SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q99973

- TEP1_HUMAN

UniProt

Q99973 - TEP1_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Telomerase protein component 1
Gene
TEP1, TLP1, TP1
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Component of the telomerase ribonucleoprotein complex that is essential for the replication of chromosome termini. Also component of the ribonucleoprotein vaults particle, a multi-subunit structure involved in nucleo-cytoplasmic transport. Responsible for the localizing and stabilizing vault RNA (vRNA) association in the vault ribonucleoprotein particle. Binds to TERC By similarity.

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi1168 – 11758ATP Reviewed prediction

GO - Molecular functioni

  1. ATP binding Source: UniProtKB-KW
  2. RNA binding Source: UniProtKB

GO - Biological processi

  1. RNA-dependent DNA replication Source: GOC
  2. telomere maintenance via recombination Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Ribonucleoprotein

Keywords - Ligandi

ATP-binding, Nucleotide-binding, RNA-binding

Enzyme and pathway databases

SignaLinkiQ99973.

Names & Taxonomyi

Protein namesi
Recommended name:
Telomerase protein component 1
Alternative name(s):
Telomerase-associated protein 1
Short name:
Telomerase protein 1
p240
p80 telomerase homolog
Gene namesi
Name:TEP1
Synonyms:TLP1, TP1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 14

Organism-specific databases

HGNCiHGNC:11726. TEP1.

Subcellular locationi

GO - Cellular componenti

  1. chromosome, telomeric region Source: UniProtKB-SubCell
  2. cytoplasm Source: MGI
  3. nuclear matrix Source: MGI
  4. ribonucleoprotein complex Source: UniProtKB
  5. telomerase holoenzyme complex Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Chromosome, Nucleus, Telomere

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA36443.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 26272627Telomerase protein component 1
PRO_0000050982Add
BLAST

Proteomic databases

MaxQBiQ99973.
PaxDbiQ99973.
PRIDEiQ99973.

PTM databases

PhosphoSiteiQ99973.

Expressioni

Tissue specificityi

Ubiquitous.1 Publication

Gene expression databases

ArrayExpressiQ99973.
BgeeiQ99973.
CleanExiHS_TEP1.
GenevestigatoriQ99973.

Organism-specific databases

HPAiHPA029206.

Interactioni

Subunit structurei

Component of the telomerase holoenzyme complex at least composed of TERT, DKC1, WRAP53/TCAB1, NOP10, NHP2, GAR1, TEP1, EST1A, POT1 and a telomerase RNA template component (TERC). Component of the vault ribonucleoprotein particle, at least composed of MVP, PARP4 and one or more vault RNAs (vRNAs). Binds to VAULTRC1, VAULTRC2 and VAULTRC4/hvg4 vRNAs By similarity.4 Publications

Protein-protein interaction databases

BioGridi112870. 12 interactions.
IntActiQ99973. 1 interaction.
MINTiMINT-112815.
STRINGi9606.ENSP00000262715.

Structurei

3D structure databases

ProteinModelPortaliQ99973.
SMRiQ99973. Positions 1664-2391.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati1 – 3030TEP1 N-terminal 1
Add
BLAST
Repeati31 – 6030TEP1 N-terminal 2
Add
BLAST
Repeati61 – 9030TEP1 N-terminal 3
Add
BLAST
Repeati91 – 12030TEP1 N-terminal 4
Add
BLAST
Domaini223 – 676454TROVE
Add
BLAST
Domaini1162 – 1490329NACHT
Add
BLAST
Repeati1411 – 144838WD 1
Add
BLAST
Repeati1674 – 171340WD 2
Add
BLAST
Repeati1716 – 175439WD 3
Add
BLAST
Repeati1757 – 179640WD 4
Add
BLAST
Repeati1798 – 183740WD 5
Add
BLAST
Repeati1840 – 187940WD 6
Add
BLAST
Repeati1882 – 192140WD 7
Add
BLAST
Repeati1925 – 196440WD 8
Add
BLAST
Repeati1967 – 200539WD 9
Add
BLAST
Repeati2008 – 204740WD 10
Add
BLAST
Repeati2059 – 209840WD 11
Add
BLAST
Repeati2105 – 214339WD 12
Add
BLAST
Repeati2146 – 218338WD 13
Add
BLAST
Repeati2185 – 223349WD 14
Add
BLAST
Repeati2236 – 227540WD 15
Add
BLAST
Repeati2278 – 231740WD 16
Add
BLAST
Repeati2319 – 235537WD 17
Add
BLAST
Repeati2368 – 241750WD 18
Add
BLAST
Repeati2459 – 250042WD 19
Add
BLAST
Repeati2553 – 259038WD 20
Add
BLAST
Repeati2592 – 262635WD 21
Add
BLAST

Sequence similaritiesi

Contains 1 NACHT domain.
Contains 1 TROVE domain.
Contains 21 WD repeats.

Keywords - Domaini

Repeat, WD repeat

Phylogenomic databases

eggNOGiCOG2319.
HOGENOMiHOG000154545.
HOVERGENiHBG059633.
InParanoidiQ99973.
KOiK11127.
OMAiLWHPLLV.
OrthoDBiEOG7W6WJT.
PhylomeDBiQ99973.
TreeFamiTF328424.

Family and domain databases

Gene3Di2.130.10.10. 7 hits.
InterProiIPR025139. DUF4062.
IPR007111. NACHT_NTPase.
IPR027417. P-loop_NTPase.
IPR008850. TEP1_N.
IPR008858. TROVE.
IPR015943. WD40/YVTN_repeat-like_dom.
IPR001680. WD40_repeat.
IPR019775. WD40_repeat_CS.
IPR017986. WD40_repeat_dom.
[Graphical view]
PfamiPF13271. DUF4062. 1 hit.
PF05386. TEP1_N. 4 hits.
PF05731. TROVE. 1 hit.
PF00400. WD40. 8 hits.
[Graphical view]
SMARTiSM00320. WD40. 18 hits.
[Graphical view]
SUPFAMiSSF50978. SSF50978. 5 hits.
SSF52540. SSF52540. 1 hit.
PROSITEiPS50837. NACHT. 1 hit.
PS51226. TEP1_N. 4 hits.
PS50988. TROVE. 1 hit.
PS00678. WD_REPEATS_1. 1 hit.
PS50082. WD_REPEATS_2. 7 hits.
PS50294. WD_REPEATS_REGION. 2 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q99973-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MEKLHGHVSA HPDILSLENR CLAMLPDLQP LEKLHQHVST HSDILSLKNQ     50
CLATLPDLKT MEKPHGYVSA HPDILSLENQ CLATLSDLKT MEKPHGHVSA 100
HPDILSLENR CLATLSSLKS TVSASPLFQS LQISHMTQAD LYRVNNSNCL 150
LSEPPSWRAQ HFSKGLDLST CPIALKSISA TETAQEATLG RWFDSEEKKG 200
AETQMPSYSL SLGEEEEVED LAVKLTSGDS ESHPEPTDHV LQEKKMALLS 250
LLCSTLVSEV NMNNTSDPTL AAIFEICREL ALLEPEFILK ASLYARQQLN 300
VRNVANNILA IAAFLPACRP HLRRYFCAIV QLPSDWIQVA ELYQSLAEGD 350
KNKLVPLPAC LRTAMTDKFA QFDEYQLAKY NPRKHRAKRH PRRPPRSPGM 400
EPPFSHRCFP RYIGFLREEQ RKFEKAGDTV SEKKNPPRFT LKKLVQRLHI 450
HKPAQHVQAL LGYRYPSNLQ LFSRSRLPGP WDSSRAGKRM KLSRPETWER 500
ELSLRGNKAS VWEELIENGK LPFMAMLRNL CNLLRVGISS RHHELILQRL 550
QHAKSVIHSR QFPFRFLNAH DAIDALEAQL RNQALPFPSN ITLMRRILTR 600
NEKNRPRRRF LCHLSRQQLR MAMRIPVLYE QLKREKLRVH KARQWKYDGE 650
MLNRYRQALE TAVNLSVKHS LPLLPGRTVL VYLTDANADR LCPKSNPQGP 700
PLNYALLLIG MMITRAEQVD VVLCGGDTLK TAVLKAEEGI LKTAIKLQAQ 750
VQEFDENDGW SLNTFGKYLL SLAGQRVPVD RVILLGQSMD DGMINVAKQL 800
YWQRVNSKCL FVGILLRRVQ YLSTDLNPND VTLSGCTDAI LKFIAEHGAS 850
HLLEHVGQMD KIFKIPPPPG KTGVQSLRPL EEDTPSPLAP VSQQGWRSIR 900
LFISSTFRDM HGERDLLLRS VLPALQARAA PHRISLHGID LRWGVTEEET 950
RRNRQLEVCL GEVENAQLFV GILGSRYGYI PPSYNLPDHP HFHWAQQYPS 1000
GRSVTEMEVM QFLNRNQRLQ PSAQALIYFR DSSFLSSVPD AWKSDFVSES 1050
EEAARRISEL KSYLSRQKGI TCRRYPCEWG GVAAGRPYVG GLEEFGQLVL 1100
QDVWNMIQKL YLQPGALLEQ PVSIPDDDLV QATFQQLQKP PSPARPRLLQ 1150
DTVQRLMLPH GRLSLVTGQS GQGKTAFLAS LVSALQAPDG AKVASLVFFH 1200
FSGARPDQGL ALTLLRRLCT YLRGQLKEPG ALPSTYRSLV WELQQRLLPK 1250
SAESLHPGQT QVLIIDGADR LVDQNGQLIS DWIPKKLPRC VHLVLSVSSD 1300
AGLGETLEQS QGAHVLALGP LEASARARLV REELALYGKR LEESPFNNQM 1350
RLLLVKRESG RPLYLRLVTD HLRLFTLYEQ VSERLRTLPA TVPLLLQHIL 1400
STLEKEHGPD VLPQALTALE VTRSGLTVDQ LHGVLSVWRT LPKGTKSWEE 1450
AVAAGNSGDP YPMGPFACLV QSLRSLLGEG PLERPGARLC LPDGPLRTAA 1500
KRCYGKRPGL EDTAHILIAA QLWKTCDADA SGTFRSCPPE ALGDLPYHLL 1550
QSGNRGLLSK FLTNLHVVAA HLELGLVSRL LEAHALYASS VPKEEQKLPE 1600
ADVAVFRTFL RQQASILSQY PRLLPQQAAN QPLDSPLCHQ ASLLSRRWHL 1650
QHTLRWLNKP RTMKNQQSSS LSLAVSSSPT AVAFSTNGQR AAVGTANGTV 1700
YLLDLRTWQE EKSVVSGCDG ISACLFLSDD TLFLTAFDGL LELWDLQHGC 1750
RVLQTKAHQY QITGCCLSPD CRLLATVCLG GCLKLWDTVR GQLAFQHTYP 1800
KSLNCVAFHP EGQVIATGSW AGSISFFQVD GLKVTKDLGA PGASIRTLAF 1850
NVPGGVVAVG RLDSMVELWA WREGARLAAF PAHHGFVAAA LFLHAGCQLL 1900
TAGEDGKVQV WSGSLGRPRG HLGSLSLSPA LSVALSPDGD RVAVGYRADG 1950
IRIYKISSGS QGAQGQALDV AVSALAWLSP KVLVSGAEDG SLQGWALKEC 2000
SLQSLWLLSR FQKPVLGLAT SQELLASASE DFTVQLWPRQ LLTRPHKAED 2050
FPCGTELRGH EGPVSCCSFS TDGGSLATGG RDRSLLCWDV RTPKTPVLIH 2100
SFPACHRDWV TGCAWTKDNL LISCSSDGSV GLWDPESGQR LGQFLGHQSA 2150
VSAVAAVEEH VVSVSRDGTL KVWDHQGVEL TSIPAHSGPI SHCAAAMEPR 2200
AAGQPGSELL VVTVGLDGAT RLWHPLLVCQ THTLLGHSGP VRAAAVSETS 2250
GLMLTASEDG SVRLWQVPKE ADDTCIPRSS AAVTAVAWAP DGSMAVSGNQ 2300
AGELILWQEA KAVATAQAPG HIGALIWSSA HTFFVLSADE KISEWQVKLR 2350
KGSAPGNLSL HLNRILQEDL GVLTSLDWAP DGHFLILAKA DLKLLCMKPG 2400
DAPSEIWSSY TENPMILSTH KEYGIFVLQP KDPGVLSFLR QKESGEFEER 2450
LNFDINLENP SRTLISITQA KPESESSFLC ASSDGILWNL AKCSPEGEWT 2500
TGNMWQKKAN TPETQTPGTD PSTCRESDAS MDSDASMDSE PTPHLKTRQR 2550
RKIHSGSVTA LHVLPELLVT ASKDRDVKLW ERPSMQLLGL FRCEGSVSCL 2600
EPWLGANSTL QLAVGDVQGN VYFLNWE 2627
Length:2,627
Mass (Da):290,490
Last modified:November 25, 2008 - v2
Checksum:i32628238704A8860
GO
Isoform 2 (identifier: Q99973-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     2475-2506: ESSFLCASSDGILWNLAKCSPEGEWTTGNMWQ → ALMGSYGTWPNAAQKENGPQVTCGR

Note: May be due to an exon inclusion.

Show »
Length:2,620
Mass (Da):289,578
Checksum:iD512FB76402A71C4
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti116 – 1161S → P.1 Publication
Corresponds to variant rs1760897 [ dbSNP | Ensembl ].
VAR_018490
Natural varianti137 – 1371T → M.
Corresponds to variant rs10083536 [ dbSNP | Ensembl ].
VAR_047631
Natural varianti307 – 3071N → K.
Corresponds to variant rs1760898 [ dbSNP | Ensembl ].
VAR_018491
Natural varianti368 – 3681K → R.
Corresponds to variant rs2228035 [ dbSNP | Ensembl ].
VAR_047632
Natural varianti434 – 4341K → N.
Corresponds to variant rs17111188 [ dbSNP | Ensembl ].
VAR_047633
Natural varianti510 – 5101S → L.
Corresponds to variant rs4982051 [ dbSNP | Ensembl ].
VAR_047634
Natural varianti553 – 5531A → G.1 Publication
Corresponds to variant rs2228040 [ dbSNP | Ensembl ].
VAR_047635
Natural varianti933 – 9331R → H.
Corresponds to variant rs34179031 [ dbSNP | Ensembl ].
VAR_047636
Natural varianti1055 – 10551R → C.1 Publication
Corresponds to variant rs1760903 [ dbSNP | Ensembl ].
VAR_018492
Natural varianti1155 – 11551R → Q.1 Publication
Corresponds to variant rs2228041 [ dbSNP | Ensembl ].
VAR_047637
Natural varianti1195 – 11951S → P.1 Publication
Corresponds to variant rs1760904 [ dbSNP | Ensembl ].
VAR_018493
Natural varianti1351 – 13511R → Q.
Corresponds to variant rs12886088 [ dbSNP | Ensembl ].
VAR_047638
Natural varianti1408 – 14081G → R.
Corresponds to variant rs2229100 [ dbSNP | Ensembl ].
VAR_047639
Natural varianti1447 – 14471S → T.
Corresponds to variant rs1713457 [ dbSNP | Ensembl ].
VAR_018494
Natural varianti1468 – 14681C → Y.
Corresponds to variant rs1713456 [ dbSNP | Ensembl ].
VAR_018495
Natural varianti1661 – 16611R → Q.
Corresponds to variant rs34401320 [ dbSNP | Ensembl ].
VAR_047640
Natural varianti1772 – 17721R → Q.
Corresponds to variant rs8022805 [ dbSNP | Ensembl ].
VAR_047641
Natural varianti2214 – 22141V → I.
Corresponds to variant rs1713449 [ dbSNP | Ensembl ].
VAR_018496
Natural varianti2310 – 23101A → S.
Corresponds to variant rs35929175 [ dbSNP | Ensembl ].
VAR_047642
Natural varianti2486 – 24861I → M.
Corresponds to variant rs938886 [ dbSNP | Ensembl ].
VAR_018497
Natural varianti2562 – 25621H → R.
Corresponds to variant rs2104978 [ dbSNP | Ensembl ].
VAR_018498

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei2475 – 250632ESSFL…GNMWQ → ALMGSYGTWPNAAQKENGPQ VTCGR in isoform 2.
VSP_010359Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U86136 mRNA. Translation: AAC51107.1.
BC126107 mRNA. Translation: AAI26108.1.
BX640983 mRNA. Translation: CAE45993.1.
CCDSiCCDS9548.1. [Q99973-1]
RefSeqiNP_009041.2. NM_007110.4. [Q99973-1]
XP_005268084.1. XM_005268027.2. [Q99973-1]
UniGeneiHs.508835.

Genome annotation databases

EnsembliENST00000262715; ENSP00000262715; ENSG00000129566. [Q99973-1]
GeneIDi7011.
KEGGihsa:7011.
UCSCiuc001vxe.3. human. [Q99973-1]

Polymorphism databases

DMDMi215273899.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U86136 mRNA. Translation: AAC51107.1 .
BC126107 mRNA. Translation: AAI26108.1 .
BX640983 mRNA. Translation: CAE45993.1 .
CCDSi CCDS9548.1. [Q99973-1 ]
RefSeqi NP_009041.2. NM_007110.4. [Q99973-1 ]
XP_005268084.1. XM_005268027.2. [Q99973-1 ]
UniGenei Hs.508835.

