Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q99973

- TEP1_HUMAN

UniProt

Q99973 - TEP1_HUMAN

Protein

Telomerase protein component 1

Gene

TEP1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 129 (01 Oct 2014)
      Sequence version 2 (25 Nov 2008)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Component of the telomerase ribonucleoprotein complex that is essential for the replication of chromosome termini. Also component of the ribonucleoprotein vaults particle, a multi-subunit structure involved in nucleo-cytoplasmic transport. Responsible for the localizing and stabilizing vault RNA (vRNA) association in the vault ribonucleoprotein particle. Binds to TERC By similarity.By similarity

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Nucleotide bindingi1168 – 11758ATPPROSITE-ProRule annotation

    GO - Molecular functioni

    1. ATP binding Source: UniProtKB-KW
    2. RNA binding Source: UniProtKB

    GO - Biological processi

    1. RNA-dependent DNA replication Source: GOC
    2. telomere maintenance via recombination Source: UniProtKB

    Keywords - Molecular functioni

    Ribonucleoprotein

    Keywords - Ligandi

    ATP-binding, Nucleotide-binding, RNA-binding

    Enzyme and pathway databases

    SignaLinkiQ99973.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Telomerase protein component 1
    Alternative name(s):
    Telomerase-associated protein 1
    Short name:
    Telomerase protein 1
    p240
    p80 telomerase homolog
    Gene namesi
    Name:TEP1
    Synonyms:TLP1, TP1
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 14

    Organism-specific databases

    HGNCiHGNC:11726. TEP1.

    Subcellular locationi

    GO - Cellular componenti

    1. chromosome, telomeric region Source: UniProtKB-SubCell
    2. cytoplasm Source: MGI
    3. nuclear matrix Source: MGI
    4. ribonucleoprotein complex Source: UniProtKB
    5. telomerase holoenzyme complex Source: UniProtKB

    Keywords - Cellular componenti

    Chromosome, Nucleus, Telomere

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA36443.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 26272627Telomerase protein component 1PRO_0000050982Add
    BLAST

    Proteomic databases

    MaxQBiQ99973.
    PaxDbiQ99973.
    PRIDEiQ99973.

    PTM databases

    PhosphoSiteiQ99973.

    Expressioni

    Tissue specificityi

    Ubiquitous.1 Publication

    Gene expression databases

    ArrayExpressiQ99973.
    BgeeiQ99973.
    CleanExiHS_TEP1.
    GenevestigatoriQ99973.

    Organism-specific databases

    HPAiHPA029206.

    Interactioni

    Subunit structurei

    Component of the telomerase holoenzyme complex at least composed of TERT, DKC1, WRAP53/TCAB1, NOP10, NHP2, GAR1, TEP1, EST1A, POT1 and a telomerase RNA template component (TERC). Component of the vault ribonucleoprotein particle, at least composed of MVP, PARP4 and one or more vault RNAs (vRNAs). Binds to VAULTRC1, VAULTRC2 and VAULTRC4/hvg4 vRNAs By similarity.By similarity

    Protein-protein interaction databases

    BioGridi112870. 12 interactions.
    IntActiQ99973. 1 interaction.
    MINTiMINT-112815.
    STRINGi9606.ENSP00000262715.

    Structurei

    3D structure databases

    ProteinModelPortaliQ99973.
    SMRiQ99973. Positions 1664-2391.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Repeati1 – 3030TEP1 N-terminal 1Add
    BLAST
    Repeati31 – 6030TEP1 N-terminal 2Add
    BLAST
    Repeati61 – 9030TEP1 N-terminal 3Add
    BLAST
    Repeati91 – 12030TEP1 N-terminal 4Add
    BLAST
    Domaini223 – 676454TROVEPROSITE-ProRule annotationAdd
    BLAST
    Domaini1162 – 1490329NACHTPROSITE-ProRule annotationAdd
    BLAST
    Repeati1411 – 144838WD 1Add
    BLAST
    Repeati1674 – 171340WD 2Add
    BLAST
    Repeati1716 – 175439WD 3Add
    BLAST
    Repeati1757 – 179640WD 4Add
    BLAST
    Repeati1798 – 183740WD 5Add
    BLAST
    Repeati1840 – 187940WD 6Add
    BLAST
    Repeati1882 – 192140WD 7Add
    BLAST
    Repeati1925 – 196440WD 8Add
    BLAST
    Repeati1967 – 200539WD 9Add
    BLAST
    Repeati2008 – 204740WD 10Add
    BLAST
    Repeati2059 – 209840WD 11Add
    BLAST
    Repeati2105 – 214339WD 12Add
    BLAST
    Repeati2146 – 218338WD 13Add
    BLAST
    Repeati2185 – 223349WD 14Add
    BLAST
    Repeati2236 – 227540WD 15Add
    BLAST
    Repeati2278 – 231740WD 16Add
    BLAST
    Repeati2319 – 235537WD 17Add
    BLAST
    Repeati2368 – 241750WD 18Add
    BLAST
    Repeati2459 – 250042WD 19Add
    BLAST
    Repeati2553 – 259038WD 20Add
    BLAST
    Repeati2592 – 262635WD 21Add
    BLAST

    Sequence similaritiesi

    Contains 1 NACHT domain.PROSITE-ProRule annotation
    Contains 4 TEP1 N-terminal repeats.PROSITE-ProRule annotation
    Contains 1 TROVE domain.PROSITE-ProRule annotation
    Contains 21 WD repeats.PROSITE-ProRule annotation

    Keywords - Domaini

    Repeat, WD repeat

    Phylogenomic databases

    eggNOGiCOG2319.
    HOGENOMiHOG000154545.
    HOVERGENiHBG059633.
    InParanoidiQ99973.
    KOiK11127.
    OMAiLWHPLLV.
    OrthoDBiEOG7W6WJT.
    PhylomeDBiQ99973.
    TreeFamiTF328424.

    Family and domain databases

    Gene3Di2.130.10.10. 7 hits.
    InterProiIPR025139. DUF4062.
    IPR007111. NACHT_NTPase.
    IPR027417. P-loop_NTPase.
    IPR008850. TEP1_N.
    IPR008858. TROVE.
    IPR015943. WD40/YVTN_repeat-like_dom.
    IPR001680. WD40_repeat.
    IPR019775. WD40_repeat_CS.
    IPR017986. WD40_repeat_dom.
    [Graphical view]
    PfamiPF13271. DUF4062. 1 hit.
    PF05386. TEP1_N. 4 hits.
    PF05731. TROVE. 1 hit.
    PF00400. WD40. 8 hits.
    [Graphical view]
    SMARTiSM00320. WD40. 18 hits.
    [Graphical view]
    SUPFAMiSSF50978. SSF50978. 5 hits.
    SSF52540. SSF52540. 1 hit.
    PROSITEiPS50837. NACHT. 1 hit.
    PS51226. TEP1_N. 4 hits.
    PS50988. TROVE. 1 hit.
    PS00678. WD_REPEATS_1. 1 hit.
    PS50082. WD_REPEATS_2. 7 hits.
    PS50294. WD_REPEATS_REGION. 2 hits.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q99973-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MEKLHGHVSA HPDILSLENR CLAMLPDLQP LEKLHQHVST HSDILSLKNQ     50
    CLATLPDLKT MEKPHGYVSA HPDILSLENQ CLATLSDLKT MEKPHGHVSA 100
    HPDILSLENR CLATLSSLKS TVSASPLFQS LQISHMTQAD LYRVNNSNCL 150
    LSEPPSWRAQ HFSKGLDLST CPIALKSISA TETAQEATLG RWFDSEEKKG 200
    AETQMPSYSL SLGEEEEVED LAVKLTSGDS ESHPEPTDHV LQEKKMALLS 250
    LLCSTLVSEV NMNNTSDPTL AAIFEICREL ALLEPEFILK ASLYARQQLN 300
    VRNVANNILA IAAFLPACRP HLRRYFCAIV QLPSDWIQVA ELYQSLAEGD 350
    KNKLVPLPAC LRTAMTDKFA QFDEYQLAKY NPRKHRAKRH PRRPPRSPGM 400
    EPPFSHRCFP RYIGFLREEQ RKFEKAGDTV SEKKNPPRFT LKKLVQRLHI 450
    HKPAQHVQAL LGYRYPSNLQ LFSRSRLPGP WDSSRAGKRM KLSRPETWER 500
    ELSLRGNKAS VWEELIENGK LPFMAMLRNL CNLLRVGISS RHHELILQRL 550
    QHAKSVIHSR QFPFRFLNAH DAIDALEAQL RNQALPFPSN ITLMRRILTR 600
    NEKNRPRRRF LCHLSRQQLR MAMRIPVLYE QLKREKLRVH KARQWKYDGE 650
    MLNRYRQALE TAVNLSVKHS LPLLPGRTVL VYLTDANADR LCPKSNPQGP 700
    PLNYALLLIG MMITRAEQVD VVLCGGDTLK TAVLKAEEGI LKTAIKLQAQ 750
    VQEFDENDGW SLNTFGKYLL SLAGQRVPVD RVILLGQSMD DGMINVAKQL 800
    YWQRVNSKCL FVGILLRRVQ YLSTDLNPND VTLSGCTDAI LKFIAEHGAS 850
    HLLEHVGQMD KIFKIPPPPG KTGVQSLRPL EEDTPSPLAP VSQQGWRSIR 900
    LFISSTFRDM HGERDLLLRS VLPALQARAA PHRISLHGID LRWGVTEEET 950
    RRNRQLEVCL GEVENAQLFV GILGSRYGYI PPSYNLPDHP HFHWAQQYPS 1000
    GRSVTEMEVM QFLNRNQRLQ PSAQALIYFR DSSFLSSVPD AWKSDFVSES 1050
    EEAARRISEL KSYLSRQKGI TCRRYPCEWG GVAAGRPYVG GLEEFGQLVL 1100
    QDVWNMIQKL YLQPGALLEQ PVSIPDDDLV QATFQQLQKP PSPARPRLLQ 1150
    DTVQRLMLPH GRLSLVTGQS GQGKTAFLAS LVSALQAPDG AKVASLVFFH 1200
    FSGARPDQGL ALTLLRRLCT YLRGQLKEPG ALPSTYRSLV WELQQRLLPK 1250
    SAESLHPGQT QVLIIDGADR LVDQNGQLIS DWIPKKLPRC VHLVLSVSSD 1300
    AGLGETLEQS QGAHVLALGP LEASARARLV REELALYGKR LEESPFNNQM 1350
    RLLLVKRESG RPLYLRLVTD HLRLFTLYEQ VSERLRTLPA TVPLLLQHIL 1400
    STLEKEHGPD VLPQALTALE VTRSGLTVDQ LHGVLSVWRT LPKGTKSWEE 1450
    AVAAGNSGDP YPMGPFACLV QSLRSLLGEG PLERPGARLC LPDGPLRTAA 1500
    KRCYGKRPGL EDTAHILIAA QLWKTCDADA SGTFRSCPPE ALGDLPYHLL 1550
    QSGNRGLLSK FLTNLHVVAA HLELGLVSRL LEAHALYASS VPKEEQKLPE 1600
    ADVAVFRTFL RQQASILSQY PRLLPQQAAN QPLDSPLCHQ ASLLSRRWHL 1650
    QHTLRWLNKP RTMKNQQSSS LSLAVSSSPT AVAFSTNGQR AAVGTANGTV 1700
    YLLDLRTWQE EKSVVSGCDG ISACLFLSDD TLFLTAFDGL LELWDLQHGC 1750
    RVLQTKAHQY QITGCCLSPD CRLLATVCLG GCLKLWDTVR GQLAFQHTYP 1800
    KSLNCVAFHP EGQVIATGSW AGSISFFQVD GLKVTKDLGA PGASIRTLAF 1850
    NVPGGVVAVG RLDSMVELWA WREGARLAAF PAHHGFVAAA LFLHAGCQLL 1900
    TAGEDGKVQV WSGSLGRPRG HLGSLSLSPA LSVALSPDGD RVAVGYRADG 1950
    IRIYKISSGS QGAQGQALDV AVSALAWLSP KVLVSGAEDG SLQGWALKEC 2000
    SLQSLWLLSR FQKPVLGLAT SQELLASASE DFTVQLWPRQ LLTRPHKAED 2050
    FPCGTELRGH EGPVSCCSFS TDGGSLATGG RDRSLLCWDV RTPKTPVLIH 2100
    SFPACHRDWV TGCAWTKDNL LISCSSDGSV GLWDPESGQR LGQFLGHQSA 2150
    VSAVAAVEEH VVSVSRDGTL KVWDHQGVEL TSIPAHSGPI SHCAAAMEPR 2200
    AAGQPGSELL VVTVGLDGAT RLWHPLLVCQ THTLLGHSGP VRAAAVSETS 2250
    GLMLTASEDG SVRLWQVPKE ADDTCIPRSS AAVTAVAWAP DGSMAVSGNQ 2300
    AGELILWQEA KAVATAQAPG HIGALIWSSA HTFFVLSADE KISEWQVKLR 2350
    KGSAPGNLSL HLNRILQEDL GVLTSLDWAP DGHFLILAKA DLKLLCMKPG 2400
    DAPSEIWSSY TENPMILSTH KEYGIFVLQP KDPGVLSFLR QKESGEFEER 2450
    LNFDINLENP SRTLISITQA KPESESSFLC ASSDGILWNL AKCSPEGEWT 2500
    TGNMWQKKAN TPETQTPGTD PSTCRESDAS MDSDASMDSE PTPHLKTRQR 2550
    RKIHSGSVTA LHVLPELLVT ASKDRDVKLW ERPSMQLLGL FRCEGSVSCL 2600
    EPWLGANSTL QLAVGDVQGN VYFLNWE 2627
    Length:2,627
    Mass (Da):290,490
    Last modified:November 25, 2008 - v2
    Checksum:i32628238704A8860
    GO
    Isoform 2 (identifier: Q99973-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         2475-2506: ESSFLCASSDGILWNLAKCSPEGEWTTGNMWQ → ALMGSYGTWPNAAQKENGPQVTCGR

    Note: May be due to an exon inclusion.

    Show »
    Length:2,620
    Mass (Da):289,578
    Checksum:iD512FB76402A71C4
    GO

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti116 – 1161S → P.1 Publication
    Corresponds to variant rs1760897 [ dbSNP | Ensembl ].
    VAR_018490
    Natural varianti137 – 1371T → M.
    Corresponds to variant rs10083536 [ dbSNP | Ensembl ].
    VAR_047631
    Natural varianti307 – 3071N → K.
    Corresponds to variant rs1760898 [ dbSNP | Ensembl ].
    VAR_018491
    Natural varianti368 – 3681K → R.
    Corresponds to variant rs2228035 [ dbSNP | Ensembl ].
    VAR_047632
    Natural varianti434 – 4341K → N.
    Corresponds to variant rs17111188 [ dbSNP | Ensembl ].
    VAR_047633
    Natural varianti510 – 5101S → L.
    Corresponds to variant rs4982051 [ dbSNP | Ensembl ].
    VAR_047634
    Natural varianti553 – 5531A → G.1 Publication
    Corresponds to variant rs2228040 [ dbSNP | Ensembl ].
    VAR_047635
    Natural varianti933 – 9331R → H.
    Corresponds to variant rs34179031 [ dbSNP | Ensembl ].
    VAR_047636
    Natural varianti1055 – 10551R → C.1 Publication
    Corresponds to variant rs1760903 [ dbSNP | Ensembl ].
    VAR_018492
    Natural varianti1155 – 11551R → Q.1 Publication
    Corresponds to variant rs2228041 [ dbSNP | Ensembl ].
    VAR_047637
    Natural varianti1195 – 11951S → P.1 Publication
    Corresponds to variant rs1760904 [ dbSNP | Ensembl ].
    VAR_018493
    Natural varianti1351 – 13511R → Q.
    Corresponds to variant rs12886088 [ dbSNP | Ensembl ].
    VAR_047638
    Natural varianti1408 – 14081G → R.
    Corresponds to variant rs2229100 [ dbSNP | Ensembl ].
    VAR_047639
    Natural varianti1447 – 14471S → T.
    Corresponds to variant rs1713457 [ dbSNP | Ensembl ].
    VAR_018494
    Natural varianti1468 – 14681C → Y.
    Corresponds to variant rs1713456 [ dbSNP | Ensembl ].
    VAR_018495
    Natural varianti1661 – 16611R → Q.
    Corresponds to variant rs34401320 [ dbSNP | Ensembl ].
    VAR_047640
    Natural varianti1772 – 17721R → Q.
    Corresponds to variant rs8022805 [ dbSNP | Ensembl ].
    VAR_047641
    Natural varianti2214 – 22141V → I.
    Corresponds to variant rs1713449 [ dbSNP | Ensembl ].
    VAR_018496
    Natural varianti2310 – 23101A → S.
    Corresponds to variant rs35929175 [ dbSNP | Ensembl ].
    VAR_047642
    Natural varianti2486 – 24861I → M.
    Corresponds to variant rs938886 [ dbSNP | Ensembl ].
    VAR_018497
    Natural varianti2562 – 25621H → R.
    Corresponds to variant rs2104978 [ dbSNP | Ensembl ].
    VAR_018498

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei2475 – 250632ESSFL…GNMWQ → ALMGSYGTWPNAAQKENGPQ VTCGR in isoform 2. 1 PublicationVSP_010359Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U86136 mRNA. Translation: AAC51107.1.
    BC126107 mRNA. Translation: AAI26108.1.
    BX640983 mRNA. Translation: CAE45993.1.
    CCDSiCCDS9548.1. [Q99973-1]
    RefSeqiNP_009041.2. NM_007110.4. [Q99973-1]
    XP_005268084.1. XM_005268027.2. [Q99973-1]
    UniGeneiHs.508835.

    Genome annotation databases

    EnsembliENST00000262715; ENSP00000262715; ENSG00000129566. [Q99973-1]
    GeneIDi7011.
    KEGGihsa:7011.
    UCSCiuc001vxe.3. human. [Q99973-1]

    Polymorphism databases

    DMDMi215273899.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U86136 mRNA. Translation: AAC51107.1 .
    BC126107 mRNA. Translation: AAI26108.1 .
    BX640983 mRNA. Translation: CAE45993.1 .
    CCDSi CCDS9548.1. [Q99973-1 ]
    RefSeqi NP_009041.2. NM_007110.4. [Q99973-1 ]
    XP_005268084.1. XM_005268027.2. [Q99973-1 ]
    UniGenei Hs.508835.

    3D structure databases

    ProteinModelPortali Q99973.
    SMRi Q99973. Positions 1664-2391.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 112870. 12 interactions.
    IntActi Q99973. 1 interaction.
    MINTi MINT-112815.
    STRINGi 9606.ENSP00000262715.

    PTM databases

    PhosphoSitei Q99973.

    Polymorphism databases

    DMDMi 215273899.

