SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q99M31

- HSP7E_MOUSE

UniProt

Q99M31 - HSP7E_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Heat shock 70 kDa protein 14
Gene
Hspa14, Hsp70-4
Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 3 out of 5 - Experimental evidence at transcript leveli

Functioni

Component of the ribosome-associated complex (RAC), a complex involved in folding or maintaining nascent polypeptides in a folding-competent state. In the RAC complex, binds to the nascent polypeptide chain, while DNAJC2 stimulates its ATPase activity By similarity.

GO - Molecular functioni

  1. ATP binding Source: UniProtKB-KW
Complete GO annotation...

Keywords - Molecular functioni

Chaperone

Keywords - Ligandi

ATP-binding, Nucleotide-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Heat shock 70 kDa protein 14
Alternative name(s):
NST-1
hsr.1
Gene namesi
Name:Hspa14
Synonyms:Hsp70-4
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 2

Organism-specific databases

MGIiMGI:1354164. Hspa14.

Subcellular locationi

Cytoplasmcytosol By similarity

GO - Cellular componenti

  1. cytosol Source: UniProtKB
  2. ribosome Source: Ensembl
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 509509Heat shock 70 kDa protein 14
PRO_0000289947Add
BLAST

Proteomic databases

MaxQBiQ99M31.
PaxDbiQ99M31.
PRIDEiQ99M31.

PTM databases

PhosphoSiteiQ99M31.

Expressioni

Gene expression databases

ArrayExpressiQ99M31.
BgeeiQ99M31.
CleanExiMM_HSPA14.
GenevestigatoriQ99M31.

Interactioni

Subunit structurei

Component of ribosome-associated complex (RAC), a heterodimer composed of Hsp70/DnaK-type chaperone HSPA14 and Hsp40/DnaJ-type chaperone DNAJC2 By similarity.

Structurei

3D structure databases

ProteinModelPortaliQ99M31.
SMRiQ99M31. Positions 3-505.

Family & Domainsi

Sequence similaritiesi

Phylogenomic databases

eggNOGiCOG0443.
GeneTreeiENSGT00750000117237.
HOGENOMiHOG000228135.
HOVERGENiHBG099873.
InParanoidiQ99M31.
OMAiSLMIECS.
OrthoDBiEOG73804J.
PhylomeDBiQ99M31.
TreeFamiTF105045.

Family and domain databases

Gene3Di2.60.34.10. 1 hit.
InterProiIPR018181. Heat_shock_70_CS.
IPR029047. HSP70_peptide-bd.
IPR013126. Hsp_70_fam.
[Graphical view]
PfamiPF00012. HSP70. 1 hit.
[Graphical view]
PRINTSiPR00301. HEATSHOCK70.
SUPFAMiSSF100920. SSF100920. 1 hit.
PROSITEiPS01036. HSP70_3. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q99M31-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MAAIGVHLGC TSACVAVYKD GRADVVANDA GDRVTPAIVA YSEREQVVGL    50
AAKQSRIRHV SSTVVKVKQI LGRSSADPQA QKYISESKCL VIEKNGKLRY 100
EIDTGEETKL VNPEDVARLI FSKMKETAHS VLGSDANDVV VTVPFDFGEK 150
QKSALGEAAG AAGFNVLRLI HEPSAALLAY GIGQDHPTGK SNVLVFKLGG 200
TSLSLSVMEV NSGMYRVLST NTSDNIGGAH FTDTLAQYLA SEFQRLFKHD 250
VRGNARAMMK LMNSAEVAKH SLSTLGSANC FVDSLYEGQD FDCNVSRARF 300
ELLCSPLFNK CTEAIRELLR QTGFTADDIN KVVLCGGSSR IPKLQQLIKD 350
LFPAVDLLNS IPPDEVIPIG AAIEAGILVG KESTSGDDSV MIECSAKDIL 400
VKGVDESGAD RFTVLFPSGT PLPARRQHTL QAPGRVSSVC LELYESEGKN 450
SAKEEAKFAQ VVLQDLDKKE NGLRDILAVL TMKRDGSLQV TCTDQDTGKC 500
EAITVEVAS 509
Length:509
Mass (Da):54,650
Last modified:May 29, 2007 - v2
Checksum:iD27133C677373DB0
GO
Isoform 2 (identifier: Q99M31-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     485-509: DGSLQVTCTDQDTGKCEAITVEVAS → YKMKCFQYYEDSLKLGPFGAWLNYHSRQILC

Note: No experimental confirmation available.