3D structure databases

ProteinModelPortali Q99973.
SMRi Q99973. Positions 1664-2391.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 112870. 12 interactions.
IntActi Q99973. 1 interaction.
MINTi MINT-112815.
STRINGi 9606.ENSP00000262715.

PTM databases

PhosphoSitei Q99973.

Polymorphism databases

DMDMi 215273899.

Proteomic databases

MaxQBi Q99973.
PaxDbi Q99973.
PRIDEi Q99973.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000262715 ; ENSP00000262715 ; ENSG00000129566 . [Q99973-1 ]
GeneIDi 7011.
KEGGi hsa:7011.
UCSCi uc001vxe.3. human. [Q99973-1 ]

Organism-specific databases

CTDi 7011.
GeneCardsi GC14M020833.
H-InvDB HIX0026646.
HGNCi HGNC:11726. TEP1.
HPAi HPA029206.
MIMi 601686. gene.
neXtProti NX_Q99973.
PharmGKBi PA36443.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG2319.
HOGENOMi HOG000154545.
HOVERGENi HBG059633.
InParanoidi Q99973.
KOi K11127.
OMAi LWHPLLV.
OrthoDBi EOG7W6WJT.
PhylomeDBi Q99973.
TreeFami TF328424.

Enzyme and pathway databases

SignaLinki Q99973.

Miscellaneous databases

ChiTaRSi TEP1. human.
GeneWikii TEP1.
GenomeRNAii 7011.
NextBioi 27388.
PROi Q99973.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q99973.
Bgeei Q99973.
CleanExi HS_TEP1.
Genevestigatori Q99973.

Family and domain databases

Gene3Di 2.130.10.10. 7 hits.
InterProi IPR025139. DUF4062.
IPR007111. NACHT_NTPase.
IPR027417. P-loop_NTPase.
IPR008850. TEP1_N.
IPR008858. TROVE.
IPR015943. WD40/YVTN_repeat-like_dom.
IPR001680. WD40_repeat.
IPR019775. WD40_repeat_CS.
IPR017986. WD40_repeat_dom.
[Graphical view ]
Pfami PF13271. DUF4062. 1 hit.
PF05386. TEP1_N. 4 hits.
PF05731. TROVE. 1 hit.
PF00400. WD40. 8 hits.
[Graphical view ]
SMARTi SM00320. WD40. 18 hits.
[Graphical view ]
SUPFAMi SSF50978. SSF50978. 5 hits.
SSF52540. SSF52540. 1 hit.
PROSITEi PS50837. NACHT. 1 hit.
PS51226. TEP1_N. 4 hits.
PS50988. TROVE. 1 hit.
PS00678. WD_REPEATS_1. 1 hit.
PS50082. WD_REPEATS_2. 7 hits.
PS50294. WD_REPEATS_REGION. 2 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY, VARIANTS PRO-116; GLY-553; CYS-1055; GLN-1155 AND PRO-1195.
  2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Cerebellum.
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 2288-2627 (ISOFORM 2).
    Tissue: Salivary gland.
  4. "Human telomerase contains evolutionarily conserved catalytic and structural subunits."
    Harrington L., Zhou W., McPhail T., Oulton R., Yeung D.S., Mar V., Bass M.B., Robinson M.O.
    Genes Dev. 11:3109-3115(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION IN THE TELOMERASE RIBONUCLEOPROTEIN COMPLEX.
  5. Cited for: IDENTIFICATION IN THE VAULTS RIBONUCLEOPROTEIN PARTICLE, RNA-BINDING.
  6. "Polymerization defects within human telomerase are distinct from telomerase RNA and TEP1 binding."
    Beattie T.L., Zhou W., Robinson M.O., Harrington L.
    Mol. Biol. Cell 11:3329-3340(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION IN THE TELOMERASE RIBONUCLEOPROTEIN COMPLEX.
  7. "A human telomerase holoenzyme protein required for Cajal body localization and telomere synthesis."
    Venteicher A.S., Abreu E.B., Meng Z., McCann K.E., Terns R.M., Veenstra T.D., Terns M.P., Artandi S.E.
    Science 323:644-648(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION IN THE TELOMERASE HOLOENZYME COMPLEX.

Entry informationi

Entry nameiTEP1_HUMAN
AccessioniPrimary (citable) accession number: Q99973
Secondary accession number(s): A0AUV9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 24, 2004
Last sequence update: November 25, 2008
Last modified: July 9, 2014
This is version 128 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 14
    Human chromosome 14: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi