Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Ras-related GTP-binding protein C

Gene

Rragc

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Guanine nucleotide-binding protein forming heterodimeric Rag complexes required for the amino acid-induced relocalization of mTORC1 to the lysosomes and its subsequent activation by the GTPase RHEB. This is a crucial step in the activation of the TOR signaling cascade by amino acids (By similarity).By similarity

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi67 – 74GTPBy similarity8
Nucleotide bindingi115 – 119GTPBy similarity5
Nucleotide bindingi177 – 180GTPBy similarity4

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Ligandi

GTP-binding, Nucleotide-binding

Enzyme and pathway databases

ReactomeiR-MMU-1632852. Macroautophagy.
R-MMU-165159. mTOR signalling.
R-MMU-166208. mTORC1-mediated signalling.
R-MMU-380972. Energy dependent regulation of mTOR by LKB1-AMPK.
R-MMU-5628897. TP53 Regulates Metabolic Genes.

Names & Taxonomyi

Protein namesi
Recommended name:
Ras-related GTP-binding protein C
Short name:
Rag C
Short name:
RagC
Alternative name(s):
GTPase-interacting protein 2
TIB929
Gene namesi
Name:RragcImported
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 4

Organism-specific databases

MGIiMGI:1858751. Rragc.

Subcellular locationi

  • Cytoplasm By similarity
  • Nucleus By similarity
  • Lysosome By similarity

  • Note: Predominantly cytoplasmic. May shuttle between the cytoplasm and nucleus, depending on the bound nucleotide state of associated RRAGA.By similarity

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Lysosome, Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedBy similarity
ChainiPRO_00002399522 – 398Ras-related GTP-binding protein CAdd BLAST397

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylserineBy similarity1
Modified residuei2PhosphoserineBy similarity1
Modified residuei15PhosphoserineBy similarity1
Modified residuei95PhosphothreonineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiQ99K70.
PaxDbiQ99K70.
PeptideAtlasiQ99K70.
PRIDEiQ99K70.

PTM databases

iPTMnetiQ99K70.
PhosphoSitePlusiQ99K70.

Expressioni

Tissue specificityi

Expressed most abundantly in kidney. Moderately expressed in brain, ovary, and testis, and detected at lower levels in heart, liver, and muscle. Not detected in lung, spleen, and small intestine. Widely expressed in tumor cells, with expression being specifically up-regulated in highly metastatic cells.1 Publication

Gene expression databases

BgeeiENSMUSG00000028646.
CleanExiMM_RRAGC.
GenevisibleiQ99K70. MM.

Interactioni

Subunit structurei

Forms a heterodimer with RRAGA, in a sequence-independent manner, and RRAGB. Heterodimerization stabilizes proteins of the heterodimer. In complex with RRAGA or RRAGB, interacts with RPTOR; this interaction is particularly efficient with GTP-loaded RRAGB and GDP-loaded RRAGC. Interacts with NOL8. Interacts with SH3BP4; the interaction with this negative regulator is most probably direct, preferentially occurs with the inactive GDP-bound form of RRAGB, is negatively regulated by amino acids and prevents interaction with RPTOR. The Rag heterodimer interacts with SLC38A9; the probable amino acid sensor (By similarity). Interacts with SESN1, SESN2 AND SESN3 (PubMed:25259925).By similarity1 Publication

GO - Molecular functioni

Protein-protein interaction databases

IntActiQ99K70. 1 interactor.
MINTiMINT-4123648.
STRINGi10090.ENSMUSP00000030399.

Structurei

3D structure databases

ProteinModelPortaliQ99K70.
SMRiQ99K70.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the GTR/RAG GTP-binding protein family.Curated

Phylogenomic databases

eggNOGiKOG3887. Eukaryota.
ENOG410XQS9. LUCA.
GeneTreeiENSGT00550000074708.
HOGENOMiHOG000203695.
HOVERGENiHBG059482.
InParanoidiQ99K70.
KOiK16186.
OMAiNCRTFQE.
OrthoDBiEOG091G0AN4.
PhylomeDBiQ99K70.
TreeFamiTF300659.

Family and domain databases

Gene3Di3.40.50.300. 1 hit.
InterProiIPR006762. Gtr1_RagA.
IPR027417. P-loop_NTPase.
[Graphical view]
PANTHERiPTHR11259. PTHR11259. 1 hit.
PfamiPF04670. Gtr1_RagA. 1 hit.
[Graphical view]
SUPFAMiSSF52540. SSF52540. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 11 Publication (identifier: Q99K70-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSLQYGAEET PLAGSYGAAD SFPKDFGYGV EEEEEEAAAG GGGGAGAGGG
60 70 80 90 100
CGPGGADSSK PRILLMGLRR SGKSSIQKVV FHKMSPNETL FLESTNKIYK
110 120 130 140 150
DDISNSSFVN FQIWDFPGQM DFFDPTFDYE MIFRGTGALI YVIDAQDDYM
160 170 180 190 200
EALTRLHITV SKAYKVNPDM NFEVFIHKVD GLSDDHKIET QRDIHQRAND
210 220 230 240 250
DLADAGLEKL HLSFYLTSIY DHSIFEAFSK VVQKLIPQLP TLENLLNIFI
260 270 280 290 300
SNSGIEKAFL FDVVSKIYIA TDSSPVDMQS YELCCDMIDV VIDVSCIYGL
310 320 330 340 350
KEDGSGSAYD KESMAIIKLN NTTVLYLKEV TKFLALVCIL REESFERKGL
360 370 380 390
IDYNFHCFRK AIHEVFEVGV TSHRSCSHQT SAPSLKALAH NGTPRNAI
Length:398
Mass (Da):44,121
Last modified:June 1, 2001 - v1
Checksum:i094F670E44B37A25
GO
Isoform 21 Publication (identifier: Q99K70-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     147-182: DDYMEALTRLHITVSKAYKVNPDMNFEVFIHKVDGL → VVRHDGVCTSLVAKRQRKGGKLFVSFVMCLKLLSFQ
     183-398: Missing.

Note: No experimental confirmation available.Curated
Show »
Length:182
Mass (Da):19,654
Checksum:i446F7354D9934B61
GO

Sequence cautioni

The sequence BAA75671 differs from that shown. Reason: Frameshift at positions 19, 56, 68 and 71.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti19 – 20AD → R in BAA75671 (PubMed:10660099).Curated2
Sequence conflicti55G → R in BAA75671 (PubMed:10660099).Curated1
Sequence conflicti56A → DA in BAA75671 (PubMed:10660099).Curated1
Sequence conflicti71S → H in BAA75671 (PubMed:10660099).Curated1
Sequence conflicti376 – 398CSHQT…PRNAI → TSCR in BAE38923 (PubMed:16141072).CuratedAdd BLAST23
Sequence conflicti386K → R in BAA75671 (PubMed:10660099).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_052076147 – 182DDYME…KVDGL → VVRHDGVCTSLVAKRQRKGG KLFVSFVMCLKLLSFQ in isoform 2. 2 PublicationsAdd BLAST36
Alternative sequenceiVSP_052077183 – 398Missing in isoform 2. 2 PublicationsAdd BLAST216

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB017616 mRNA. Translation: BAA75671.1. Frameshift.
AK159355 mRNA. Translation: BAE35013.1.
AK166658 mRNA. Translation: BAE38923.1.
AL606962 Genomic DNA. Translation: CAM20100.1.
BC005417 mRNA. Translation: AAH05417.1.
BC037732 mRNA. No translation available.
BC071245 mRNA. Translation: AAH71245.1.
CCDSiCCDS18622.1. [Q99K70-1]
RefSeqiNP_059503.2. NM_017475.2. [Q99K70-1]
UniGeneiMm.220922.

Genome annotation databases

EnsembliENSMUST00000030399; ENSMUSP00000030399; ENSMUSG00000028646. [Q99K70-1]
ENSMUST00000155757; ENSMUSP00000115232; ENSMUSG00000028646. [Q99K70-2]
GeneIDi54170.
KEGGimmu:54170.
UCSCiuc008uqm.1. mouse. [Q99K70-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB017616 mRNA. Translation: BAA75671.1. Frameshift.
AK159355 mRNA. Translation: BAE35013.1.
AK166658 mRNA. Translation: BAE38923.1.
AL606962 Genomic DNA. Translation: CAM20100.1.
BC005417 mRNA. Translation: AAH05417.1.
BC037732 mRNA. No translation available.
BC071245 mRNA. Translation: AAH71245.1.
CCDSiCCDS18622.1. [Q99K70-1]
RefSeqiNP_059503.2. NM_017475.2. [Q99K70-1]
UniGeneiMm.220922.

3D structure databases

ProteinModelPortaliQ99K70.
SMRiQ99K70.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiQ99K70. 1 interactor.
MINTiMINT-4123648.
STRINGi10090.ENSMUSP00000030399.

PTM databases

iPTMnetiQ99K70.
PhosphoSitePlusiQ99K70.

Proteomic databases

EPDiQ99K70.
PaxDbiQ99K70.
PeptideAtlasiQ99K70.
PRIDEiQ99K70.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000030399; ENSMUSP00000030399; ENSMUSG00000028646. [Q99K70-1]
ENSMUST00000155757; ENSMUSP00000115232; ENSMUSG00000028646. [Q99K70-2]
GeneIDi54170.
KEGGimmu:54170.
UCSCiuc008uqm.1. mouse. [Q99K70-1]

Organism-specific databases

CTDi64121.
MGIiMGI:1858751. Rragc.

Phylogenomic databases

eggNOGiKOG3887. Eukaryota.
ENOG410XQS9. LUCA.
GeneTreeiENSGT00550000074708.
HOGENOMiHOG000203695.
HOVERGENiHBG059482.
InParanoidiQ99K70.
KOiK16186.
OMAiNCRTFQE.
OrthoDBiEOG091G0AN4.
PhylomeDBiQ99K70.
TreeFamiTF300659.

Enzyme and pathway databases

ReactomeiR-MMU-1632852. Macroautophagy.
R-MMU-165159. mTOR signalling.
R-MMU-166208. mTORC1-mediated signalling.
R-MMU-380972. Energy dependent regulation of mTOR by LKB1-AMPK.
R-MMU-5628897. TP53 Regulates Metabolic Genes.

Miscellaneous databases

ChiTaRSiRragc. mouse.
PROiQ99K70.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000028646.
CleanExiMM_RRAGC.
GenevisibleiQ99K70. MM.

Family and domain databases

Gene3Di3.40.50.300. 1 hit.
InterProiIPR006762. Gtr1_RagA.
IPR027417. P-loop_NTPase.
[Graphical view]
PANTHERiPTHR11259. PTHR11259. 1 hit.
PfamiPF04670. Gtr1_RagA. 1 hit.
[Graphical view]
SUPFAMiSSF52540. SSF52540. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiRRAGC_MOUSE
AccessioniPrimary (citable) accession number: Q99K70
Secondary accession number(s): A2A7K7
, Q3TL69, Q6IQZ6, Q8CFT7, Q9Z124
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 13, 2006
Last sequence update: June 1, 2001
Last modified: November 2, 2016
This is version 117 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.