Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q99M31

- HSP7E_MOUSE

UniProt

Q99M31 - HSP7E_MOUSE

Protein

Heat shock 70 kDa protein 14

Gene

Hspa14

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 2 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 98 (01 Oct 2014)
      Sequence version 2 (29 May 2007)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Component of the ribosome-associated complex (RAC), a complex involved in folding or maintaining nascent polypeptides in a folding-competent state. In the RAC complex, binds to the nascent polypeptide chain, while DNAJC2 stimulates its ATPase activity By similarity.By similarity

    GO - Molecular functioni

    1. ATP binding Source: UniProtKB-KW

    Keywords - Molecular functioni

    Chaperone

    Keywords - Ligandi

    ATP-binding, Nucleotide-binding

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Heat shock 70 kDa protein 14
    Alternative name(s):
    NST-1
    hsr.1
    Gene namesi
    Name:Hspa14
    Synonyms:Hsp70-4
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 2

    Organism-specific databases

    MGIiMGI:1354164. Hspa14.

    Subcellular locationi

    Cytoplasmcytosol By similarity

    GO - Cellular componenti

    1. cytosol Source: UniProtKB
    2. ribosome Source: Ensembl

    Keywords - Cellular componenti

    Cytoplasm

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 509509Heat shock 70 kDa protein 14PRO_0000289947Add
    BLAST

    Proteomic databases

    MaxQBiQ99M31.
    PaxDbiQ99M31.
    PRIDEiQ99M31.

    PTM databases

    PhosphoSiteiQ99M31.

    Expressioni

    Gene expression databases

    ArrayExpressiQ99M31.
    BgeeiQ99M31.
    CleanExiMM_HSPA14.
    GenevestigatoriQ99M31.

    Interactioni

    Subunit structurei

    Component of ribosome-associated complex (RAC), a heterodimer composed of Hsp70/DnaK-type chaperone HSPA14 and Hsp40/DnaJ-type chaperone DNAJC2.By similarity

    Structurei

    3D structure databases

    ProteinModelPortaliQ99M31.
    SMRiQ99M31. Positions 3-505.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the heat shock protein 70 family.Curated

    Phylogenomic databases

    eggNOGiCOG0443.
    GeneTreeiENSGT00750000117237.
    HOGENOMiHOG000228135.
    HOVERGENiHBG099873.
    InParanoidiQ99M31.
    OMAiSLMIECS.
    OrthoDBiEOG73804J.
    PhylomeDBiQ99M31.
    TreeFamiTF105045.

    Family and domain databases

    Gene3Di2.60.34.10. 1 hit.
    InterProiIPR018181. Heat_shock_70_CS.
    IPR029047. HSP70_peptide-bd.
    IPR013126. Hsp_70_fam.
    [Graphical view]
    PfamiPF00012. HSP70. 1 hit.
    [Graphical view]
    PRINTSiPR00301. HEATSHOCK70.
    SUPFAMiSSF100920. SSF100920. 1 hit.
    PROSITEiPS01036. HSP70_3. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q99M31-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MAAIGVHLGC TSACVAVYKD GRADVVANDA GDRVTPAIVA YSEREQVVGL    50
    AAKQSRIRHV SSTVVKVKQI LGRSSADPQA QKYISESKCL VIEKNGKLRY 100
    EIDTGEETKL VNPEDVARLI FSKMKETAHS VLGSDANDVV VTVPFDFGEK 150
    QKSALGEAAG AAGFNVLRLI HEPSAALLAY GIGQDHPTGK SNVLVFKLGG 200
    TSLSLSVMEV NSGMYRVLST NTSDNIGGAH FTDTLAQYLA SEFQRLFKHD 250
    VRGNARAMMK LMNSAEVAKH SLSTLGSANC FVDSLYEGQD FDCNVSRARF 300
    ELLCSPLFNK CTEAIRELLR QTGFTADDIN KVVLCGGSSR IPKLQQLIKD 350
    LFPAVDLLNS IPPDEVIPIG AAIEAGILVG KESTSGDDSV MIECSAKDIL 400
    VKGVDESGAD RFTVLFPSGT PLPARRQHTL QAPGRVSSVC LELYESEGKN 450
    SAKEEAKFAQ VVLQDLDKKE NGLRDILAVL TMKRDGSLQV TCTDQDTGKC 500
    EAITVEVAS 509
    Length:509
    Mass (Da):54,650
    Last modified:May 29, 2007 - v2
    Checksum:iD27133C677373DB0
    GO
    Isoform 2 (identifier: Q99M31-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         485-509: DGSLQVTCTDQDTGKCEAITVEVAS → YKMKCFQYYEDSLKLGPFGAWLNYHSRQILC

    Note: No experimental confirmation available.

    Show »
    Length:515
    Mass (Da):55,883
    Checksum:iA8671B288E6A9C23
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti229 – 2291A → G in AAA17724. 1 PublicationCurated
    Sequence conflicti237 – 2371Q → R in AAH02056. (PubMed:19468303)Curated
    Sequence conflicti335 – 3351C → WHE in AAA17724. 1 PublicationCurated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei485 – 50925DGSLQ…VEVAS → YKMKCFQYYEDSLKLGPFGA WLNYHSRQILC in isoform 2. CuratedVSP_026032Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U08215 mRNA. Translation: AAA17724.1.
    AK145937 mRNA. Translation: BAE26767.1.
    AK153397 mRNA. Translation: BAE31959.1.
    AL732620 Genomic DNA. Translation: CAM16049.1.
    BC002056 mRNA. Translation: AAH02056.1.
    CCDSiCCDS15653.1. [Q99M31-1]
    RefSeqiNP_056580.2. NM_015765.2. [Q99M31-1]
    XP_006497566.1. XM_006497503.1. [Q99M31-2]
    UniGeneiMm.89341.

    Genome annotation databases

    EnsembliENSMUST00000027961; ENSMUSP00000027961; ENSMUSG00000051396. [Q99M31-1]
    GeneIDi50497.
    KEGGimmu:50497.
    UCSCiuc008ief.1. mouse. [Q99M31-1]
    uc008ieg.1. mouse. [Q99M31-2]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U08215 mRNA. Translation: AAA17724.1 .
    AK145937 mRNA. Translation: BAE26767.1 .
    AK153397 mRNA. Translation: BAE31959.1 .
    AL732620 Genomic DNA. Translation: CAM16049.1 .
    BC002056 mRNA. Translation: AAH02056.1 .
    CCDSi CCDS15653.1. [Q99M31-1 ]
    RefSeqi NP_056580.2. NM_015765.2. [Q99M31-1 ]
    XP_006497566.1. XM_006497503.1. [Q99M31-2 ]
    UniGenei Mm.89341.

    3D structure databases

    ProteinModelPortali Q99M31.
    SMRi Q99M31. Positions 3-505.
    ModBasei Search...
    MobiDBi Search...

    PTM databases

    PhosphoSitei Q99M31.

    Proteomic databases

    MaxQBi Q99M31.
    PaxDbi Q99M31.
    PRIDEi Q99M31.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000027961 ; ENSMUSP00000027961 ; ENSMUSG00000051396 . [Q99M31-1 ]
    GeneIDi 50497.
    KEGGi mmu:50497.
    UCSCi uc008ief.1. mouse. [Q99M31-1 ]
    uc008ieg.1. mouse. [Q99M31-2 ]

    Organism-specific databases

    CTDi 51182.
    MGIi MGI:1354164. Hspa14.

    Phylogenomic databases

    eggNOGi COG0443.
    GeneTreei ENSGT00750000117237.
    HOGENOMi HOG000228135.
    HOVERGENi HBG099873.
    InParanoidi Q99M31.
    OMAi SLMIECS.
    OrthoDBi EOG73804J.
    PhylomeDBi Q99M31.
    TreeFami TF105045.

    Miscellaneous databases

    NextBioi 307490.
    PROi Q99M31.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q99M31.
    Bgeei Q99M31.
    CleanExi MM_HSPA14.
    Genevestigatori Q99M31.

    Family and domain databases

    Gene3Di 2.60.34.10. 1 hit.
    InterProi IPR018181. Heat_shock_70_CS.
    IPR029047. HSP70_peptide-bd.
    IPR013126. Hsp_70_fam.
    [Graphical view ]
    Pfami PF00012. HSP70. 1 hit.
    [Graphical view ]
    PRINTSi PR00301. HEATSHOCK70.
    SUPFAMi SSF100920. SSF100920. 1 hit.
    PROSITEi PS01036. HSP70_3. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "The molecular cloning and characterization of NST-1 (hsr.1), a novel member of the Hsp70 superfamily."
      Yang C.
      Thesis (1994), Rockefeller University, United States
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Tissue: Brain.
    2. "The transcriptional landscape of the mammalian genome."
      Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
      , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
      Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA].
      Strain: C57BL/6J.
      Tissue: Bone marrow and Placenta.
    3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
      Strain: C57BL/6J.
    4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Strain: Czech II.
      Tissue: Mammary tumor.

    Entry informationi

    Entry nameiHSP7E_MOUSE
    AccessioniPrimary (citable) accession number: Q99M31
    Secondary accession number(s): A2AJH7, Q3U5W7, Q60637
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: May 29, 2007
    Last sequence update: May 29, 2007
    Last modified: October 1, 2014
    This is version 98 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3