Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Neuroligin-1

Gene

Nlgn1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Cell surface protein involved in cell-cell-interactions via its interactions with neurexin family members. Plays a role in synapse function and synaptic signal transmission, and probably mediates its effects by recruiting and clustering other synaptic proteins. May promote the initial formation of synapses, but is not essential for this. In vitro, triggers the de novo formation of presynaptic structures. May be involved in specification of excitatory synapses. Required to maintain wakefulness quality and normal synchrony of cerebral cortex activity during wakefulness and sleep (PubMed:23716671).4 Publications

GO - Molecular functioni

GO - Biological processi

  • AMPA glutamate receptor clustering Source: BHF-UCL
  • calcium-dependent cell-cell adhesion via plasma membrane cell adhesion molecules Source: UniProtKB
  • cytoskeletal matrix organization at active zone Source: BHF-UCL
  • establishment of protein localization Source: BHF-UCL
  • excitatory synapse assembly Source: ParkinsonsUK-UCL
  • heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules Source: BHF-UCL
  • long-term synaptic potentiation Source: Ensembl
  • modulation of synaptic transmission Source: MGI
  • negative regulation of dendritic spine morphogenesis Source: BHF-UCL
  • nervous system development Source: UniProtKB
  • neurexin clustering involved in presynaptic membrane assembly Source: BHF-UCL
  • neuron cell-cell adhesion Source: BHF-UCL
  • neuron projection development Source: MGI
  • NMDA glutamate receptor clustering Source: BHF-UCL
  • positive regulation of circadian sleep/wake cycle, wakefulness Source: UniProtKB
  • positive regulation of dendritic spine development Source: BHF-UCL
  • positive regulation of excitatory postsynaptic potential Source: BHF-UCL
  • positive regulation of filopodium assembly Source: BHF-UCL
  • positive regulation of intracellular signal transduction Source: Ensembl
  • positive regulation of protein localization to synapse Source: Ensembl
  • positive regulation of ruffle assembly Source: Ensembl
  • positive regulation of synapse assembly Source: BHF-UCL
  • positive regulation of synaptic transmission, GABAergic Source: BHF-UCL
  • positive regulation of synaptic transmission, glutamatergic Source: BHF-UCL
  • positive regulation of synaptic vesicle clustering Source: BHF-UCL
  • positive regulation of synaptic vesicle endocytosis Source: BHF-UCL
  • positive regulation of synaptic vesicle exocytosis Source: BHF-UCL
  • postsynaptic density protein 95 clustering Source: BHF-UCL
  • postsynaptic membrane assembly Source: BHF-UCL
  • presynaptic membrane assembly Source: BHF-UCL
  • protein heterotetramerization Source: Ensembl
  • protein homooligomerization Source: BHF-UCL
  • protein localization to synapse Source: BHF-UCL
  • protein targeting Source: Ensembl
  • receptor localization to synapse Source: BHF-UCL
  • regulation of alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate selective glutamate receptor activity Source: BHF-UCL
  • regulation of neuron differentiation Source: UniProtKB
  • regulation of N-methyl-D-aspartate selective glutamate receptor activity Source: BHF-UCL
  • regulation of respiratory gaseous exchange by neurological system process Source: MGI
  • rhythmic process Source: UniProtKB-KW
  • synapse assembly Source: UniProtKB
  • synapse organization Source: MGI
  • synaptic vesicle clustering Source: BHF-UCL
  • synaptic vesicle targeting Source: UniProtKB
  • terminal button organization Source: BHF-UCL
Complete GO annotation...

Keywords - Biological processi

Biological rhythms, Cell adhesion

Enzyme and pathway databases

ReactomeiR-MMU-6794361. Interactions of neurexins and neuroligins at synapses.

Protein family/group databases

ESTHERimouse-1neur. Neuroligin.
MEROPSiS09.994.

Names & Taxonomyi

Protein namesi
Recommended name:
Neuroligin-1
Gene namesi
Name:Nlgn1
Synonyms:Kiaa1070
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 3

Organism-specific databases

MGIiMGI:2179435. Nlgn1.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini46 – 697ExtracellularSequence analysisAdd BLAST652
Transmembranei698 – 718HelicalSequence analysisAdd BLAST21
Topological domaini719 – 843CytoplasmicSequence analysisAdd BLAST125

GO - Cellular componenti

  • cell junction Source: UniProtKB-KW
  • cell surface Source: BHF-UCL
  • dendrite Source: BHF-UCL
  • dendritic shaft Source: Ensembl
  • dendritic spine Source: BHF-UCL
  • excitatory synapse Source: BHF-UCL
  • external side of plasma membrane Source: MGI
  • filopodium tip Source: BHF-UCL
  • Golgi apparatus Source: BHF-UCL
  • integral component of plasma membrane Source: UniProtKB
  • NMDA selective glutamate receptor complex Source: Ensembl
  • postsynaptic density Source: UniProtKB-SubCell
  • postsynaptic membrane Source: UniProtKB-KW
  • presynapse Source: GOC
  • synapse Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Cell membrane, Membrane, Postsynaptic cell membrane, Synapse