Show »
Length:515
Mass (Da):55,883
Checksum:iA8671B288E6A9C23
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei485 – 50925DGSLQ…VEVAS → YKMKCFQYYEDSLKLGPFGA WLNYHSRQILC in isoform 2.
VSP_026032Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti229 – 2291A → G in AAA17724. 1 Publication
Sequence conflicti237 – 2371Q → R in AAH02056. 1 Publication
Sequence conflicti335 – 3351C → WHE in AAA17724. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U08215 mRNA. Translation: AAA17724.1.
AK145937 mRNA. Translation: BAE26767.1.
AK153397 mRNA. Translation: BAE31959.1.
AL732620 Genomic DNA. Translation: CAM16049.1.
BC002056 mRNA. Translation: AAH02056.1.
CCDSiCCDS15653.1. [Q99M31-1]
RefSeqiNP_056580.2. NM_015765.2. [Q99M31-1]
XP_006497566.1. XM_006497503.1. [Q99M31-2]
UniGeneiMm.89341.

Genome annotation databases

EnsembliENSMUST00000027961; ENSMUSP00000027961; ENSMUSG00000051396. [Q99M31-1]
GeneIDi50497.
KEGGimmu:50497.
UCSCiuc008ief.1. mouse. [Q99M31-1]
uc008ieg.1. mouse. [Q99M31-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U08215 mRNA. Translation: AAA17724.1 .
AK145937 mRNA. Translation: BAE26767.1 .
AK153397 mRNA. Translation: BAE31959.1 .
AL732620 Genomic DNA. Translation: CAM16049.1 .
BC002056 mRNA. Translation: AAH02056.1 .
CCDSi CCDS15653.1. [Q99M31-1 ]
RefSeqi NP_056580.2. NM_015765.2. [Q99M31-1 ]
XP_006497566.1. XM_006497503.1. [Q99M31-2 ]
UniGenei Mm.89341.

3D structure databases

ProteinModelPortali Q99M31.
SMRi Q99M31. Positions 3-505.
ModBasei Search...
MobiDBi Search...

PTM databases

PhosphoSitei Q99M31.

Proteomic databases

MaxQBi Q99M31.
PaxDbi Q99M31.
PRIDEi Q99M31.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000027961 ; ENSMUSP00000027961 ; ENSMUSG00000051396 . [Q99M31-1 ]
GeneIDi 50497.
KEGGi mmu:50497.
UCSCi uc008ief.1. mouse. [Q99M31-1 ]
uc008ieg.1. mouse. [Q99M31-2 ]

Organism-specific databases

CTDi 51182.
MGIi MGI:1354164. Hspa14.

Phylogenomic databases

eggNOGi COG0443.
GeneTreei ENSGT00750000117237.
HOGENOMi HOG000228135.
HOVERGENi HBG099873.
InParanoidi Q99M31.
OMAi SLMIECS.
OrthoDBi EOG73804J.
PhylomeDBi Q99M31.
TreeFami TF105045.

Miscellaneous databases

NextBioi 307490.
PROi Q99M31.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q99M31.
Bgeei Q99M31.
CleanExi MM_HSPA14.
Genevestigatori Q99M31.

Family and domain databases

Gene3Di 2.60.34.10. 1 hit.
InterProi IPR018181. Heat_shock_70_CS.
IPR029047. HSP70_peptide-bd.
IPR013126. Hsp_70_fam.
[Graphical view ]
Pfami PF00012. HSP70. 1 hit.
[Graphical view ]
PRINTSi PR00301. HEATSHOCK70.
SUPFAMi SSF100920. SSF100920. 1 hit.
PROSITEi PS01036. HSP70_3. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "The molecular cloning and characterization of NST-1 (hsr.1), a novel member of the Hsp70 superfamily."
    Yang C.
    Thesis (1994), Rockefeller University, United States
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Brain.
  2. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA].
    Strain: C57BL/6J.
    Tissue: Bone marrow and Placenta.
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: C57BL/6J.
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Strain: Czech II.
    Tissue: Mammary tumor.

Entry informationi

Entry nameiHSP7E_MOUSE
AccessioniPrimary (citable) accession number: Q99M31
Secondary accession number(s): A2AJH7, Q3U5W7, Q60637
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 29, 2007
Last sequence update: May 29, 2007
Last modified: July 9, 2014
This is version 97 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi