Q99M31 (HSP7E_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 29, 2013.
Version 87.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Heat shock 70 kDa protein 14 Alternative name(s): NST-1 hsr.1 | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 509 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | Component of the ribosome-associated complex (RAC), a complex involved in folding or maintaining nascent polypeptides in a folding-competent state. In the RAC complex, binds to the nascent polypeptide chain, while DNAJC2 stimulates its ATPase activity By similarity. |
| Subunit structure | Component of ribosome-associated complex (RAC), a heterodimer composed of Hsp70/DnaK-type chaperone HSPA14 and Hsp40/DnaJ-type chaperone DNAJC2 By similarity. |
| Subcellular location | |
| Sequence similarities | Belongs to the heat shock protein 70 family. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cytoplasm |
| Coding sequence diversity | Alternative splicing |
| Ligand | ATP-binding Nucleotide-binding |
| Molecular function | Chaperone |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular_component | cytosol Inferred from sequence or structural similarity. Source: UniProtKB ribosomeInferred from electronic annotation. Source: Compara |
| Molecular_function | ATP binding Inferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q99M31-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q99M31-2) The sequence of this isoform differs from the canonical sequence as follows: 485-509: DGSLQVTCTDQDTGKCEAITVEVAS → YKMKCFQYYEDSLKLGPFGAWLNYHSRQILC | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 509 | 509 | Heat shock 70 kDa protein 14 | PRO_0000289947 | |||||
Natural variations | |||||||||
| Alternative sequence | 485 – 509 | 25 | DGSLQ…VEVAS → YKMKCFQYYEDSLKLGPFGA WLNYHSRQILC in isoform 2. | VSP_026032 | |||||
Experimental info | |||||||||
| Sequence conflict | 229 | 1 | A → G in AAA17724. Ref.1 | ||||||
| Sequence conflict | 237 | 1 | Q → R in AAH02056. Ref.3 | ||||||
| Sequence conflict | 335 | 1 | C → WHE in AAA17724. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "The molecular cloning and characterization of NST-1 (hsr.1), a novel member of the Hsp70 superfamily." Yang C. Thesis (1994), Rockefeller University, United States Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Brain. |
| [2] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA]. Strain: C57BL/6J. Tissue: Bone marrow and Placenta. |
| [3] | "Lineage-specific biology revealed by a finished genome assembly of the mouse." Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S. Ponting C.P.PLoS Biol. 7:E1000112-E1000112(2009) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: C57BL/6J. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Strain: Czech II. Tissue: Mammary tumor. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | U08215 mRNA. Translation: AAA17724.1. AK145937 mRNA. Translation: BAE26767.1. AK153397 mRNA. Translation: BAE31959.1. AL732620 Genomic DNA. Translation: CAM16049.1. BC002056 mRNA. Translation: AAH02056.1. |
| IPI | IPI00119066. IPI00652428. |
| RefSeq | NP_056580.2. NM_015765.2. |
| UniGene | Mm.89341. |
3D structure databases | |
| ProteinModelPortal | Q99M31. |
| SMR | Q99M31. Positions 3-505. |
| ModBase | Search... |
PTM databases | |
| PhosphoSite | Q99M31. |
Proteomic databases | |
| PaxDb | Q99M31. |
| PRIDE | Q99M31. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSMUST00000027961; ENSMUSP00000027961; ENSMUSG00000051396. |
| GeneID | 50497. |
| KEGG | mmu:50497. |
| UCSC | uc008ief.1. mouse. uc008ieg.1. mouse. |
Organism-specific databases | |
| CTD | 51182. |
| MGI | MGI:1354164. Hspa14. |
Phylogenomic databases | |
| eggNOG | COG0443. |
| GeneTree | ENSGT00550000074467. |
| HOGENOM | HOG000228135. |
| HOVERGEN | HBG099873. |
| InParanoid | Q99M31. |
| OMA | KMKETAH. |
| OrthoDB | EOG4S7JPV. |
Gene expression databases | |
| ArrayExpress | Q99M31. |
| Bgee | Q99M31. |
| CleanEx | MM_HSPA14. |
| Genevestigator | Q99M31. |
Family and domain databases | |
| InterPro | IPR018181. Heat_shock_70_CS. IPR013126. Hsp_70_fam. [Graphical view] |
| Pfam | PF00012. HSP70. 1 hit. [Graphical view] |
| PRINTS | PR00301. HEATSHOCK70. |
| PROSITE | PS00297. HSP70_1. False negative. PS00329. HSP70_2. False negative. PS01036. HSP70_3. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 307490. |
| SOURCE | Search... |
Entry information
| Entry name | HSP7E_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q99M31 Secondary accession number(s): A2AJH7, Q3U5W7, Q60637 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