Pathology & Biotechi

Disruption phenotypei

No obvious phenotype, but mice present subtle behavorial changes with some deficits in spatial learning and memory. In addition, mice have reduced brain volume. Mice lacking both NLGN1 and NLGN2, or NLGN1 and NLGN3, are viable, but have impaired breathing, drastically reduced reproduction rates and striking deficits in raising their offspring. Mice lacking NLGN1, NLGN2 and NLGN3 are born at the expected Mendelian rate, but die shortly after birth due to respiratory failure. They do not show a significant change in the number of synapses, but synapse function is strongly impaired. Mice exhibit social novelty and fear-conditioning deficits and also show reduced wakefulness duration and altered EEG during wakefulness and sleep.3 Publications

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 45Sequence analysisAdd BLAST45
ChainiPRO_000000864146 – 843Neuroligin-1Add BLAST798

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi109N-linked (GlcNAc...) (complex)1 Publication1
Disulfide bondi117 ↔ 1531 Publication
Glycosylationi303N-linked (GlcNAc...) (complex)By similarity1
Disulfide bondi342 ↔ 3531 Publication
Glycosylationi343N-linked (GlcNAc...) (complex)By similarity1
Disulfide bondi512 ↔ 5461 Publication
Glycosylationi547N-linked (GlcNAc...)1 Publication1
Glycosylationi683O-linked (GalNAc...)By similarity1
Glycosylationi686O-linked (GalNAc...)By similarity1
Modified residuei733PhosphoserineBy similarity1
Modified residuei782PhosphotyrosineBy similarity1

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

PaxDbiQ99K10.
PeptideAtlasiQ99K10.
PRIDEiQ99K10.

PTM databases

iPTMnetiQ99K10.
PhosphoSitePlusiQ99K10.

Expressioni

Tissue specificityi

Brain and arteries (at protein level). Expressed in olfactory bulb. Detected in brain.4 Publications

Inductioni

Expressed in a circadian manner in the brain with highest expression seen at Zeitgeber time (ZT) 6 hours.1 Publication

Gene expression databases

BgeeiENSMUSG00000063887.
CleanExiMM_NLGN1.
ExpressionAtlasiQ99K10. baseline and differential.
GenevisibleiQ99K10. MM.

Interactioni

Subunit structurei

Interacts with NRXN1, NRXN2 and NRXN3. Interacts (via its C-terminus) with DLG4/PSD-95 (via PDZ domain 3). Interacts with AIP1, GOPC and PDZRN3 (By similarity). Interacts with NLGN3.By similarity2 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
PTPRTO145222EBI-775037,EBI-728180From a different organism.

GO - Molecular functioni

  • neurexin family protein binding Source: UniProtKB
  • PDZ domain binding Source: MGI
  • protein dimerization activity Source: BHF-UCL
  • scaffold protein binding Source: MGI

Protein-protein interaction databases

DIPiDIP-32027N.
IntActiQ99K10. 2 interactors.
MINTiMINT-5104301.
STRINGi10090.ENSMUSP00000074565.

Structurei

Secondary structure

1843
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi54 – 57Combined sources4
Beta strandi60 – 63Combined sources4
Beta strandi65 – 67Combined sources3
Beta strandi77 – 84Combined sources8
Helixi91 – 93Combined sources3
Beta strandi105 – 109Combined sources5
Beta strandi122 – 124Combined sources3
Turni128 – 130Combined sources3
Helixi133 – 137Combined sources5
Helixi139 – 145Combined sources7
Beta strandi147 – 149Combined sources3
Beta strandi155 – 160Combined sources6
Beta strandi193 – 198Combined sources6
Beta strandi202 – 206Combined sources5
Helixi209 – 211Combined sources3
Helixi215 – 221Combined sources7
Beta strandi224 – 228Combined sources5
Helixi233 – 237Combined sources5
Beta strandi241 – 245Combined sources5
Helixi249 – 264Combined sources16
Helixi266 – 268Combined sources3
Beta strandi270 – 280Combined sources11
Helixi282 – 290Combined sources9
Beta strandi310 – 316Combined sources7
Beta strandi319 – 321Combined sources3
Beta strandi324 – 327Combined sources4
Helixi329 – 339Combined sources11
Helixi347 – 356Combined sources10
Helixi359 – 363Combined sources5
Beta strandi375 – 377Combined sources3
Beta strandi382 – 385Combined sources4
Helixi389 – 395Combined sources7
Beta strandi402 – 408Combined sources7
Turni409 – 412Combined sources4
Helixi413 – 416Combined sources4
Helixi417 – 419Combined sources3
Beta strandi422 – 424Combined sources3
Helixi428 – 443Combined sources16
Helixi451 – 459Combined sources9
Helixi469 – 484Combined sources16
Helixi486 – 498Combined sources13
Beta strandi503 – 508Combined sources6
Turni525 – 528Combined sources4
Helixi529 – 532Combined sources4
Turni536 – 538Combined sources3
Beta strandi542 – 544Combined sources3
Helixi550 – 569Combined sources20
Beta strandi572 – 576Combined sources5
Turni600 – 602Combined sources3
Beta strandi604 – 611Combined sources8
Beta strandi613 – 617Combined sources5
Helixi620 – 627Combined sources8
Helixi630 – 633Combined sources4

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3B3QX-ray2.40A/B46-635[»]
ProteinModelPortaliQ99K10.
SMRiQ99K10.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ99K10.

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG1516. Eukaryota.
COG2272. LUCA.
GeneTreeiENSGT00760000118946.
HOGENOMiHOG000231424.
HOVERGENiHBG008839.
InParanoidiQ99K10.
KOiK07378.
OMAiKFVELIV.
OrthoDBiEOG091G0CHW.
PhylomeDBiQ99K10.
TreeFamiTF326187.

Family and domain databases

Gene3Di3.40.50.1820. 1 hit.
InterProiIPR029058. AB_hydrolase.
IPR002018. CarbesteraseB.
IPR019819. Carboxylesterase_B_CS.
IPR000460. Nlgn.
IPR030022. NLGN1.
[Graphical view]
PANTHERiPTHR11559:SF52. PTHR11559:SF52. 2 hits.
PfamiPF00135. COesterase. 1 hit.
[Graphical view]
PRINTSiPR01090. NEUROLIGIN.
SUPFAMiSSF53474. SSF53474. 1 hit.
PROSITEiPS00941. CARBOXYLESTERASE_B_2. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q99K10-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MALPRCMWPN YVWRAMMACV VHRGSGAPLT LCLLGCLLQT FHVLSQKLDD
60 70 80 90 100
VDPLVTTNFG KIRGIKKELN NEILGPVIQF LGVPYAAPPT GEHRFQPPEP
110 120 130 140 150
PSPWSDIRNA TQFAPVCPQN IIDGRLPEVM LPVWFTNNLD VVSSYVQDQS
160 170 180 190 200
EDCLYLNIYV PTEDGPLTKK HTDDLGDNDG AEDEDIRDSG GPKPVMVYIH
210 220 230 240 250
GGSYMEGTGN LYDGSVLASY GNVIVITVNY RLGVLGFLST GDQAAKGNYG
260 270 280 290 300
LLDLIQALRW TSENIGFFGG DPLRITVFGS GAGGSCVNLL TLSHYSEGNR
310 320 330 340 350
WSNSTKGLFQ RAIAQSGTAL SSWAVSFQPA KYARILATKV GCNVSDTVEL
360 370 380 390 400
VECLQKKPYK ELVDQDVQPA RYHIAFGPVI DGDVIPDDPQ ILMEQGEFLN
410 420 430 440 450
YDIMLGVNQG EGLKFVENIV DSDDGVSASD FDFAVSNFVD NLYGYPEGKD
460 470 480 490 500
VLRETIKFMY TDWADRHNPE TRRKTLLALF TDHQWVAPAV ATADLHSNFG
510 520 530 540 550
SPTYFYAFYH HCQTDQVPAW ADAAHGDEVP YVLGIPMIGP TELFPCNFSK
560 570 580 590 600
NDVMLSAVVM TYWTNFAKTG DPNQPVPQDT KFIHTKPNRF EEVAWTRYSQ
610 620 630 640 650
KDQLYLHIGL KPRVKEHYRA NKVNLWLELV PHLHNLNDIS QYTSTTTKVP
660 670 680 690 700
STDITLRPTR KNSTPVTSAF PTAKQDDPKQ QPSPFSVDQR DYSTELSVTI
710 720 730 740 750
AVGASLLFLN ILAFAALYYK KDKRRHDVHR RCSPQRTTTN DLTHAPEEEI
760 770 780 790 800
MSLQMKHTDL DHECESIHPH EVVLRTACPP DYTLAMRRSP DDIPLMTPNT
810 820 830 840
ITMIPNTIPG IQPLHTFNTF TGGQNNTLPH PHPHPHSHST TRV
Note: No experimental confirmation available.
Length:843
Mass (Da):94,149
Last modified:May 23, 2003 - v2
Checksum:i69E50709CF7D2E1F
GO
Isoform 2 (identifier: Q99K10-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     165-184: Missing.
     236-269: GFLSTGDQAAKGNYGLLDLIQALRWTSENIGFFG → EKETIKETISVALQALRTKGGGFIPKQATYKRCE
     270-843: Missing.