    Proteomic databases

    MaxQBi Q99973.
    PaxDbi Q99973.
    PRIDEi Q99973.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000262715 ; ENSP00000262715 ; ENSG00000129566 . [Q99973-1 ]
    GeneIDi 7011.
    KEGGi hsa:7011.
    UCSCi uc001vxe.3. human. [Q99973-1 ]

    Organism-specific databases

    CTDi 7011.
    GeneCardsi GC14M020833.
    H-InvDB HIX0026646.
    HGNCi HGNC:11726. TEP1.
    HPAi HPA029206.
    MIMi 601686. gene.
    neXtProti NX_Q99973.
    PharmGKBi PA36443.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG2319.
    HOGENOMi HOG000154545.
    HOVERGENi HBG059633.
    InParanoidi Q99973.
    KOi K11127.
    OMAi LWHPLLV.
    OrthoDBi EOG7W6WJT.
    PhylomeDBi Q99973.
    TreeFami TF328424.

    Enzyme and pathway databases

    SignaLinki Q99973.

    Miscellaneous databases

    ChiTaRSi TEP1. human.
    GeneWikii TEP1.
    GenomeRNAii 7011.
    NextBioi 27388.
    PROi Q99973.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q99973.
    Bgeei Q99973.
    CleanExi HS_TEP1.
    Genevestigatori Q99973.

    Family and domain databases

    Gene3Di 2.130.10.10. 7 hits.
    InterProi IPR025139. DUF4062.
    IPR007111. NACHT_NTPase.
    IPR027417. P-loop_NTPase.
    IPR008850. TEP1_N.
    IPR008858. TROVE.
    IPR015943. WD40/YVTN_repeat-like_dom.
    IPR001680. WD40_repeat.
    IPR019775. WD40_repeat_CS.
    IPR017986. WD40_repeat_dom.
    [Graphical view ]
    Pfami PF13271. DUF4062. 1 hit.
    PF05386. TEP1_N. 4 hits.
    PF05731. TROVE. 1 hit.
    PF00400. WD40. 8 hits.
    [Graphical view ]
    SMARTi SM00320. WD40. 18 hits.
    [Graphical view ]
    SUPFAMi SSF50978. SSF50978. 5 hits.
    SSF52540. SSF52540. 1 hit.
    PROSITEi PS50837. NACHT. 1 hit.
    PS51226. TEP1_N. 4 hits.
    PS50988. TROVE. 1 hit.
    PS00678. WD_REPEATS_1. 1 hit.
    PS50082. WD_REPEATS_2. 7 hits.
    PS50294. WD_REPEATS_REGION. 2 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY, VARIANTS PRO-116; GLY-553; CYS-1055; GLN-1155 AND PRO-1195.
    2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Cerebellum.
    3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 2288-2627 (ISOFORM 2).
      Tissue: Salivary gland.
    4. "Human telomerase contains evolutionarily conserved catalytic and structural subunits."
      Harrington L., Zhou W., McPhail T., Oulton R., Yeung D.S., Mar V., Bass M.B., Robinson M.O.
      Genes Dev. 11:3109-3115(1997) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION IN THE TELOMERASE RIBONUCLEOPROTEIN COMPLEX.
    5. Cited for: IDENTIFICATION IN THE VAULTS RIBONUCLEOPROTEIN PARTICLE, RNA-BINDING.
    6. "Polymerization defects within human telomerase are distinct from telomerase RNA and TEP1 binding."
      Beattie T.L., Zhou W., Robinson M.O., Harrington L.
      Mol. Biol. Cell 11:3329-3340(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION IN THE TELOMERASE RIBONUCLEOPROTEIN COMPLEX.
    7. "A human telomerase holoenzyme protein required for Cajal body localization and telomere synthesis."
      Venteicher A.S., Abreu E.B., Meng Z., McCann K.E., Terns R.M., Veenstra T.D., Terns M.P., Artandi S.E.
      Science 323:644-648(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION IN THE TELOMERASE HOLOENZYME COMPLEX.

    Entry informationi

    Entry nameiTEP1_HUMAN
    AccessioniPrimary (citable) accession number: Q99973
    Secondary accession number(s): A0AUV9
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: May 24, 2004
    Last sequence update: November 25, 2008
    Last modified: October 1, 2014
    This is version 129 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 14
      Human chromosome 14: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3