Q99963 (SH3G3_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 125.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Endophilin-A3 Alternative name(s): EEN-B2 Endophilin-3 SH3 domain protein 2C SH3 domain-containing GRB2-like protein 3 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 347 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Implicated in endocytosis. May recruit other proteins to membranes with high curvature By similarity. |
| Subunit structure | Interacts with ARC By similarity. Interacts with DNM1, SGIP1 and SYNJ1. Interacts with the huntingtin exon 1 protein (HDEX1P) containing a glutamine repeat in the pathological range and promotes formation of insoluble polyglutamine-containing aggregates in vivo. Interacts with DYDC1. Interacts with FASLG. Interacts with ATX2. Interacts with BIN2. Ref.3 Ref.4 Ref.5 Ref.6 Ref.7 Ref.8 Ref.10 |
| Subcellular location | Cytoplasm By similarity. Early endosome membrane; Peripheral membrane protein By similarity. Note: Associated with postsynaptic endosomes in hippocampal neurons. Associated with presynaptic endosomes in olfactory neurons By similarity. |
| Tissue specificity | Brain and testis. |
| Domain | An N-terminal amphipathic helix, the BAR domain and a second amphipathic helix inserted into helix 1 of the BAR domain (N-BAR domain) induce membrane curvature and bind curved membranes By similarity. |
| Sequence similarities | Belongs to the endophilin family. Contains 1 BAR domain. Contains 1 SH3 domain. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Endocytosis |
| Cellular component | Cytoplasm Endosome Membrane |
| Coding sequence diversity | Alternative splicing |
| Domain | Coiled coil SH3 domain |
| Ligand | Lipid-binding |
| Technical term | 3D-structure Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | central nervous system development Traceable author statement Ref.1. Source: ProtInc endocytosisInferred from electronic annotation. Source: UniProtKB-KW signal transductionTraceable author statement Ref.1. Source: ProtInc |
| Cellular_component | early endosome membrane Inferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular_function | lipid binding Inferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| itself | 2 | EBI-473910,EBI-473910 | ||
| ATXN2 | Q99700 | 7 | EBI-473910,EBI-697691 | |
| HTT | P42858 | 4 | EBI-473910,EBI-466029 | |
| SH3GL1 | Q99961 | 3 | EBI-473910,EBI-697911 | |
| SH3GL2 | Q99962 | 4 | EBI-473910,EBI-77938 |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q99963-1) Also known as: EEN-B2-L1; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q99963-2) Also known as: EEN-B2-L2; The sequence of this isoform differs from the canonical sequence as follows: 1-69: Missing. | ||||||
| Isoform 3 (identifier: Q99963-3) Also known as: EEN-B2-L3; The sequence of this isoform differs from the canonical sequence as follows: 1-14: MSVAGLKKQFHKAS → MDGIFAGIICNQANRCLTWTSQ | ||||||
| Isoform 4 (identifier: Q99963-4) Also known as: EEN-B2-L4; The sequence of this isoform differs from the canonical sequence as follows: 311-347: IITLTNQIDENWYEGMIHGESGFFPINYVEVIVPLPQ → GTFRKIKRETKIKMCRKKIVNIYKLKDQQH |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 347 | 347 | Endophilin-A3 | PRO_0000146750 | ||||||||||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||||||||||
| Domain | 18 – 249 | 232 | BAR | |||||||||||||||||||||||||||||||
| Domain | 285 – 344 | 60 | SH3 | |||||||||||||||||||||||||||||||
| Region | 1 – 21 | 21 | Membrane-binding amphipathic helix By similarity | |||||||||||||||||||||||||||||||
| Region | 60 – 87 | 28 | Required for dimerization upon membrane association By similarity | |||||||||||||||||||||||||||||||
| Region | 218 – 254 | 37 | Interaction with ARC By similarity | |||||||||||||||||||||||||||||||
| Coiled coil | 181 – 201 | 21 | Potential | |||||||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 69 | 69 | Missing in isoform 2. | VSP_001441 | ||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 14 | 14 | MSVAG…FHKAS → MDGIFAGIICNQANRCLTWT SQ in isoform 3. | VSP_001440 | ||||||||||||||||||||||||||||||
| Alternative sequence | 311 – 347 | 37 | IITLT…VPLPQ → GTFRKIKRETKIKMCRKKIV NIYKLKDQQH in isoform 4. | VSP_001442 | ||||||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||||||
| Helix | 31 – 58 | 28 | ||||||||||||||||||||||||||||||||
| Helix | 62 – 69 | 8 | ||||||||||||||||||||||||||||||||
| Helix | 89 – 104 | 16 | ||||||||||||||||||||||||||||||||
| Helix | 109 – 138 | 30 | ||||||||||||||||||||||||||||||||
| Helix | 140 – 148 | 9 | ||||||||||||||||||||||||||||||||
| Helix | 150 – 172 | 23 | ||||||||||||||||||||||||||||||||
| Turn | 173 – 176 | 4 | ||||||||||||||||||||||||||||||||
| Helix | 180 – 206 | 27 | ||||||||||||||||||||||||||||||||
| Helix | 209 – 246 | 38 | ||||||||||||||||||||||||||||||||
| Beta strand | 289 – 294 | 6 | ||||||||||||||||||||||||||||||||
| Beta strand | 311 – 327 | 17 | ||||||||||||||||||||||||||||||||
| Beta strand | 330 – 335 | 6 | ||||||||||||||||||||||||||||||||
| Helix | 336 – 338 | 3 | ||||||||||||||||||||||||||||||||
| Beta strand | 339 – 342 | 4 | ||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "A novel SH3-containing human gene family preferentially expressed in the central nervous system." Giachino C., Lantelme E., Lanzetti L., Saccone S., Della Valle G., Migone N. Genomics 41:427-434(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Fetal brain. |
| [2] | "A family of EEN-like genes coding for SH3-domain containing proteins are preferentially expressed in human brain." So C.W., So C.K.C., Sham M.H., Chan L.C. Submitted (MAR-1998) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3 AND 4). Tissue: Brain. |
| [3] | "SH3GL3 associates with the Huntingtin exon 1 protein and promotes the formation of polygln-containing protein aggregates." Sittler A., Walter S., Wedemeyer N., Hasenbank R., Scherzinger E., Eickhoff H., Bates G.P., Lehrach H., Wanker E.E. Mol. Cell 2:427-436(1998) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH HUNTINGTIN EXON 1 PROTEIN. |
| [4] | "The SH3 domains of endophilin and amphiphysin bind to the proline-rich region of synaptojanin 1 at distinct sites that display an unconventional binding specificity." Cestra G., Castagnoli L., Dente L., Minenkova O., Petrelli A., Migone N., Hoffmueller U., Schneider-Mergener J., Cesareni G. J. Biol. Chem. 274:32001-32007(1999) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH SYNJ1. |
| [5] | "Src homology 3-domain growth factor receptor-bound 2-like (endophilin) interacting protein 1, a novel neuronal protein that regulates energy balance." Trevaskis J., Walder K., Foletta V., Kerr-Bayles L., McMillan J., Cooper A., Lee S., Bolton K., Prior M., Fahey R., Whitecross K., Morton G.J., Schwartz M.W., Collier G.R. Endocrinology 146:3757-3764(2005) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH SGIP1. |
| [6] | "Ataxin-2 associates with the endocytosis complex and affects EGF receptor trafficking." Nonis D., Schmidt M.H., van de Loo S., Eich F., Dikic I., Nowock J., Auburger G. Cell. Signal. 20:1725-1739(2008) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH ATX2. |
| [7] | "Identification of SH3 domain interaction partners of human FasL (CD178) by phage display screening." Voss M., Lettau M., Janssen O. BMC Immunol. 10:53-53(2009) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH FASLG. |
| [8] | "Interaction of SH3P13 and DYDC1 protein: a germ cell component that regulates acrosome biogenesis during spermiogenesis." Li S., Qiao Y., Di Q., Le X., Zhang L., Zhang X., Zhang C., Cheng J., Zong S., Koide S.S., Miao S., Wang L. Eur. J. Cell Biol. 88:509-520(2009) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH DYDC1. |
| [9] | "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation." Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B. Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [10] | "Bin2 is a membrane sculpting N-BAR protein that influences leucocyte podosomes, motility and phagocytosis." Sanchez-Barrena M.J., Vallis Y., Clatworthy M.R., Doherty G.J., Veprintsev D.B., Evans P.R., McMahon H.T. PLoS ONE 7:E52401-E52401(2012) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH BIN2. |
| [11] | "Crystal structure of BAR domain of endophilin-III." RIKEN structural genomics initiative (RSGI) Submitted (FEB-2009) to the PDB data bank Cited for: X-RAY CRYSTALLOGRAPHY (2.49 ANGSTROMS) OF 22-256. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | X99664 mRNA. Translation: CAA67978.1. AF036269 mRNA. Translation: AAC04765.1. AF036270 mRNA. Translation: AAC04766.1. AF036271 mRNA. Translation: AAC04767.1. AF036272 mRNA. Translation: AAC04768.1. | ||||||||||||||||||
| IPI | IPI00019172. IPI00216201. IPI00216202. IPI00216203. | ||||||||||||||||||
| RefSeq | NP_003018.3. NM_003027.3. | ||||||||||||||||||
| UniGene | Hs.270055. Hs.666365. | ||||||||||||||||||
3D structure databases | |||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||
| ProteinModelPortal | Q99963. | ||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||
| IntAct | Q99963. 29 interactions. | ||||||||||||||||||
| MINT | MINT-128532. | ||||||||||||||||||
| STRING | 9606.ENSP00000391372. | ||||||||||||||||||
PTM databases | |||||||||||||||||||
| PhosphoSite | Q99963. | ||||||||||||||||||
Polymorphism databases | |||||||||||||||||||
| DMDM | 12643798. | ||||||||||||||||||
Proteomic databases | |||||||||||||||||||
| PaxDb | Q99963. | ||||||||||||||||||
| PRIDE | Q99963. | ||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||
| DNASU | 6457. | ||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||
Genome annotation databases | |||||||||||||||||||
| Ensembl | ENST00000324537; ENSP00000320092; ENSG00000140600. ENST00000427482; ENSP00000391372; ENSG00000140600. ENST00000434347; ENSP00000397871; ENSG00000140600. | ||||||||||||||||||
| GeneID | 6457. | ||||||||||||||||||
| KEGG | hsa:6457. | ||||||||||||||||||
| UCSC | uc002bju.3. human. uc002bjw.3. human. | ||||||||||||||||||
Organism-specific databases | |||||||||||||||||||
| CTD | 6457. | ||||||||||||||||||
| GeneCards | GC15P084115. | ||||||||||||||||||
| H-InvDB | HIX0026775. | ||||||||||||||||||
| HGNC | HGNC:10832. SH3GL3. | ||||||||||||||||||
| HPA | HPA039381. | ||||||||||||||||||
| MIM | 603362. gene. | ||||||||||||||||||
| neXtProt | NX_Q99963. | ||||||||||||||||||
| PharmGKB | PA35738. | ||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||
| eggNOG | NOG307129. | ||||||||||||||||||
| HOGENOM | HOG000231641. | ||||||||||||||||||
| HOVERGEN | HBG052866. | ||||||||||||||||||
| InParanoid | Q99963. | ||||||||||||||||||
| KO | K11247. | ||||||||||||||||||
| OMA | GMLNTMS. | ||||||||||||||||||
| OrthoDB | EOG4C2H9V. | ||||||||||||||||||
Gene expression databases | |||||||||||||||||||
| ArrayExpress | Q99963. | ||||||||||||||||||
| Bgee | Q99963. | ||||||||||||||||||
| CleanEx | HS_SH3GL3. | ||||||||||||||||||
| Genevestigator | Q99963. | ||||||||||||||||||
| GermOnline | ENSG00000140600. Homo sapiens. | ||||||||||||||||||
Family and domain databases | |||||||||||||||||||
| Gene3D | 1.20.1270.60. 1 hit. | ||||||||||||||||||
| InterPro | IPR027267. AH/BAR-dom. IPR004148. BAR_dom. IPR001452. SH3_domain. [Graphical view] | ||||||||||||||||||
| Pfam | PF03114. BAR. 1 hit. PF00018. SH3_1. 1 hit. [Graphical view] | ||||||||||||||||||
| PRINTS | PR00452. SH3DOMAIN. | ||||||||||||||||||
| SMART | SM00721. BAR. 1 hit. SM00326. SH3. 1 hit. [Graphical view] | ||||||||||||||||||
| SUPFAM | SSF50044. SH3. 1 hit. | ||||||||||||||||||
| PROSITE | PS51021. BAR. 1 hit. PS50002. SH3. 1 hit. [Graphical view] | ||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||
Other | |||||||||||||||||||
| EvolutionaryTrace | Q99963. | ||||||||||||||||||
| GenomeRNAi | 6457. | ||||||||||||||||||
| NextBio | 25097. | ||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||
Entry information
| Entry name | SH3G3_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q99963 Secondary accession number(s): O43553, O43554 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 15 Human chromosome 15: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
