Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q99973

- TEP1_HUMAN

UniProt

Q99973 - TEP1_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Telomerase protein component 1

Gene

TEP1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Component of the telomerase ribonucleoprotein complex that is essential for the replication of chromosome termini. Also component of the ribonucleoprotein vaults particle, a multi-subunit structure involved in nucleo-cytoplasmic transport. Responsible for the localizing and stabilizing vault RNA (vRNA) association in the vault ribonucleoprotein particle. Binds to TERC (By similarity).By similarity

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi1168 – 11758ATPPROSITE-ProRule annotation

GO - Molecular functioni

  1. ATP binding Source: UniProtKB-KW
  2. RNA binding Source: UniProtKB

GO - Biological processi

  1. RNA-dependent DNA replication Source: GOC
  2. telomere maintenance via recombination Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Ribonucleoprotein

Keywords - Ligandi

ATP-binding, Nucleotide-binding, RNA-binding

Enzyme and pathway databases

SignaLinkiQ99973.

Names & Taxonomyi

Protein namesi
Recommended name:
Telomerase protein component 1
Alternative name(s):
Telomerase-associated protein 1
Short name:
Telomerase protein 1
p240
p80 telomerase homolog
Gene namesi
Name:TEP1
Synonyms:TLP1, TP1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 14

Organism-specific databases

HGNCiHGNC:11726. TEP1.

Subcellular locationi

GO - Cellular componenti

  1. chromosome, telomeric region Source: UniProtKB-KW
  2. cytoplasm Source: MGI
  3. nuclear matrix Source: MGI
  4. ribonucleoprotein complex Source: UniProtKB
  5. telomerase holoenzyme complex Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Chromosome, Nucleus, Telomere

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA36443.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 26272627Telomerase protein component 1PRO_0000050982Add
BLAST

Proteomic databases

MaxQBiQ99973.
PaxDbiQ99973.
PRIDEiQ99973.

PTM databases

PhosphoSiteiQ99973.

Expressioni

Tissue specificityi

Ubiquitous.1 Publication

Gene expression databases

BgeeiQ99973.
CleanExiHS_TEP1.
ExpressionAtlasiQ99973. baseline and differential.
GenevestigatoriQ99973.

Organism-specific databases

HPAiHPA029206.

Interactioni

Subunit structurei

Component of the telomerase holoenzyme complex at least composed of TERT, DKC1, WRAP53/TCAB1, NOP10, NHP2, GAR1, TEP1, EST1A, POT1 and a telomerase RNA template component (TERC). Component of the vault ribonucleoprotein particle, at least composed of MVP, PARP4 and one or more vault RNAs (vRNAs). Binds to VAULTRC1, VAULTRC2 and VAULTRC4/hvg4 vRNAs (By similarity).By similarity

Protein-protein interaction databases

BioGridi112870. 13 interactions.
IntActiQ99973. 1 interaction.
MINTiMINT-112815.
STRINGi9606.ENSP00000262715.

Structurei

3D structure databases

ProteinModelPortaliQ99973.
SMRiQ99973. Positions 1664-2391.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati1 – 3030TEP1 N-terminal 1Add
BLAST
Repeati31 – 6030TEP1 N-terminal 2Add
BLAST
Repeati61 – 9030TEP1 N-terminal 3Add
BLAST
Repeati91 – 12030TEP1 N-terminal 4Add
BLAST
Domaini223 – 676454TROVEPROSITE-ProRule annotationAdd
BLAST
Domaini1162 – 1490329NACHTPROSITE-ProRule annotationAdd
BLAST
Repeati1411 – 144838WD 1Add
BLAST
Repeati1674 – 171340WD 2Add
BLAST
Repeati1716 – 175439WD 3Add
BLAST
Repeati1757 – 179640WD 4Add
BLAST
Repeati1798 – 183740WD 5Add
BLAST
Repeati1840 – 187940WD 6Add
BLAST
Repeati1882 – 192140WD 7Add
BLAST
Repeati1925 – 196440WD 8Add
BLAST
Repeati1967 – 200539WD 9Add
BLAST
Repeati2008 – 204740WD 10Add
BLAST
Repeati2059 – 209840WD 11Add
BLAST
Repeati2105 – 214339WD 12Add
BLAST
Repeati2146 – 218338WD 13Add
BLAST
Repeati2185 – 223349WD 14Add
BLAST
Repeati2236 – 227540WD 15Add
BLAST
Repeati2278 – 231740WD 16Add
BLAST
Repeati2319 – 235537WD 17Add
BLAST
Repeati2368 – 241750WD 18Add
BLAST
Repeati2459 – 250042WD 19Add
BLAST
Repeati2553 – 259038WD 20Add
BLAST
Repeati2592 – 262635WD 21Add
BLAST

Sequence similaritiesi

Contains 1 NACHT domain.PROSITE-ProRule annotation
Contains 4 TEP1 N-terminal repeats.PROSITE-ProRule annotation
Contains 1 TROVE domain.PROSITE-ProRule annotation
Contains 21 WD repeats.PROSITE-ProRule annotation

Keywords - Domaini

Repeat, WD repeat

Phylogenomic databases

eggNOGiCOG2319.
GeneTreeiENSGT00760000119296.
HOGENOMiHOG000154545.
HOVERGENiHBG059633.
InParanoidiQ99973.
KOiK11127.
OMAiLWHPLLV.
OrthoDBiEOG7W6WJT.
PhylomeDBiQ99973.
TreeFamiTF328424.

Family and domain databases

Gene3Di2.130.10.10. 7 hits.
InterProiIPR025139. DUF4062.
IPR007111. NACHT_NTPase.
IPR027417. P-loop_NTPase.
IPR008850. TEP1_N.
IPR008858. TROVE.
IPR015943. WD40/YVTN_repeat-like_dom.
IPR001680. WD40_repeat.
IPR019775. WD40_repeat_CS.
IPR017986. WD40_repeat_dom.
[Graphical view]
PfamiPF13271. DUF4062. 1 hit.
PF05386. TEP1_N. 4 hits.
PF05731. TROVE. 1 hit.
PF00400. WD40. 8 hits.
[Graphical view]
SMARTiSM00320. WD40. 18 hits.
[Graphical view]
SUPFAMiSSF50978. SSF50978. 5 hits.
SSF52540. SSF52540. 1 hit.
PROSITEiPS50837. NACHT. 1 hit.
PS51226. TEP1_N. 4 hits.
PS50988. TROVE. 1 hit.
PS00678. WD_REPEATS_1. 1 hit.
PS50082. WD_REPEATS_2. 7 hits.
PS50294. WD_REPEATS_REGION. 2 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q99973-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEKLHGHVSA HPDILSLENR CLAMLPDLQP LEKLHQHVST HSDILSLKNQ
60 70 80 90 100
CLATLPDLKT MEKPHGYVSA HPDILSLENQ CLATLSDLKT MEKPHGHVSA
110 120 130 140 150
HPDILSLENR CLATLSSLKS TVSASPLFQS LQISHMTQAD LYRVNNSNCL
160 170 180 190 200
LSEPPSWRAQ HFSKGLDLST CPIALKSISA TETAQEATLG RWFDSEEKKG
210 220 230 240 250
AETQMPSYSL SLGEEEEVED LAVKLTSGDS ESHPEPTDHV LQEKKMALLS
260 270 280 290 300
LLCSTLVSEV NMNNTSDPTL AAIFEICREL ALLEPEFILK ASLYARQQLN
310 320 330 340 350
VRNVANNILA IAAFLPACRP HLRRYFCAIV QLPSDWIQVA ELYQSLAEGD
360 370 380 390 400
KNKLVPLPAC LRTAMTDKFA QFDEYQLAKY NPRKHRAKRH PRRPPRSPGM
410 420 430 440 450
EPPFSHRCFP RYIGFLREEQ RKFEKAGDTV SEKKNPPRFT LKKLVQRLHI
460 470 480 490 500
HKPAQHVQAL LGYRYPSNLQ LFSRSRLPGP WDSSRAGKRM KLSRPETWER
510 520 530 540 550
ELSLRGNKAS VWEELIENGK LPFMAMLRNL CNLLRVGISS RHHELILQRL
560 570 580 590 600
QHAKSVIHSR QFPFRFLNAH DAIDALEAQL RNQALPFPSN ITLMRRILTR
610 620 630 640 650
NEKNRPRRRF LCHLSRQQLR MAMRIPVLYE QLKREKLRVH KARQWKYDGE
660 670 680 690 700
MLNRYRQALE TAVNLSVKHS LPLLPGRTVL VYLTDANADR LCPKSNPQGP
710 720 730 740 750
PLNYALLLIG MMITRAEQVD VVLCGGDTLK TAVLKAEEGI LKTAIKLQAQ
760 770 780 790 800
VQEFDENDGW SLNTFGKYLL SLAGQRVPVD RVILLGQSMD DGMINVAKQL
810 820 830 840 850
YWQRVNSKCL FVGILLRRVQ YLSTDLNPND VTLSGCTDAI LKFIAEHGAS
860 870 880 890 900
HLLEHVGQMD KIFKIPPPPG KTGVQSLRPL EEDTPSPLAP VSQQGWRSIR
910 920 930 940 950
LFISSTFRDM HGERDLLLRS VLPALQARAA PHRISLHGID LRWGVTEEET
960 970 980 990 1000
RRNRQLEVCL GEVENAQLFV GILGSRYGYI PPSYNLPDHP HFHWAQQYPS
1010 1020 1030 1040 1050
GRSVTEMEVM QFLNRNQRLQ PSAQALIYFR DSSFLSSVPD AWKSDFVSES
1060 1070 1080 1090 1100
EEAARRISEL KSYLSRQKGI TCRRYPCEWG GVAAGRPYVG GLEEFGQLVL
1110 1120 1130 1140 1150
QDVWNMIQKL YLQPGALLEQ PVSIPDDDLV QATFQQLQKP PSPARPRLLQ
1160 1170 1180 1190 1200
DTVQRLMLPH GRLSLVTGQS GQGKTAFLAS LVSALQAPDG AKVASLVFFH
1210 1220 1230 1240 1250
FSGARPDQGL ALTLLRRLCT YLRGQLKEPG ALPSTYRSLV WELQQRLLPK
1260 1270 1280 1290 1300
SAESLHPGQT QVLIIDGADR LVDQNGQLIS DWIPKKLPRC VHLVLSVSSD
1310 1320 1330 1340 1350
AGLGETLEQS QGAHVLALGP LEASARARLV REELALYGKR LEESPFNNQM
1360 1370 1380 1390 1400
RLLLVKRESG RPLYLRLVTD HLRLFTLYEQ VSERLRTLPA TVPLLLQHIL
1410 1420 1430 1440 1450
STLEKEHGPD VLPQALTALE VTRSGLTVDQ LHGVLSVWRT LPKGTKSWEE
1460 1470 1480 1490 1500
AVAAGNSGDP YPMGPFACLV QSLRSLLGEG PLERPGARLC LPDGPLRTAA
1510 1520 1530 1540 1550
KRCYGKRPGL EDTAHILIAA QLWKTCDADA SGTFRSCPPE ALGDLPYHLL
1560 1570 1580 1590 1600
QSGNRGLLSK FLTNLHVVAA HLELGLVSRL LEAHALYASS VPKEEQKLPE
1610 1620 1630 1640 1650
ADVAVFRTFL RQQASILSQY PRLLPQQAAN QPLDSPLCHQ ASLLSRRWHL
1660 1670 1680 1690 1700
QHTLRWLNKP RTMKNQQSSS LSLAVSSSPT AVAFSTNGQR AAVGTANGTV
1710 1720 1730 1740 1750
YLLDLRTWQE EKSVVSGCDG ISACLFLSDD TLFLTAFDGL LELWDLQHGC
1760 1770 1780 1790 1800
RVLQTKAHQY QITGCCLSPD CRLLATVCLG GCLKLWDTVR GQLAFQHTYP
1810 1820 1830 1840 1850
KSLNCVAFHP EGQVIATGSW AGSISFFQVD GLKVTKDLGA PGASIRTLAF
1860 1870 1880 1890 1900
NVPGGVVAVG RLDSMVELWA WREGARLAAF PAHHGFVAAA LFLHAGCQLL
1910 1920 1930 1940 1950
TAGEDGKVQV WSGSLGRPRG HLGSLSLSPA LSVALSPDGD RVAVGYRADG
1960 1970 1980 1990 2000
IRIYKISSGS QGAQGQALDV AVSALAWLSP KVLVSGAEDG SLQGWALKEC
2010 2020 2030 2040 2050
SLQSLWLLSR FQKPVLGLAT SQELLASASE DFTVQLWPRQ LLTRPHKAED
2060 2070 2080 2090 2100
FPCGTELRGH EGPVSCCSFS TDGGSLATGG RDRSLLCWDV RTPKTPVLIH
2110 2120 2130 2140 2150
SFPACHRDWV TGCAWTKDNL LISCSSDGSV GLWDPESGQR LGQFLGHQSA
2160 2170 2180 2190 2200
VSAVAAVEEH VVSVSRDGTL KVWDHQGVEL TSIPAHSGPI SHCAAAMEPR
2210 2220 2230 2240 2250
AAGQPGSELL VVTVGLDGAT RLWHPLLVCQ THTLLGHSGP VRAAAVSETS
2260 2270 2280 2290 2300
GLMLTASEDG SVRLWQVPKE ADDTCIPRSS AAVTAVAWAP DGSMAVSGNQ
2310 2320 2330 2340 2350
AGELILWQEA KAVATAQAPG HIGALIWSSA HTFFVLSADE KISEWQVKLR
2360 2370 2380 2390 2400
KGSAPGNLSL HLNRILQEDL GVLTSLDWAP DGHFLILAKA DLKLLCMKPG
2410 2420 2430 2440 2450
DAPSEIWSSY TENPMILSTH KEYGIFVLQP KDPGVLSFLR QKESGEFEER
2460 2470 2480 2490 2500
LNFDINLENP SRTLISITQA KPESESSFLC ASSDGILWNL AKCSPEGEWT
2510 2520 2530 2540 2550
TGNMWQKKAN TPETQTPGTD PSTCRESDAS MDSDASMDSE PTPHLKTRQR
2560 2570 2580 2590 2600
RKIHSGSVTA LHVLPELLVT ASKDRDVKLW ERPSMQLLGL FRCEGSVSCL
2610 2620
EPWLGANSTL QLAVGDVQGN VYFLNWE
Length:2,627
Mass (Da):290,490
Last modified:November 25, 2008 - v2
Checksum:i32628238704A8860
GO
Isoform 2 (identifier: Q99973-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     2475-2506: ESSFLCASSDGILWNLAKCSPEGEWTTGNMWQ → ALMGSYGTWPNAAQKENGPQVTCGR

Note: May be due to an exon inclusion.

Show »
Length:2,620
Mass (Da):289,578
Checksum:iD512FB76402A71C4
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti116 – 1161S → P.1 Publication
Corresponds to variant rs1760897 [ dbSNP | Ensembl ].
VAR_018490
Natural varianti137 – 1371T → M.
Corresponds to variant rs10083536 [ dbSNP | Ensembl ].
VAR_047631
Natural varianti307 – 3071N → K.
Corresponds to variant rs1760898 [ dbSNP | Ensembl ].
VAR_018491
Natural varianti368 – 3681K → R.
Corresponds to variant rs2228035 [ dbSNP | Ensembl ].
VAR_047632
Natural varianti434 – 4341K → N.
Corresponds to variant rs17111188 [ dbSNP | Ensembl ].
VAR_047633
Natural varianti510 – 5101S → L.
Corresponds to variant rs4982051 [ dbSNP | Ensembl ].
VAR_047634
Natural varianti553 – 5531A → G.1 Publication
Corresponds to variant rs2228040 [ dbSNP | Ensembl ].
VAR_047635
Natural varianti933 – 9331R → H.
Corresponds to variant rs34179031 [ dbSNP | Ensembl ].
VAR_047636
Natural varianti1055 – 10551R → C.1 Publication
Corresponds to variant rs1760903 [ dbSNP | Ensembl ].
VAR_018492
Natural varianti1155 – 11551R → Q.1 Publication
Corresponds to variant rs2228041 [ dbSNP | Ensembl ].
VAR_047637
Natural varianti1195 – 11951S → P.1 Publication
Corresponds to variant rs1760904 [ dbSNP | Ensembl ].
VAR_018493
Natural varianti1351 – 13511R → Q.
Corresponds to variant rs12886088 [ dbSNP | Ensembl ].
VAR_047638
Natural varianti1408 – 14081G → R.
Corresponds to variant rs2229100 [ dbSNP | Ensembl ].
VAR_047639
Natural varianti1447 – 14471S → T.
Corresponds to variant rs1713457 [ dbSNP | Ensembl ].
VAR_018494
Natural varianti1468 – 14681C → Y.
Corresponds to variant rs1713456 [ dbSNP | Ensembl ].
VAR_018495
Natural varianti1661 – 16611R → Q.
Corresponds to variant rs34401320 [ dbSNP | Ensembl ].
VAR_047640
Natural varianti1772 – 17721R → Q.
Corresponds to variant rs8022805 [ dbSNP | Ensembl ].
VAR_047641
Natural varianti2214 – 22141V → I.
Corresponds to variant rs1713449 [ dbSNP | Ensembl ].
VAR_018496
Natural varianti2310 – 23101A → S.
Corresponds to variant rs35929175 [ dbSNP | Ensembl ].
VAR_047642
Natural varianti2486 – 24861I → M.
Corresponds to variant rs938886 [ dbSNP | Ensembl ].
VAR_018497
Natural varianti2562 – 25621H → R.
Corresponds to variant rs2104978 [ dbSNP | Ensembl ].
VAR_018498

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei2475 – 250632ESSFL…GNMWQ → ALMGSYGTWPNAAQKENGPQ VTCGR in isoform 2. 1 PublicationVSP_010359Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U86136 mRNA. Translation: AAC51107.1.
BC126107 mRNA. Translation: AAI26108.1.
BX640983 mRNA. Translation: CAE45993.1.
CCDSiCCDS9548.1. [Q99973-1]
RefSeqiNP_009041.2. NM_007110.4. [Q99973-1]
XP_005268084.1. XM_005268027.2. [Q99973-1]
UniGeneiHs.508835.

Genome annotation databases

EnsembliENST00000262715; ENSP00000262715; ENSG00000129566. [Q99973-1]
GeneIDi7011.
KEGGihsa:7011.
UCSCiuc001vxe.3. human. [Q99973-1]

Polymorphism databases

DMDMi215273899.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U86136 mRNA. Translation: AAC51107.1 .
BC126107 mRNA. Translation: AAI26108.1 .
BX640983 mRNA. Translation: CAE45993.1 .
CCDSi CCDS9548.1. [Q99973-1 ]
RefSeqi NP_009041.2. NM_007110.4. [Q99973-1 ]
XP_005268084.1. XM_005268027.2. [Q99973-1 ]
UniGenei Hs.508835.

3D structure databases

ProteinModelPortali Q99973.
SMRi Q99973. Positions 1664-2391.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 112870. 13 interactions.
IntActi Q99973. 1 interaction.
MINTi MINT-112815.
STRINGi 9606.ENSP00000262715.

PTM databases

PhosphoSitei Q99973.

Polymorphism databases

DMDMi 215273899.

Proteomic databases

MaxQBi Q99973.
PaxDbi Q99973.
PRIDEi Q99973.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000262715 ; ENSP00000262715 ; ENSG00000129566 . [Q99973-1 ]
GeneIDi 7011.
KEGGi hsa:7011.
UCSCi uc001vxe.3. human. [Q99973-1 ]

Organism-specific databases

CTDi 7011.
GeneCardsi GC14M020833.
H-InvDB HIX0026646.
HGNCi HGNC:11726. TEP1.
HPAi HPA029206.
MIMi 601686. gene.
neXtProti NX_Q99973.
PharmGKBi PA36443.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG2319.
GeneTreei ENSGT00760000119296.
HOGENOMi HOG000154545.
HOVERGENi HBG059633.
InParanoidi Q99973.
KOi K11127.
OMAi LWHPLLV.
OrthoDBi EOG7W6WJT.
PhylomeDBi Q99973.
TreeFami TF328424.

Enzyme and pathway databases

SignaLinki Q99973.

Miscellaneous databases

ChiTaRSi TEP1. human.
GeneWikii TEP1.
GenomeRNAii 7011.
NextBioi 27388.
PROi Q99973.
SOURCEi Search...

Gene expression databases

Bgeei Q99973.
CleanExi HS_TEP1.
ExpressionAtlasi Q99973. baseline and differential.
Genevestigatori Q99973.

Family and domain databases

Gene3Di 2.130.10.10. 7 hits.
InterProi IPR025139. DUF4062.
IPR007111. NACHT_NTPase.
IPR027417. P-loop_NTPase.
IPR008850. TEP1_N.
IPR008858. TROVE.
IPR015943. WD40/YVTN_repeat-like_dom.
IPR001680. WD40_repeat.
IPR019775. WD40_repeat_CS.
IPR017986. WD40_repeat_dom.
[Graphical view ]
Pfami PF13271. DUF4062. 1 hit.
PF05386. TEP1_N. 4 hits.
PF05731. TROVE. 1 hit.
PF00400. WD40. 8 hits.
[Graphical view ]
SMARTi SM00320. WD40. 18 hits.
[Graphical view ]
SUPFAMi SSF50978. SSF50978. 5 hits.
SSF52540. SSF52540. 1 hit.
PROSITEi PS50837. NACHT. 1 hit.
PS51226. TEP1_N. 4 hits.
PS50988. TROVE. 1 hit.
PS00678. WD_REPEATS_1. 1 hit.
PS50082. WD_REPEATS_2. 7 hits.
PS50294. WD_REPEATS_REGION. 2 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY, VARIANTS PRO-116; GLY-553; CYS-1055; GLN-1155 AND PRO-1195.
  2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Cerebellum.
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 2288-2627 (ISOFORM 2).
    Tissue: Salivary gland.
  4. "Human telomerase contains evolutionarily conserved catalytic and structural subunits."
    Harrington L., Zhou W., McPhail T., Oulton R., Yeung D.S., Mar V., Bass M.B., Robinson M.O.
    Genes Dev. 11:3109-3115(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION IN THE TELOMERASE RIBONUCLEOPROTEIN COMPLEX.
  5. Cited for: IDENTIFICATION IN THE VAULTS RIBONUCLEOPROTEIN PARTICLE, RNA-BINDING.
  6. "Polymerization defects within human telomerase are distinct from telomerase RNA and TEP1 binding."
    Beattie T.L., Zhou W., Robinson M.O., Harrington L.
    Mol. Biol. Cell 11:3329-3340(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION IN THE TELOMERASE RIBONUCLEOPROTEIN COMPLEX.
  7. "A human telomerase holoenzyme protein required for Cajal body localization and telomere synthesis."
    Venteicher A.S., Abreu E.B., Meng Z., McCann K.E., Terns R.M., Veenstra T.D., Terns M.P., Artandi S.E.
    Science 323:644-648(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION IN THE TELOMERASE HOLOENZYME COMPLEX.

Entry informationi

Entry nameiTEP1_HUMAN
AccessioniPrimary (citable) accession number: Q99973
Secondary accession number(s): A0AUV9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 24, 2004
Last sequence update: November 25, 2008
Last modified: October 29, 2014
This is version 130 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 14
    Human chromosome 14: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3