Note: No experimental confirmation available.
Show »
Length:249
Mass (Da):27,602
Checksum:i1D87ADF1EAFF2F0B
GO

Sequence cautioni

The sequence BAC65715 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_007528165 – 184Missing in isoform 2. 1 PublicationAdd BLAST20
Alternative sequenceiVSP_007529236 – 269GFLST…IGFFG → EKETIKETISVALQALRTKG GGFIPKQATYKRCE in isoform 2. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_007530270 – 843Missing in isoform 2. 1 PublicationAdd BLAST574

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK122433 mRNA. Translation: BAC65715.1. Different initiation.
BC005523 mRNA. Translation: AAH05523.1.
CCDSiCCDS17268.1. [Q99K10-1]
RefSeqiNP_619607.2. NM_138666.3. [Q99K10-1]
UniGeneiMm.316080.

Genome annotation databases

EnsembliENSMUST00000075054; ENSMUSP00000074565; ENSMUSG00000063887. [Q99K10-1]
ENSMUST00000193603; ENSMUSP00000142200; ENSMUSG00000063887. [Q99K10-1]
GeneIDi192167.
KEGGimmu:192167.
UCSCiuc008otc.1. mouse. [Q99K10-1]
uc008otd.1. mouse. [Q99K10-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK122433 mRNA. Translation: BAC65715.1. Different initiation.
BC005523 mRNA. Translation: AAH05523.1.
CCDSiCCDS17268.1. [Q99K10-1]
RefSeqiNP_619607.2. NM_138666.3. [Q99K10-1]
UniGeneiMm.316080.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3B3QX-ray2.40A/B46-635[»]
ProteinModelPortaliQ99K10.
SMRiQ99K10.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

DIPiDIP-32027N.
IntActiQ99K10. 2 interactors.
MINTiMINT-5104301.
STRINGi10090.ENSMUSP00000074565.

Protein family/group databases

ESTHERimouse-1neur. Neuroligin.
MEROPSiS09.994.

PTM databases

iPTMnetiQ99K10.
PhosphoSitePlusiQ99K10.

Proteomic databases

PaxDbiQ99K10.
PeptideAtlasiQ99K10.
PRIDEiQ99K10.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000075054; ENSMUSP00000074565; ENSMUSG00000063887. [Q99K10-1]
ENSMUST00000193603; ENSMUSP00000142200; ENSMUSG00000063887. [Q99K10-1]
GeneIDi192167.
KEGGimmu:192167.
UCSCiuc008otc.1. mouse. [Q99K10-1]
uc008otd.1. mouse. [Q99K10-2]

Organism-specific databases

CTDi22871.
MGIiMGI:2179435. Nlgn1.
RougeiSearch...

Phylogenomic databases

eggNOGiKOG1516. Eukaryota.
COG2272. LUCA.
GeneTreeiENSGT00760000118946.
HOGENOMiHOG000231424.
HOVERGENiHBG008839.
InParanoidiQ99K10.
KOiK07378.
OMAiKFVELIV.
OrthoDBiEOG091G0CHW.
PhylomeDBiQ99K10.
TreeFamiTF326187.

Enzyme and pathway databases

ReactomeiR-MMU-6794361. Interactions of neurexins and neuroligins at synapses.

Miscellaneous databases

EvolutionaryTraceiQ99K10.
PROiQ99K10.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000063887.
CleanExiMM_NLGN1.
ExpressionAtlasiQ99K10. baseline and differential.
GenevisibleiQ99K10. MM.

Family and domain databases

Gene3Di3.40.50.1820. 1 hit.
InterProiIPR029058. AB_hydrolase.
IPR002018. CarbesteraseB.
IPR019819. Carboxylesterase_B_CS.
IPR000460. Nlgn.
IPR030022. NLGN1.
[Graphical view]
PANTHERiPTHR11559:SF52. PTHR11559:SF52. 2 hits.
PfamiPF00135. COesterase. 1 hit.
[Graphical view]
PRINTSiPR01090. NEUROLIGIN.
SUPFAMiSSF53474. SSF53474. 1 hit.
PROSITEiPS00941. CARBOXYLESTERASE_B_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiNLGN1_MOUSE
AccessioniPrimary (citable) accession number: Q99K10
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 23, 2003
Last sequence update: May 23, 2003
Last modified: November 2, 2016
This is version 137 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.