNLSTV → MQEGKQITCSHVKLLPSRLPEHAFM
     215-237: Missing.

Show »
Length:528
Mass (Da):60,321
Checksum:iD3A25B6A12F40666
GO
Isoform 5 (identifier: Q99M96-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-51: MAEAGAGFLE...LRINDNLSTV → MQEGKQITCSHVKLLPSRLPEHAFM

Show »
Length:551
Mass (Da):62,953
Checksum:i65A172902C8C6FB4
GO
Isoform 6 (identifier: Q99M96-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-19: Missing.
     20-50: WTYLWTVWFFLVLFLVYILRVPLRINDNLST → MKYA

Show »
Length:531
Mass (Da):60,682
Checksum:i7BE7FD826A2A45BB
GO
Isoform 7 (identifier: Q99M96-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-19: Missing.
     20-50: WTYLWTVWFFLVLFLVYILRVPLRINDNLST → MKYA
     215-237: Missing.

Show »
Length:508
Mass (Da):58,051
Checksum:i66A46480F5CA3AEB
GO
Isoform 8 (identifier: Q99M96-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-26: Missing.
     27-51: WFFLVLFLVYILRVPLRINDNLSTV → MFGTESSL

Show »
Length:534
Mass (Da):60,942
Checksum:i3460D7C19A6CA82A
GO
Isoform 9 (identifier: Q99M96-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-26: Missing.
     27-51: WFFLVLFLVYILRVPLRINDNLSTV → MFGTESSL
     215-237: Missing.

Show »
Length:511
Mass (Da):58,311
Checksum:i0ECD998EB214827F
GO

Sequence cautioni

The sequence AAH12719 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti102R → C in AAG24465 (PubMed:11279520).Curated1
Sequence conflicti102R → C in AAG24464 (PubMed:11279520).Curated1
Sequence conflicti308R → G in BAE30495 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0341181 – 51MAEAG…NLSTV → MQEGKQITCSHVKLLPSRLP EHAFM in isoform 4 and isoform 5. 1 PublicationAdd BLAST51
Alternative sequenceiVSP_0341191 – 26Missing in isoform 8 and isoform 9. 6 PublicationsAdd BLAST26
Alternative sequenceiVSP_0341201 – 19Missing in isoform 6 and isoform 7. 1 PublicationAdd BLAST19
Alternative sequenceiVSP_03412120 – 50WTYLW…DNLST → MKYA in isoform 6 and isoform 7. 1 PublicationAdd BLAST31
Alternative sequenceiVSP_03412227 – 51WFFLV…NLSTV → MFGTESSL in isoform 8 and isoform 9. 6 PublicationsAdd BLAST25
Alternative sequenceiVSP_034123215 – 237Missing in isoform 3, isoform 4, isoform 7 and isoform 9. 6 PublicationsAdd BLAST23
Alternative sequenceiVSP_034124464 – 469CTWEGT → S in isoform 2. 1 Publication6

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF234885 mRNA. Translation: AAF85948.1.
AF234884 mRNA. Translation: AAF85947.1.
AY007792 mRNA. Translation: AAG24458.1.
AY007794 mRNA. Translation: AAG24460.1.
AY007795 mRNA. Translation: AAG24461.1.
AY007796 mRNA. Translation: AAG24462.1.
AY007797 mRNA. Translation: AAG24463.1.
AY007798 mRNA. Translation: AAG24464.1.
AY007799 mRNA. Translation: AAG24465.1.
AY551821 mRNA. Translation: AAS59839.1.
AY551822 mRNA. Translation: AAS59840.1.
AK132103 mRNA. Translation: BAE20983.1.
AK151550 mRNA. Translation: BAE30495.1.
CT010245 mRNA. Translation: CAJ18453.1.
BC012719 mRNA. Translation: AAH12719.1. Different initiation.
BC024652 mRNA. Translation: AAH24652.1.
BC108418 mRNA. Translation: AAI08419.1.
CCDSiCCDS19927.1. [Q99M96-8]
CCDS39431.1. [Q99M96-9]
CCDS71728.1. [Q99M96-1]
CCDS71729.1. [Q99M96-3]
CCDS71730.1. [Q99M96-6]
CCDS71731.1. [Q99M96-7]
CCDS80490.1. [Q99M96-2]
RefSeqiNP_001076784.1. NM_001083315.2. [Q99M96-9]
NP_001276553.1. NM_001289624.1. [Q99M96-1]
NP_001276554.1. NM_001289625.1. [Q99M96-2]
NP_001276556.1. NM_001289627.1. [Q99M96-6]
NP_001276558.1. NM_001289629.1. [Q99M96-7]
NP_071727.2. NM_022332.3. [Q99M96-8]
XP_011239376.1. XM_011241074.1. [Q99M96-1]
UniGeneiMm.12051.

Genome annotation databases

EnsembliENSMUST00000000674; ENSMUSP00000000674; ENSMUSG00000029534. [Q99M96-7]
ENSMUST00000052113; ENSMUSP00000062886; ENSMUSG00000029534. [Q99M96-3]
ENSMUST00000053148; ENSMUSP00000057326; ENSMUSG00000029534. [Q99M96-8]
ENSMUST00000077080; ENSMUSP00000076334; ENSMUSG00000029534. [Q99M96-6]
ENSMUST00000081635; ENSMUSP00000080341; ENSMUSG00000029534. [Q99M96-1]
ENSMUST00000115417; ENSMUSP00000111077; ENSMUSG00000029534. [Q99M96-9]
ENSMUST00000115419; ENSMUSP00000111079; ENSMUSG00000029534. [Q99M96-2]
GeneIDi64213.
KEGGimmu:64213.
UCSCiuc009azu.2. mouse. [Q99M96-2]
uc009azv.2. mouse. [Q99M96-1]
uc009azx.2. mouse. [Q99M96-7]
uc009azy.2. mouse. [Q99M96-6]
uc009bac.2. mouse. [Q99M96-8]
uc009bae.2. mouse. [Q99M96-9]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF234885 mRNA. Translation: AAF85948.1.
AF234884 mRNA. Translation: AAF85947.1.
AY007792 mRNA. Translation: AAG24458.1.
AY007794 mRNA. Translation: AAG24460.1.
AY007795 mRNA. Translation: AAG24461.1.
AY007796 mRNA. Translation: AAG24462.1.
AY007797 mRNA. Translation: AAG24463.1.
AY007798 mRNA. Translation: AAG24464.1.
AY007799 mRNA. Translation: AAG24465.1.
AY551821 mRNA. Translation: AAS59839.1.
AY551822 mRNA. Translation: AAS59840.1.
AK132103 mRNA. Translation: BAE20983.1.
AK151550 mRNA. Translation: BAE30495.1.
CT010245 mRNA. Translation: CAJ18453.1.
BC012719 mRNA. Translation: AAH12719.1. Different initiation.
BC024652 mRNA. Translation: AAH24652.1.
BC108418 mRNA. Translation: AAI08419.1.
CCDSiCCDS19927.1. [Q99M96-8]
CCDS39431.1. [Q99M96-9]
CCDS71728.1. [Q99M96-1]
CCDS71729.1. [Q99M96-3]
CCDS71730.1. [Q99M96-6]
CCDS71731.1. [Q99M96-7]
CCDS80490.1. [Q99M96-2]
RefSeqiNP_001076784.1. NM_001083315.2. [Q99M96-9]
NP_001276553.1. NM_001289624.1. [Q99M96-1]
NP_001276554.1. NM_001289625.1. [Q99M96-2]
NP_001276556.1. NM_001289627.1. [Q99M96-6]
NP_001276558.1. NM_001289629.1. [Q99M96-7]
NP_071727.2. NM_022332.3. [Q99M96-8]
XP_011239376.1. XM_011241074.1. [Q99M96-1]
UniGeneiMm.12051.

3D structure databases

ProteinModelPortaliQ99M96.
SMRiQ99M96.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000057326.

PTM databases

iPTMnetiQ99M96.
PhosphoSitePlusiQ99M96.

Proteomic databases

PaxDbiQ99M96.
PRIDEiQ99M96.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000000674; ENSMUSP00000000674; ENSMUSG00000029534. [Q99M96-7]
ENSMUST00000052113; ENSMUSP00000062886; ENSMUSG00000029534. [Q99M96-3]
ENSMUST00000053148; ENSMUSP00000057326; ENSMUSG00000029534. [Q99M96-8]
ENSMUST00000077080; ENSMUSP00000076334; ENSMUSG00000029534. [Q99M96-6]
ENSMUST00000081635; ENSMUSP00000080341; ENSMUSG00000029534. [Q99M96-1]
ENSMUST00000115417; ENSMUSP00000111077; ENSMUSG00000029534. [Q99M96-9]
ENSMUST00000115419; ENSMUSP00000111079; ENSMUSG00000029534. [Q99M96-2]
GeneIDi64213.
KEGGimmu:64213.
UCSCiuc009azu.2. mouse. [Q99M96-2]
uc009azv.2. mouse. [Q99M96-1]
uc009azx.2. mouse. [Q99M96-7]
uc009azy.2. mouse. [Q99M96-6]
uc009bac.2. mouse. [Q99M96-8]
uc009bae.2. mouse. [Q99M96-9]

Organism-specific databases

CTDi7982.
MGIiMGI:1927450. St7.

Phylogenomic databases

eggNOGiKOG3807. Eukaryota.
ENOG410XQ2Z. LUCA.
GeneTreeiENSGT00390000000873.
HOVERGENiHBG054916.
InParanoidiQ99M96.
OMAiVFAKAMI.
OrthoDBiEOG091G05WJ.
PhylomeDBiQ99M96.
TreeFamiTF314162.

Miscellaneous databases

ChiTaRSiSt7. mouse.
PROiQ99M96.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000029534.
ExpressionAtlasiQ99M96. baseline and differential.
GenevisibleiQ99M96. MM.

Family and domain databases

Gene3Di1.25.40.10. 1 hit.
InterProiIPR007311. ST7.
IPR011990. TPR-like_helical_dom.
[Graphical view]
PANTHERiPTHR12745. PTHR12745. 2 hits.
PfamiPF04184. ST7. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiST7_MOUSE
AccessioniPrimary (citable) accession number: Q99M96
Secondary accession number(s): Q3UA20
, Q6Q9W2, Q6Q9W3, Q8R3T3, Q921F6, Q99M89, Q99M90, Q99M91, Q99M92, Q99M93, Q99M94, Q9JID7, Q9JID8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 10, 2008
Last sequence update: June 1, 2001
Last modified: November 2, 2016
This is version 105 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.