Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q99M31 (HSP7E_MOUSE) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 97. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Heat shock 70 kDa protein 14
Alternative name(s):
NST-1
hsr.1
Gene names
Name:Hspa14
Synonyms:Hsp70-4
OrganismMus musculus (Mouse) [Reference proteome]
Taxonomic identifier10090 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus

Protein attributes

Sequence length509 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Function

Component of the ribosome-associated complex (RAC), a complex involved in folding or maintaining nascent polypeptides in a folding-competent state. In the RAC complex, binds to the nascent polypeptide chain, while DNAJC2 stimulates its ATPase activity By similarity.

Subunit structure

Component of ribosome-associated complex (RAC), a heterodimer composed of Hsp70/DnaK-type chaperone HSPA14 and Hsp40/DnaJ-type chaperone DNAJC2 By similarity.

Subcellular location

Cytoplasmcytosol By similarity.

Sequence similarities

Belongs to the heat shock protein 70 family.

Ontologies

Keywords
   Cellular componentCytoplasm
   Coding sequence diversityAlternative splicing
   LigandATP-binding
Nucleotide-binding
   Molecular functionChaperone
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Cellular_componentcytosol

Inferred from sequence or structural similarity. Source: UniProtKB

ribosome

Inferred from electronic annotation. Source: Ensembl

   Molecular_functionATP binding

Inferred from electronic annotation. Source: UniProtKB-KW

Complete GO annotation...

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q99M31-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q99M31-2)

The sequence of this isoform differs from the canonical sequence as follows:
     485-509: DGSLQVTCTDQDTGKCEAITVEVAS → YKMKCFQYYEDSLKLGPFGAWLNYHSRQILC
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 509509Heat shock 70 kDa protein 14
PRO_0000289947

Natural variations

Alternative sequence485 – 50925DGSLQ…VEVAS → YKMKCFQYYEDSLKLGPFGA WLNYHSRQILC in isoform 2.
VSP_026032

Experimental info

Sequence conflict2291A → G in AAA17724. Ref.1
Sequence conflict2371Q → R in AAH02056. Ref.3
Sequence conflict3351C → WHE in AAA17724. Ref.1

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified May 29, 2007. Version 2.
Checksum: D27133C677373DB0

FASTA50954,650
        10         20         30         40         50         60 
MAAIGVHLGC TSACVAVYKD GRADVVANDA GDRVTPAIVA YSEREQVVGL AAKQSRIRHV 

        70         80         90        100        110        120 
SSTVVKVKQI LGRSSADPQA QKYISESKCL VIEKNGKLRY EIDTGEETKL VNPEDVARLI 

       130        140        150        160        170        180 
FSKMKETAHS VLGSDANDVV VTVPFDFGEK QKSALGEAAG AAGFNVLRLI HEPSAALLAY 

       190        200        210        220        230        240 
GIGQDHPTGK SNVLVFKLGG TSLSLSVMEV NSGMYRVLST NTSDNIGGAH FTDTLAQYLA 

       250        260        270        280        290        300 
SEFQRLFKHD VRGNARAMMK LMNSAEVAKH SLSTLGSANC FVDSLYEGQD FDCNVSRARF 

       310        320        330        340        350        360 
ELLCSPLFNK CTEAIRELLR QTGFTADDIN KVVLCGGSSR IPKLQQLIKD LFPAVDLLNS 

       370        380        390        400        410        420 
IPPDEVIPIG AAIEAGILVG KESTSGDDSV MIECSAKDIL VKGVDESGAD RFTVLFPSGT 

       430        440        450        460        470        480 
PLPARRQHTL QAPGRVSSVC LELYESEGKN SAKEEAKFAQ VVLQDLDKKE NGLRDILAVL 

       490        500 
TMKRDGSLQV TCTDQDTGKC EAITVEVAS 

« Hide

Isoform 2 [UniParc].

Checksum: A8671B288E6A9C23
Show »

FASTA51555,883

References

« Hide 'large scale' references
[1]"The molecular cloning and characterization of NST-1 (hsr.1), a novel member of the Hsp70 superfamily."
Yang C.
Thesis (1994), Rockefeller University, United States
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
Tissue: Brain.
[2]"The transcriptional landscape of the mammalian genome."
Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. expand/collapse author list , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA].
Strain: C57BL/6J.
Tissue: Bone marrow and Placenta.
[3]"Lineage-specific biology revealed by a finished genome assembly of the mouse."
Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S. expand/collapse author list , Teague B., Potamousis K., Churas C., Place M., Herschleb J., Runnheim R., Forrest D., Amos-Landgraf J., Schwartz D.C., Cheng Z., Lindblad-Toh K., Eichler E.E., Ponting C.P.
PLoS Biol. 7:E1000112-E1000112(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Strain: C57BL/6J.
[4]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Strain: Czech II.
Tissue: Mammary tumor.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
U08215 mRNA. Translation: AAA17724.1.
AK145937 mRNA. Translation: BAE26767.1.
AK153397 mRNA. Translation: BAE31959.1.
AL732620 Genomic DNA. Translation: CAM16049.1.
BC002056 mRNA. Translation: AAH02056.1.
CCDSCCDS15653.1. [Q99M31-1]
RefSeqNP_056580.2. NM_015765.2. [Q99M31-1]
XP_006497566.1. XM_006497503.1. [Q99M31-2]
UniGeneMm.89341.

3D structure databases

ProteinModelPortalQ99M31.
SMRQ99M31. Positions 3-505.
ModBaseSearch...
MobiDBSearch...

PTM databases

PhosphoSiteQ99M31.

Proteomic databases

MaxQBQ99M31.
PaxDbQ99M31.
PRIDEQ99M31.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENSMUST00000027961; ENSMUSP00000027961; ENSMUSG00000051396. [Q99M31-1]
GeneID50497.
KEGGmmu:50497.
UCSCuc008ief.1. mouse. [Q99M31-1]
uc008ieg.1. mouse. [Q99M31-2]

Organism-specific databases

CTD51182.
MGIMGI:1354164. Hspa14.

Phylogenomic databases

eggNOGCOG0443.
GeneTreeENSGT00750000117237.
HOGENOMHOG000228135.
HOVERGENHBG099873.
InParanoidQ99M31.
OMASLMIECS.
OrthoDBEOG73804J.
PhylomeDBQ99M31.
TreeFamTF105045.

Gene expression databases

ArrayExpressQ99M31.
BgeeQ99M31.
CleanExMM_HSPA14.
GenevestigatorQ99M31.

Family and domain databases

Gene3D2.60.34.10. 1 hit.
InterProIPR018181. Heat_shock_70_CS.
IPR029047. HSP70_peptide-bd.
IPR013126. Hsp_70_fam.
[Graphical view]
PfamPF00012. HSP70. 1 hit.
[Graphical view]
PRINTSPR00301. HEATSHOCK70.
SUPFAMSSF100920. SSF100920. 1 hit.
PROSITEPS01036. HSP70_3. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

NextBio307490.
PROQ99M31.
SOURCESearch...

Entry information

Entry nameHSP7E_MOUSE
AccessionPrimary (citable) accession number: Q99M31
Secondary accession number(s): A2AJH7, Q3U5W7, Q60637
Entry history
Integrated into UniProtKB/Swiss-Prot: May 29, 2007
Last sequence update: May 29, 2007
Last modified: July 9, 2014
This is version 97 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

MGD cross-references

Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot