Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Ras-related GTP-binding protein C

Gene

Rragc

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Guanine nucleotide-binding protein forming heterodimeric Rag complexes required for the amino acid-induced relocalization of mTORC1 to the lysosomes and its subsequent activation by the GTPase RHEB. This is a crucial step in the activation of the TOR signaling cascade by amino acids (By similarity).By similarity

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi67 – 74GTPBy similarity8
Nucleotide bindingi115 – 119GTPBy similarity5
Nucleotide bindingi177 – 180GTPBy similarity4

GO - Molecular functioni

GO - Biological processi

Keywordsi

LigandGTP-binding, Nucleotide-binding

Enzyme and pathway databases

ReactomeiR-MMU-1632852 Macroautophagy
R-MMU-165159 mTOR signalling
R-MMU-166208 mTORC1-mediated signalling
R-MMU-380972 Energy dependent regulation of mTOR by LKB1-AMPK
R-MMU-5628897 TP53 Regulates Metabolic Genes
R-MMU-8943724 Regulation of PTEN gene transcription

Names & Taxonomyi

Protein namesi
Recommended name:
Ras-related GTP-binding protein C
Short name:
Rag C
Short name:
RagC
Alternative name(s):
GTPase-interacting protein 2
TIB929
Gene namesi
Name:RragcImported
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 4

Organism-specific databases

MGIiMGI:1858751 Rragc

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Lysosome, Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedBy similarity
ChainiPRO_00002399522 – 398Ras-related GTP-binding protein CAdd BLAST397

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylserineBy similarity1
Modified residuei2PhosphoserineBy similarity1
Modified residuei15PhosphoserineBy similarity1
Modified residuei95PhosphothreonineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiQ99K70
PaxDbiQ99K70
PeptideAtlasiQ99K70
PRIDEiQ99K70

PTM databases

iPTMnetiQ99K70
PhosphoSitePlusiQ99K70

Expressioni

Tissue specificityi

Expressed most abundantly in kidney. Moderately expressed in brain, ovary, and testis, and detected at lower levels in heart, liver, and muscle. Not detected in lung, spleen, and small intestine. Widely expressed in tumor cells, with expression being specifically up-regulated in highly metastatic cells.1 Publication

Gene expression databases

BgeeiENSMUSG00000028646
CleanExiMM_RRAGC
GenevisibleiQ99K70 MM

Interactioni

Subunit structurei

Forms a heterodimer with RRAGA, in a sequence-independent manner, and RRAGB. Heterodimerization stabilizes proteins of the heterodimer. In complex with RRAGA or RRAGB, interacts with RPTOR; this interaction is particularly efficient with GTP-loaded RRAGB and GDP-loaded RRAGC. Interacts with NOL8. Interacts with SH3BP4; the interaction with this negative regulator is most probably direct, preferentially occurs with the inactive GDP-bound form of RRAGB, is negatively regulated by amino acids and prevents interaction with RPTOR. The Rag heterodimer interacts with SLC38A9; the probable amino acid sensor (By similarity). Interacts with SESN1, SESN2 AND SESN3 (PubMed:25259925).By similarity1 Publication

GO - Molecular functioni

Protein-protein interaction databases

IntActiQ99K70, 1 interactor
MINTiQ99K70
STRINGi10090.ENSMUSP00000030399

Structurei

Secondary structure

1398
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi239 – 253Combined sources15
Beta strandi256 – 262Combined sources7
Turni263 – 265Combined sources3
Beta strandi268 – 271Combined sources4
Helixi278 – 298Combined sources21
Beta strandi302 – 304Combined sources3
Beta strandi314 – 319Combined sources6
Beta strandi322 – 341Combined sources20
Helixi344 – 347Combined sources4
Helixi348 – 368Combined sources21

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
5X6VX-ray2.02G238-375[»]
ProteinModelPortaliQ99K70
SMRiQ99K70
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the GTR/RAG GTP-binding protein family.Curated

Phylogenomic databases

eggNOGiKOG3887 Eukaryota
ENOG410XQS9 LUCA
GeneTreeiENSGT00550000074708
HOGENOMiHOG000203695
HOVERGENiHBG059482
InParanoidiQ99K70
KOiK16186
OMAiEMNFEVF
OrthoDBiEOG091G0AN4
PhylomeDBiQ99K70
TreeFamiTF300659

Family and domain databases

InterProiView protein in InterPro
IPR006762 Gtr1_RagA
IPR027417 P-loop_NTPase
PANTHERiPTHR11259 PTHR11259, 1 hit
PfamiView protein in Pfam
PF04670 Gtr1_RagA, 1 hit
SUPFAMiSSF52540 SSF52540, 1 hit

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 11 Publication (identifier: Q99K70-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSLQYGAEET PLAGSYGAAD SFPKDFGYGV EEEEEEAAAG GGGGAGAGGG
60 70 80 90 100
CGPGGADSSK PRILLMGLRR SGKSSIQKVV FHKMSPNETL FLESTNKIYK
110 120 130 140 150
DDISNSSFVN FQIWDFPGQM DFFDPTFDYE MIFRGTGALI YVIDAQDDYM
160 170 180 190 200
EALTRLHITV SKAYKVNPDM NFEVFIHKVD GLSDDHKIET QRDIHQRAND
210 220 230 240 250
DLADAGLEKL HLSFYLTSIY DHSIFEAFSK VVQKLIPQLP TLENLLNIFI
260 270 280 290 300
SNSGIEKAFL FDVVSKIYIA TDSSPVDMQS YELCCDMIDV VIDVSCIYGL
310 320 330 340 350
KEDGSGSAYD KESMAIIKLN NTTVLYLKEV TKFLALVCIL REESFERKGL
360 370 380 390
IDYNFHCFRK AIHEVFEVGV TSHRSCSHQT SAPSLKALAH NGTPRNAI
Length:398
Mass (Da):44,121
Last modified:June 1, 2001 - v1
Checksum:i094F670E44B37A25
GO
Isoform 21 Publication (identifier: Q99K70-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     147-182: DDYMEALTRLHITVSKAYKVNPDMNFEVFIHKVDGL → VVRHDGVCTSLVAKRQRKGGKLFVSFVMCLKLLSFQ
     183-398: Missing.

Note: No experimental confirmation available.Curated
Show »
Length:182
Mass (Da):19,654
Checksum:i446F7354D9934B61
GO

Sequence cautioni

The sequence BAA75671 differs from that shown. Reason: Frameshift at positions 19, 56, 68 and 71.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti19 – 20AD → R in BAA75671 (PubMed:10660099).Curated2
Sequence conflicti55G → R in BAA75671 (PubMed:10660099).Curated1
Sequence conflicti56A → DA in BAA75671 (PubMed:10660099).Curated1
Sequence conflicti71S → H in BAA75671 (PubMed:10660099).Curated1
Sequence conflicti376 – 398CSHQT…PRNAI → TSCR in BAE38923 (PubMed:16141072).CuratedAdd BLAST23
Sequence conflicti386K → R in BAA75671 (PubMed:10660099).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_052076147 – 182DDYME…KVDGL → VVRHDGVCTSLVAKRQRKGG KLFVSFVMCLKLLSFQ in isoform 2. 2 PublicationsAdd BLAST36
Alternative sequenceiVSP_052077183 – 398Missing in isoform 2. 2 PublicationsAdd BLAST216

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB017616 mRNA Translation: BAA75671.1 Frameshift.
AK159355 mRNA Translation: BAE35013.1
AK166658 mRNA Translation: BAE38923.1
AL606962 Genomic DNA No translation available.
BC005417 mRNA Translation: AAH05417.1
BC037732 mRNA No translation available.
BC071245 mRNA Translation: AAH71245.1
CCDSiCCDS18622.1 [Q99K70-1]
RefSeqiNP_059503.2, NM_017475.2 [Q99K70-1]
UniGeneiMm.220922

Genome annotation databases

EnsembliENSMUST00000030399; ENSMUSP00000030399; ENSMUSG00000028646 [Q99K70-1]
ENSMUST00000155757; ENSMUSP00000115232; ENSMUSG00000028646 [Q99K70-2]
GeneIDi54170
KEGGimmu:54170
UCSCiuc008uqm.1 mouse [Q99K70-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiRRAGC_MOUSE
AccessioniPrimary (citable) accession number: Q99K70
Secondary accession number(s): A2A7K7
, Q3TL69, Q6IQZ6, Q8CFT7, Q9Z124
Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 13, 2006
Last sequence update: June 1, 2001
Last modified: February 28, 2018
This is version 126 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health