Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q99963

- SH3G3_HUMAN

UniProt

Q99963 - SH3G3_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Endophilin-A3

Gene

SH3GL3

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Implicated in endocytosis. May recruit other proteins to membranes with high curvature (By similarity).By similarity

GO - Molecular functioni

  1. identical protein binding Source: IntAct
  2. lipid binding Source: UniProtKB-KW

GO - Biological processi

  1. central nervous system development Source: ProtInc
  2. endocytosis Source: UniProtKB-KW
  3. signal transduction Source: ProtInc
Complete GO annotation...

Keywords - Biological processi

Endocytosis

Keywords - Ligandi

Lipid-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Endophilin-A3
Alternative name(s):
EEN-B2
Endophilin-3
SH3 domain protein 2C
SH3 domain-containing GRB2-like protein 3
Gene namesi
Name:SH3GL3
Synonyms:CNSA3, SH3D2C
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 15

Organism-specific databases

HGNCiHGNC:10832. SH3GL3.

Subcellular locationi

Cytoplasm By similarity. Early endosome membrane By similarity; Peripheral membrane protein By similarity
Note: Associated with postsynaptic endosomes in hippocampal neurons. Associated with presynaptic endosomes in olfactory neurons (By similarity).By similarity

GO - Cellular componenti

  1. endosome Source: UniProtKB-KW
  2. extracellular vesicular exosome Source: UniProt
  3. membrane Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Endosome, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA35738.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 347347Endophilin-A3PRO_0000146750Add
BLAST

Proteomic databases

MaxQBiQ99963.
PaxDbiQ99963.
PRIDEiQ99963.

PTM databases

PhosphoSiteiQ99963.

Expressioni

Tissue specificityi

Brain and testis.

Gene expression databases

BgeeiQ99963.
CleanExiHS_SH3GL3.
ExpressionAtlasiQ99963. baseline and differential.
GenevestigatoriQ99963.

Organism-specific databases

HPAiHPA039381.

Interactioni

Subunit structurei

Interacts with ARC (By similarity). Interacts with DNM1, SGIP1 and SYNJ1. Interacts with the huntingtin exon 1 protein (HDEX1P) containing a glutamine repeat in the pathological range and promotes formation of insoluble polyglutamine-containing aggregates in vivo. Interacts with DYDC1. Interacts with FASLG. Interacts with ATX2. Interacts with BIN2.By similarity7 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
itself3EBI-473910,EBI-473910
ATXN2Q9970011EBI-473910,EBI-697691
HTTP428589EBI-473910,EBI-466029
RAPH1Q70E734EBI-473910,EBI-3940924
SH3GL1Q999614EBI-473910,EBI-697911
SH3GL2Q999625EBI-473910,EBI-77938

Protein-protein interaction databases

BioGridi112354. 41 interactions.
IntActiQ99963. 40 interactions.
MINTiMINT-128532.
STRINGi9606.ENSP00000391372.

Structurei

Secondary structure

1
347
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Helixi31 – 5828
Helixi62 – 698
Helixi89 – 10416
Helixi109 – 13830
Helixi140 – 1489
Helixi150 – 17223
Turni173 – 1764
Helixi180 – 20627
Helixi209 – 24638
Beta strandi289 – 2946
Beta strandi311 – 32717
Beta strandi330 – 3356
Helixi336 – 3383
Beta strandi339 – 3424

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2EW3NMR-A285-345[»]
2Z0VX-ray2.49A/B24-256[»]
ProteinModelPortaliQ99963.
SMRiQ99963. Positions 30-252, 285-344.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ99963.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini18 – 249232BARPROSITE-ProRule annotationAdd
BLAST
Domaini285 – 34460SH3PROSITE-ProRule annotationAdd
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni1 – 2121Membrane-binding amphipathic helixBy similarityAdd
BLAST
Regioni60 – 8728Required for dimerization upon membrane associationBy similarityAdd
BLAST
Regioni218 – 25437Interaction with ARCBy similarityAdd
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili181 – 20121Sequence AnalysisAdd
BLAST

Domaini

An N-terminal amphipathic helix, the BAR domain and a second amphipathic helix inserted into helix 1 of the BAR domain (N-BAR domain) induce membrane curvature and bind curved membranes.By similarity

Sequence similaritiesi

Belongs to the endophilin family.Curated
Contains 1 BAR domain.PROSITE-ProRule annotation
Contains 1 SH3 domain.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil, SH3 domain

Phylogenomic databases

eggNOGiNOG307129.
GeneTreeiENSGT00550000074464.
HOGENOMiHOG000231641.
HOVERGENiHBG052866.
InParanoidiQ99963.
KOiK11247.
OMAiENDTEHV.
OrthoDBiEOG7G1V6H.
PhylomeDBiQ99963.
TreeFamiTF313281.

Family and domain databases

Gene3Di1.20.1270.60. 1 hit.
InterProiIPR027267. AH/BAR-dom.
IPR004148. BAR_dom.
IPR028501. Endophilin-A.
IPR001452. SH3_domain.
[Graphical view]
PANTHERiPTHR10661:SF120. PTHR10661:SF120. 1 hit.
PfamiPF03114. BAR. 1 hit.
PF14604. SH3_9. 1 hit.
[Graphical view]
PRINTSiPR00452. SH3DOMAIN.
SMARTiSM00721. BAR. 1 hit.
SM00326. SH3. 1 hit.
[Graphical view]
SUPFAMiSSF50044. SSF50044. 1 hit.
PROSITEiPS51021. BAR. 1 hit.
PS50002. SH3. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q99963-1) [UniParc]FASTAAdd to Basket

Also known as: EEN-B2-L1

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSVAGLKKQF HKASQLFSEK ISGAEGTKLD DEFLDMERKI DVTNKVVAEI
60 70 80 90 100
LSKTTEYLQP NPAYRAKLGM LNTVSKIRGQ VKTTGYPQTE GLLGDCMLKY
110 120 130 140 150
GKELGEDSTF GNALIEVGES MKLMAEVKDS LDINVKQTFI DPLQLLQDKD
160 170 180 190 200
LKEIGHHLKK LEGRRLDYDY KKKRVGKIPD EEVRQAVEKF EESKELAERS
210 220 230 240 250
MFNFLENDVE QVSQLAVFIE AALDYHRQST EILQELQSKL QMRISAASSV
260 270 280 290 300
PRREYKPRPV KRSSSELNGV STTSVVKTTG SNIPMDQPCC RGLYDFEPEN
310 320 330 340
QGELGFKEGD IITLTNQIDE NWYEGMIHGE SGFFPINYVE VIVPLPQ
Length:347
Mass (Da):39,285
Last modified:May 1, 1997 - v1
Checksum:iD68DA7B28574C4E6
GO
Isoform 2 (identifier: Q99963-2) [UniParc]FASTAAdd to Basket

Also known as: EEN-B2-L2

The sequence of this isoform differs from the canonical sequence as follows:
     1-69: Missing.

Show »
Length:278
Mass (Da):31,587
Checksum:iE0C2DDBD871FBB09
GO
Isoform 3 (identifier: Q99963-3) [UniParc]FASTAAdd to Basket

Also known as: EEN-B2-L3

The sequence of this isoform differs from the canonical sequence as follows:
     1-14: MSVAGLKKQFHKAS → MDGIFAGIICNQANRCLTWTSQ

Show »
Length:355
Mass (Da):40,196
Checksum:iAB91D787F6C13AFC
GO
Isoform 4 (identifier: Q99963-4) [UniParc]FASTAAdd to Basket

Also known as: EEN-B2-L4

The sequence of this isoform differs from the canonical sequence as follows:
     311-347: IITLTNQIDENWYEGMIHGESGFFPINYVEVIVPLPQ → GTFRKIKRETKIKMCRKKIVNIYKLKDQQH

Show »
Length:340
Mass (Da):38,739
Checksum:iBC523D052F3E0114
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 6969Missing in isoform 2. 1 PublicationVSP_001441Add
BLAST
Alternative sequencei1 – 1414MSVAG…FHKAS → MDGIFAGIICNQANRCLTWT SQ in isoform 3. 1 PublicationVSP_001440Add
BLAST
Alternative sequencei311 – 34737IITLT…VPLPQ → GTFRKIKRETKIKMCRKKIV NIYKLKDQQH in isoform 4. 1 PublicationVSP_001442Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
X99664 mRNA. Translation: CAA67978.1.
AF036269 mRNA. Translation: AAC04765.1.
AF036270 mRNA. Translation: AAC04766.1.
AF036271 mRNA. Translation: AAC04767.1.
AF036272 mRNA. Translation: AAC04768.1.
CCDSiCCDS10325.2. [Q99963-1]
CCDS73772.1. [Q99963-3]
RefSeqiNP_003018.3. NM_003027.4. [Q99963-1]
UniGeneiHs.270055.

Genome annotation databases

EnsembliENST00000324537; ENSP00000320092; ENSG00000140600. [Q99963-3]
ENST00000427482; ENSP00000391372; ENSG00000140600. [Q99963-1]
GeneIDi6457.
KEGGihsa:6457.
UCSCiuc002bju.3. human. [Q99963-3]
uc002bjw.3. human. [Q99963-1]

Polymorphism databases

DMDMi12643798.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
X99664 mRNA. Translation: CAA67978.1 .
AF036269 mRNA. Translation: AAC04765.1 .
AF036270 mRNA. Translation: AAC04766.1 .
AF036271 mRNA. Translation: AAC04767.1 .
AF036272 mRNA. Translation: AAC04768.1 .
CCDSi CCDS10325.2. [Q99963-1 ]
CCDS73772.1. [Q99963-3 ]
RefSeqi NP_003018.3. NM_003027.4. [Q99963-1 ]
UniGenei Hs.270055.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
2EW3 NMR - A 285-345 [» ]
2Z0V X-ray 2.49 A/B 24-256 [» ]
ProteinModelPortali Q99963.
SMRi Q99963. Positions 30-252, 285-344.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 112354. 41 interactions.
IntActi Q99963. 40 interactions.
MINTi MINT-128532.
STRINGi 9606.ENSP00000391372.

PTM databases

PhosphoSitei Q99963.

Polymorphism databases

DMDMi 12643798.

Proteomic databases

MaxQBi Q99963.
PaxDbi Q99963.
PRIDEi Q99963.

Protocols and materials databases

DNASUi 6457.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000324537 ; ENSP00000320092 ; ENSG00000140600 . [Q99963-3 ]
ENST00000427482 ; ENSP00000391372 ; ENSG00000140600 . [Q99963-1 ]
GeneIDi 6457.
KEGGi hsa:6457.
UCSCi uc002bju.3. human. [Q99963-3 ]
uc002bjw.3. human. [Q99963-1 ]

Organism-specific databases

CTDi 6457.
GeneCardsi GC15P084115.
H-InvDB HIX0026775.
HGNCi HGNC:10832. SH3GL3.
HPAi HPA039381.
MIMi 603362. gene.
neXtProti NX_Q99963.
PharmGKBi PA35738.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG307129.
GeneTreei ENSGT00550000074464.
HOGENOMi HOG000231641.
HOVERGENi HBG052866.
InParanoidi Q99963.
KOi K11247.
OMAi ENDTEHV.
OrthoDBi EOG7G1V6H.
PhylomeDBi Q99963.
TreeFami TF313281.

Miscellaneous databases

EvolutionaryTracei Q99963.
GeneWikii SH3GL3.
GenomeRNAii 6457.
NextBioi 25097.
PROi Q99963.
SOURCEi Search...

Gene expression databases

Bgeei Q99963.
CleanExi HS_SH3GL3.
ExpressionAtlasi Q99963. baseline and differential.
Genevestigatori Q99963.

Family and domain databases

Gene3Di 1.20.1270.60. 1 hit.
InterProi IPR027267. AH/BAR-dom.
IPR004148. BAR_dom.
IPR028501. Endophilin-A.
IPR001452. SH3_domain.
[Graphical view ]
PANTHERi PTHR10661:SF120. PTHR10661:SF120. 1 hit.
Pfami PF03114. BAR. 1 hit.
PF14604. SH3_9. 1 hit.
[Graphical view ]
PRINTSi PR00452. SH3DOMAIN.
SMARTi SM00721. BAR. 1 hit.
SM00326. SH3. 1 hit.
[Graphical view ]
SUPFAMi SSF50044. SSF50044. 1 hit.
PROSITEi PS51021. BAR. 1 hit.
PS50002. SH3. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "A novel SH3-containing human gene family preferentially expressed in the central nervous system."
    Giachino C., Lantelme E., Lanzetti L., Saccone S., Della Valle G., Migone N.
    Genomics 41:427-434(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Fetal brain.
  2. "A family of EEN-like genes coding for SH3-domain containing proteins are preferentially expressed in human brain."
    So C.W., So C.K.C., Sham M.H., Chan L.C.
    Submitted (MAR-1998) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3 AND 4).
    Tissue: Brain.
  3. "SH3GL3 associates with the Huntingtin exon 1 protein and promotes the formation of polygln-containing protein aggregates."
    Sittler A., Walter S., Wedemeyer N., Hasenbank R., Scherzinger E., Eickhoff H., Bates G.P., Lehrach H., Wanker E.E.
    Mol. Cell 2:427-436(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH HUNTINGTIN EXON 1 PROTEIN.
  4. "The SH3 domains of endophilin and amphiphysin bind to the proline-rich region of synaptojanin 1 at distinct sites that display an unconventional binding specificity."
    Cestra G., Castagnoli L., Dente L., Minenkova O., Petrelli A., Migone N., Hoffmueller U., Schneider-Mergener J., Cesareni G.
    J. Biol. Chem. 274:32001-32007(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH SYNJ1.
  5. "Src homology 3-domain growth factor receptor-bound 2-like (endophilin) interacting protein 1, a novel neuronal protein that regulates energy balance."
    Trevaskis J., Walder K., Foletta V., Kerr-Bayles L., McMillan J., Cooper A., Lee S., Bolton K., Prior M., Fahey R., Whitecross K., Morton G.J., Schwartz M.W., Collier G.R.
    Endocrinology 146:3757-3764(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH SGIP1.
  6. "Ataxin-2 associates with the endocytosis complex and affects EGF receptor trafficking."
    Nonis D., Schmidt M.H., van de Loo S., Eich F., Dikic I., Nowock J., Auburger G.
    Cell. Signal. 20:1725-1739(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH ATX2.
  7. "Identification of SH3 domain interaction partners of human FasL (CD178) by phage display screening."
    Voss M., Lettau M., Janssen O.
    BMC Immunol. 10:53-53(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH FASLG.
  8. "Interaction of SH3P13 and DYDC1 protein: a germ cell component that regulates acrosome biogenesis during spermiogenesis."
    Li S., Qiao Y., Di Q., Le X., Zhang L., Zhang X., Zhang C., Cheng J., Zong S., Koide S.S., Miao S., Wang L.
    Eur. J. Cell Biol. 88:509-520(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH DYDC1.
  9. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
    Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
    Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  10. "Bin2 is a membrane sculpting N-BAR protein that influences leucocyte podosomes, motility and phagocytosis."
    Sanchez-Barrena M.J., Vallis Y., Clatworthy M.R., Doherty G.J., Veprintsev D.B., Evans P.R., McMahon H.T.
    PLoS ONE 7:E52401-E52401(2012) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH BIN2.
  11. "Crystal structure of BAR domain of endophilin-III."
    RIKEN structural genomics initiative (RSGI)
    Submitted (FEB-2009) to the PDB data bank
    Cited for: X-RAY CRYSTALLOGRAPHY (2.49 ANGSTROMS) OF 22-256.

Entry informationi

Entry nameiSH3G3_HUMAN
AccessioniPrimary (citable) accession number: Q99963
Secondary accession number(s): O43553, O43554
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: May 1, 1997
Last modified: October 29, 2014
This is version 139 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 15
    Human chromosome 15: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3