Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Lipolysis-stimulated lipoprotein receptor

Gene

Lsr

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Probable role in the clearance of triglyceride-rich lipoprotein from blood. Binds chylomicrons, LDL and VLDL in presence of free fatty acids and allows their subsequent uptake in the cells (By similarity).By similarity1 Publication

GO - Molecular functioni

  • lipoprotein particle receptor activity Source: HGNC
  • low-density lipoprotein particle binding Source: HGNC

GO - Biological processi

  • establishment of blood-brain barrier Source: UniProtKB
  • lipoprotein transport Source: HGNC
  • liver development Source: HGNC
  • regulation of lipid metabolic process Source: Ensembl
  • tricellular tight junction assembly Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Receptor

Enzyme and pathway databases

ReactomeiR-MMU-171052. LDL-mediated lipid transport.
R-MMU-8855121. VLDL interactions.

Names & Taxonomyi

Protein namesi
Recommended name:
Lipolysis-stimulated lipoprotein receptor
Alternative name(s):
Lipolysis-stimulated receptor
Liver-specific bHLH-Zip transcription factor
Liver-specific gene on mouse chromosome 7 protein
Gene namesi
Name:Lsr
Synonyms:Lisch7
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 7

Organism-specific databases

MGIiMGI:1927471. Lsr.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini36 – 206ExtracellularSequence analysisAdd BLAST171
Transmembranei207 – 227HelicalSequence analysisAdd BLAST21
Topological domaini228 – 594CytoplasmicSequence analysisAdd BLAST367

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Chylomicron, LDL, Membrane, VLDL

Pathology & Biotechi

Disruption phenotypei

Death between E12.5 and E15.5 probably due to impaired liver and embryonic development.1 Publication

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 35Sequence analysisAdd BLAST35
ChainiPRO_000024530936 – 594Lipolysis-stimulated lipoprotein receptorAdd BLAST559

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi113 ↔ 165By similarity
Modified residuei283PhosphothreonineBy similarity1
Modified residuei308PhosphoserineCombined sources1
Modified residuei314PhosphoserineBy similarity1
Modified residuei332PhosphoserineBy similarity1
Modified residuei375PhosphoserineCombined sources1
Modified residuei379PhosphoserineCombined sources1
Modified residuei396PhosphothreonineBy similarity1
Modified residuei407PhosphoserineBy similarity1
Modified residuei410PhosphoserineBy similarity1
Modified residuei436PhosphoserineBy similarity1
Modified residuei471PhosphoserineBy similarity1
Modified residuei473PhosphoserineBy similarity1
Modified residuei478PhosphotyrosineBy similarity1
Modified residuei576PhosphoserineBy similarity1
Modified residuei588PhosphoserineCombined sources1
Modified residuei591PhosphoserineBy similarity1

Keywords - PTMi

Disulfide bond, Phosphoprotein

Proteomic databases

PaxDbiQ99KG5.
PeptideAtlasiQ99KG5.
PRIDEiQ99KG5.

PTM databases

iPTMnetiQ99KG5.
PhosphoSitePlusiQ99KG5.

Expressioni

Tissue specificityi

Specifically expressed in liver and to a lower extent in kidney (at protein level). Also detected in brain, testis, ovaries, adrenal gland, intestine, muscle, and lung.1 Publication

Developmental stagei

Expressed during embryogenesis (at protein level). Detected from E7.5 to E17.1 Publication

Gene expression databases

BgeeiENSMUSG00000001247.
CleanExiMM_LSR.
ExpressionAtlasiQ99KG5. baseline and differential.
GenevisibleiQ99KG5. MM.

Interactioni

Subunit structurei

Homotrimer or homotetramer.By similarity

Protein-protein interaction databases

BioGridi207572. 1 interactor.
IntActiQ99KG5. 2 interactors.
STRINGi10090.ENSMUSP00000001279.

Structurei

3D structure databases

ProteinModelPortaliQ99KG5.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini89 – 181Ig-like V-typeAdd BLAST93

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi227 – 251Cys-richAdd BLAST25

Sequence similaritiesi

Keywords - Domaini

Immunoglobulin domain, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IKMJ. Eukaryota.
ENOG411004A. LUCA.
GeneTreeiENSGT00430000030906.
HOGENOMiHOG000253962.
HOVERGENiHBG061576.
InParanoidiQ99KG5.
OMAiPPAMIPM.
OrthoDBiEOG091G0875.
PhylomeDBiQ99KG5.
TreeFamiTF330877.

Family and domain databases

Gene3Di2.60.40.10. 1 hit.
InterProiIPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003599. Ig_sub.
IPR008664. LISCH7.
[Graphical view]
PfamiPF05624. LSR. 1 hit.
[Graphical view]
SMARTiSM00409. IG. 1 hit.
[Graphical view]
SUPFAMiSSF48726. SSF48726. 2 hits.

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q99KG5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAPAASACAG APGSHPATTI FVCLFLIIYC PDRASAIQVT VPDPYHVVIL
60 70 80 90 100
FQPVTLHCTY QMSNTLTAPI VIWKYKSFCR DRVADAFSPA SVDNQLNAQL
110 120 130 140 150
AAGNPGYNPY VECQDSVRTV RVVATKQGNA VTLGDYYQGR RITITGNADL
160 170 180 190 200
TFEQTAWGDS GVYYCSVVSA QDLDGNNEAY AELIVLGRTS EAPELLPGFR
210 220 230 240 250
AGPLEDWLFV VVVCLASLLF FLLLGICWCQ CCPHTCCCYV RCPCCPDKCC
260 270 280 290 300
CPEALYAAGK AATSGVPSIY APSIYTHLSP AKTPPPPPAM IPMRPPYGYP
310 320 330 340 350
GDFDRTSSVG GHSSQVPLLR EVDGSVSSEV RSGYRIQANQ QDDSMRVLYY
360 370 380 390 400
MEKELANFDP SRPGPPNGRV ERAMSEVTSL HEDDWRSRPS RAPALTPIRD
410 420 430 440 450
EEWNRHSPRS PRTWEQEPLQ EQPRGGWGSG RPRARSVDAL DDINRPGSTE
460 470 480 490 500
SGRSSPPSSG RRGRAYAPPR SRSRDDLYDP DDPRDLPHSR DPHYYDDLRS
510 520 530 540 550
RDPRADPRSR QRSHDPRDAG FRSRDPQYDG RLLEEALKKK GAGERRRVYR
560 570 580 590
EEEEEEEEGH YPPAPPPYSE TDSQASRERR MKKNLALSRE SLVV
Length:594
Mass (Da):66,108
Last modified:June 1, 2001 - v1
Checksum:i2ADE28BB870A001D
GO
Isoform 2 (identifier: Q99KG5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     187-205: Missing.

Show »
Length:575
Mass (Da):64,129
Checksum:i7B405B495E25FCC0
GO
Isoform 3 (identifier: Q99KG5-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     187-255: GRTSEAPELLPGFRAGPLEDWLFVVVVCLASLLFFLLLGICWCQCCPHTCCCYVRCPCCPDKCCCPEAL → V

Show »
Length:526
Mass (Da):58,608
Checksum:i95235788A11913C6
GO

Sequence cautioni

The sequence AAA92719 differs from that shown. Reason: Frameshift at position 2.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti423P → T in AAA92720 (Ref. 1) Curated1
Sequence conflicti456P → H in BAE39548 (PubMed:16141072).Curated1
Sequence conflicti579R → L in AAA92720 (Ref. 1) Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_019695187 – 255GRTSE…CPEAL → V in isoform 3. 1 PublicationAdd BLAST69
Alternative sequenceiVSP_019696187 – 205Missing in isoform 2. 1 PublicationAdd BLAST19

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U49507 mRNA. Translation: AAA92719.1. Frameshift.
U49508 Genomic DNA. Translation: AAA92720.1.
AK146807 mRNA. Translation: BAE27447.1.
AK167463 mRNA. Translation: BAE39548.1.
BC004672 mRNA. Translation: AAH04672.1.
AY376636 Genomic DNA. Translation: AAQ83379.1.
CCDSiCCDS21119.1. [Q99KG5-1]
CCDS52185.1. [Q99KG5-3]
CCDS52186.1. [Q99KG5-2]
RefSeqiNP_001157656.1. NM_001164184.1. [Q99KG5-2]
NP_001157657.1. NM_001164185.1. [Q99KG5-3]
NP_059101.1. NM_017405.2. [Q99KG5-1]
UniGeneiMm.4067.

Genome annotation databases

EnsembliENSMUST00000001279; ENSMUSP00000001279; ENSMUSG00000001247. [Q99KG5-1]
ENSMUST00000098553; ENSMUSP00000096153; ENSMUSG00000001247. [Q99KG5-3]
ENSMUST00000108116; ENSMUSP00000103751; ENSMUSG00000001247. [Q99KG5-2]
ENSMUST00000205961; ENSMUSP00000146120; ENSMUSG00000001247. [Q99KG5-1]
GeneIDi54135.
KEGGimmu:54135.
UCSCiuc009ghj.2. mouse. [Q99KG5-1]
uc009ghk.2. mouse. [Q99KG5-2]
uc009ghl.2. mouse. [Q99KG5-3]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U49507 mRNA. Translation: AAA92719.1. Frameshift.
U49508 Genomic DNA. Translation: AAA92720.1.
AK146807 mRNA. Translation: BAE27447.1.
AK167463 mRNA. Translation: BAE39548.1.
BC004672 mRNA. Translation: AAH04672.1.
AY376636 Genomic DNA. Translation: AAQ83379.1.
CCDSiCCDS21119.1. [Q99KG5-1]
CCDS52185.1. [Q99KG5-3]
CCDS52186.1. [Q99KG5-2]
RefSeqiNP_001157656.1. NM_001164184.1. [Q99KG5-2]
NP_001157657.1. NM_001164185.1. [Q99KG5-3]
NP_059101.1. NM_017405.2. [Q99KG5-1]
UniGeneiMm.4067.

3D structure databases

ProteinModelPortaliQ99KG5.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi207572. 1 interactor.
IntActiQ99KG5. 2 interactors.
STRINGi10090.ENSMUSP00000001279.

PTM databases

iPTMnetiQ99KG5.
PhosphoSitePlusiQ99KG5.

Proteomic databases

PaxDbiQ99KG5.
PeptideAtlasiQ99KG5.
PRIDEiQ99KG5.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000001279; ENSMUSP00000001279; ENSMUSG00000001247. [Q99KG5-1]
ENSMUST00000098553; ENSMUSP00000096153; ENSMUSG00000001247. [Q99KG5-3]
ENSMUST00000108116; ENSMUSP00000103751; ENSMUSG00000001247. [Q99KG5-2]
ENSMUST00000205961; ENSMUSP00000146120; ENSMUSG00000001247. [Q99KG5-1]
GeneIDi54135.
KEGGimmu:54135.
UCSCiuc009ghj.2. mouse. [Q99KG5-1]
uc009ghk.2. mouse. [Q99KG5-2]
uc009ghl.2. mouse. [Q99KG5-3]

Organism-specific databases

CTDi51599.
MGIiMGI:1927471. Lsr.

Phylogenomic databases

eggNOGiENOG410IKMJ. Eukaryota.
ENOG411004A. LUCA.
GeneTreeiENSGT00430000030906.
HOGENOMiHOG000253962.
HOVERGENiHBG061576.
InParanoidiQ99KG5.
OMAiPPAMIPM.
OrthoDBiEOG091G0875.
PhylomeDBiQ99KG5.
TreeFamiTF330877.

Enzyme and pathway databases

ReactomeiR-MMU-171052. LDL-mediated lipid transport.
R-MMU-8855121. VLDL interactions.

Miscellaneous databases

PROiQ99KG5.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000001247.
CleanExiMM_LSR.
ExpressionAtlasiQ99KG5. baseline and differential.
GenevisibleiQ99KG5. MM.

Family and domain databases

Gene3Di2.60.40.10. 1 hit.
InterProiIPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003599. Ig_sub.
IPR008664. LISCH7.
[Graphical view]
PfamiPF05624. LSR. 1 hit.
[Graphical view]
SMARTiSM00409. IG. 1 hit.
[Graphical view]
SUPFAMiSSF48726. SSF48726. 2 hits.
ProtoNetiSearch...

Entry informationi

Entry nameiLSR_MOUSE
AccessioniPrimary (citable) accession number: Q99KG5
Secondary accession number(s): Q3TJE7
, Q3UIQ9, Q61148, Q61149, Q6U816
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 11, 2006
Last sequence update: June 1, 2001
Last modified: November 30, 2016
This is version 120 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.