Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Endophilin-A3

Gene

SH3GL3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Implicated in endocytosis. May recruit other proteins to membranes with high curvature (By similarity).By similarity

GO - Molecular functioni

GO - Biological processi

  • central nervous system development Source: ProtInc
  • endocytosis Source: UniProtKB-KW
  • signal transduction Source: ProtInc
Complete GO annotation...

Keywords - Biological processi

Endocytosis

Keywords - Ligandi

Lipid-binding

Enzyme and pathway databases

BioCyciZFISH:ENSG00000140600-MONOMER.
ReactomeiR-HSA-182971. EGFR downregulation.
R-HSA-6807004. Negative regulation of MET activity.
R-HSA-8856825. Cargo recognition for clathrin-mediated endocytosis.
R-HSA-8856828. Clathrin-mediated endocytosis.

Names & Taxonomyi

Protein namesi
Recommended name:
Endophilin-A3
Alternative name(s):
EEN-B2
Endophilin-3
SH3 domain protein 2C
SH3 domain-containing GRB2-like protein 3
Gene namesi
Name:SH3GL3
Synonyms:CNSA3, SH3D2C
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 15

Organism-specific databases

HGNCiHGNC:10832. SH3GL3.

Subcellular locationi

  • Cytoplasm By similarity
  • Early endosome membrane By similarity; Peripheral membrane protein By similarity

  • Note: Associated with postsynaptic endosomes in hippocampal neurons. Associated with presynaptic endosomes in olfactory neurons.By similarity

GO - Cellular componenti

  • early endosome membrane Source: UniProtKB-SubCell
  • extracellular exosome Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Endosome, Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi6457.
OpenTargetsiENSG00000140600.
PharmGKBiPA35738.

Polymorphism and mutation databases

BioMutaiSH3GL3.
DMDMi12643798.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001467501 – 347Endophilin-A3Add BLAST347

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei265PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ99963.
PaxDbiQ99963.
PeptideAtlasiQ99963.
PRIDEiQ99963.

PTM databases

iPTMnetiQ99963.
PhosphoSitePlusiQ99963.

Expressioni

Tissue specificityi

Brain and testis.

Gene expression databases

BgeeiENSG00000140600.
CleanExiHS_SH3GL3.
ExpressionAtlasiQ99963. baseline and differential.
GenevisibleiQ99963. HS.

Organism-specific databases

HPAiHPA039381.

Interactioni

Subunit structurei

Interacts with ARC (By similarity). Interacts with DNM1, SGIP1 and SYNJ1. Interacts with the huntingtin exon 1 protein (HDEX1P) containing a glutamine repeat in the pathological range and promotes formation of insoluble polyglutamine-containing aggregates in vivo. Interacts with DYDC1. Interacts with FASLG. Interacts with ATX2. Interacts with BIN2.By similarity7 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
itself3EBI-473910,EBI-473910
ATXN2Q9970011EBI-473910,EBI-697691
HTTP428589EBI-473910,EBI-466029
RAPH1Q70E734EBI-473910,EBI-3940924
SH3GL1Q999614EBI-473910,EBI-697911
SH3GL2Q999625EBI-473910,EBI-77938

Protein-protein interaction databases

BioGridi112354. 42 interactors.
DIPiDIP-34766N.
IntActiQ99963. 44 interactors.
MINTiMINT-128532.
STRINGi9606.ENSP00000391372.

Structurei

Secondary structure

1347
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi31 – 58Combined sources28
Helixi62 – 69Combined sources8
Helixi89 – 104Combined sources16
Helixi109 – 138Combined sources30
Helixi140 – 148Combined sources9
Helixi150 – 172Combined sources23
Turni173 – 176Combined sources4
Helixi180 – 206Combined sources27
Helixi209 – 246Combined sources38
Beta strandi289 – 294Combined sources6
Beta strandi311 – 327Combined sources17
Beta strandi330 – 335Combined sources6
Helixi336 – 338Combined sources3
Beta strandi339 – 342Combined sources4

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2EW3NMR-A285-345[»]
2Z0VX-ray2.49A/B24-256[»]
ProteinModelPortaliQ99963.
SMRiQ99963.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ99963.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini18 – 249BARPROSITE-ProRule annotationAdd BLAST232
Domaini285 – 344SH3PROSITE-ProRule annotationAdd BLAST60

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni1 – 21Membrane-binding amphipathic helixBy similarityAdd BLAST21
Regioni60 – 87Required for dimerization upon membrane associationBy similarityAdd BLAST28
Regioni218 – 254Interaction with ARCBy similarityAdd BLAST37

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili181 – 201Sequence analysisAdd BLAST21

Domaini

An N-terminal amphipathic helix, the BAR domain and a second amphipathic helix inserted into helix 1 of the BAR domain (N-BAR domain) induce membrane curvature and bind curved membranes.By similarity

Sequence similaritiesi

Belongs to the endophilin family.Curated
Contains 1 BAR domain.PROSITE-ProRule annotation
Contains 1 SH3 domain.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil, SH3 domain

Phylogenomic databases

eggNOGiKOG1118. Eukaryota.
ENOG410XNYB. LUCA.
GeneTreeiENSGT00550000074464.
HOGENOMiHOG000231641.
HOVERGENiHBG052866.
InParanoidiQ99963.
KOiK11247.
OMAiQMAEVKD.
OrthoDBiEOG091G16FW.
PhylomeDBiQ99963.
TreeFamiTF313281.

Family and domain databases

Gene3Di1.20.1270.60. 1 hit.
InterProiIPR027267. AH/BAR-dom.
IPR004148. BAR_dom.
IPR032469. Endophilin-A3.
IPR011511. SH3_2.
IPR001452. SH3_domain.
[Graphical view]
PANTHERiPTHR10663:SF158. PTHR10663:SF158. 1 hit.
PfamiPF03114. BAR. 1 hit.
PF07653. SH3_2. 1 hit.
[Graphical view]
PRINTSiPR00452. SH3DOMAIN.
SMARTiSM00721. BAR. 1 hit.
SM00326. SH3. 1 hit.
[Graphical view]
SUPFAMiSSF50044. SSF50044. 1 hit.
PROSITEiPS51021. BAR. 1 hit.
PS50002. SH3. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q99963-1) [UniParc]FASTAAdd to basket
Also known as: EEN-B2-L1

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSVAGLKKQF HKASQLFSEK ISGAEGTKLD DEFLDMERKI DVTNKVVAEI
60 70 80 90 100
LSKTTEYLQP NPAYRAKLGM LNTVSKIRGQ VKTTGYPQTE GLLGDCMLKY
110 120 130 140 150
GKELGEDSTF GNALIEVGES MKLMAEVKDS LDINVKQTFI DPLQLLQDKD
160 170 180 190 200
LKEIGHHLKK LEGRRLDYDY KKKRVGKIPD EEVRQAVEKF EESKELAERS
210 220 230 240 250
MFNFLENDVE QVSQLAVFIE AALDYHRQST EILQELQSKL QMRISAASSV
260 270 280 290 300
PRREYKPRPV KRSSSELNGV STTSVVKTTG SNIPMDQPCC RGLYDFEPEN
310 320 330 340
QGELGFKEGD IITLTNQIDE NWYEGMIHGE SGFFPINYVE VIVPLPQ
Length:347
Mass (Da):39,285
Last modified:May 1, 1997 - v1
Checksum:iD68DA7B28574C4E6
GO
Isoform 2 (identifier: Q99963-2) [UniParc]FASTAAdd to basket
Also known as: EEN-B2-L2

The sequence of this isoform differs from the canonical sequence as follows:
     1-69: Missing.

Show »
Length:278
Mass (Da):31,587
Checksum:iE0C2DDBD871FBB09
GO
Isoform 3 (identifier: Q99963-3) [UniParc]FASTAAdd to basket
Also known as: EEN-B2-L3

The sequence of this isoform differs from the canonical sequence as follows:
     1-14: MSVAGLKKQFHKAS → MDGIFAGIICNQANRCLTWTSQ

Show »
Length:355
Mass (Da):40,196
Checksum:iAB91D787F6C13AFC
GO
Isoform 4 (identifier: Q99963-4) [UniParc]FASTAAdd to basket
Also known as: EEN-B2-L4

The sequence of this isoform differs from the canonical sequence as follows:
     311-347: IITLTNQIDENWYEGMIHGESGFFPINYVEVIVPLPQ → GTFRKIKRETKIKMCRKKIVNIYKLKDQQH

Show »
Length:340
Mass (Da):38,739
Checksum:iBC523D052F3E0114
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0014411 – 69Missing in isoform 2. 1 PublicationAdd BLAST69
Alternative sequenceiVSP_0014401 – 14MSVAG…FHKAS → MDGIFAGIICNQANRCLTWT SQ in isoform 3. 1 PublicationAdd BLAST14
Alternative sequenceiVSP_001442311 – 347IITLT…VPLPQ → GTFRKIKRETKIKMCRKKIV NIYKLKDQQH in isoform 4. 1 PublicationAdd BLAST37

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X99664 mRNA. Translation: CAA67978.1.
AF036269 mRNA. Translation: AAC04765.1.
AF036270 mRNA. Translation: AAC04766.1.
AF036271 mRNA. Translation: AAC04767.1.
AF036272 mRNA. Translation: AAC04768.1.
CCDSiCCDS10325.2. [Q99963-1]
CCDS73772.1. [Q99963-3]
RefSeqiNP_001288037.1. NM_001301108.1. [Q99963-2]
NP_001288038.1. NM_001301109.1. [Q99963-3]
NP_001311112.1. NM_001324183.1. [Q99963-3]
NP_001311114.1. NM_001324185.1. [Q99963-2]
NP_001311116.1. NM_001324187.1. [Q99963-2]
NP_003018.3. NM_003027.4. [Q99963-1]
XP_011520191.1. XM_011521889.1. [Q99963-3]
XP_016877975.1. XM_017022486.1. [Q99963-2]
UniGeneiHs.270055.

Genome annotation databases

EnsembliENST00000324537; ENSP00000320092; ENSG00000140600. [Q99963-3]
ENST00000427482; ENSP00000391372; ENSG00000140600. [Q99963-1]
GeneIDi6457.
KEGGihsa:6457.
UCSCiuc002bju.4. human. [Q99963-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X99664 mRNA. Translation: CAA67978.1.
AF036269 mRNA. Translation: AAC04765.1.
AF036270 mRNA. Translation: AAC04766.1.
AF036271 mRNA. Translation: AAC04767.1.
AF036272 mRNA. Translation: AAC04768.1.
CCDSiCCDS10325.2. [Q99963-1]
CCDS73772.1. [Q99963-3]
RefSeqiNP_001288037.1. NM_001301108.1. [Q99963-2]
NP_001288038.1. NM_001301109.1. [Q99963-3]
NP_001311112.1. NM_001324183.1. [Q99963-3]
NP_001311114.1. NM_001324185.1. [Q99963-2]
NP_001311116.1. NM_001324187.1. [Q99963-2]
NP_003018.3. NM_003027.4. [Q99963-1]
XP_011520191.1. XM_011521889.1. [Q99963-3]
XP_016877975.1. XM_017022486.1. [Q99963-2]
UniGeneiHs.270055.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2EW3NMR-A285-345[»]
2Z0VX-ray2.49A/B24-256[»]
ProteinModelPortaliQ99963.
SMRiQ99963.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi112354. 42 interactors.
DIPiDIP-34766N.
IntActiQ99963. 44 interactors.
MINTiMINT-128532.
STRINGi9606.ENSP00000391372.

PTM databases

iPTMnetiQ99963.
PhosphoSitePlusiQ99963.

Polymorphism and mutation databases

BioMutaiSH3GL3.
DMDMi12643798.

Proteomic databases

MaxQBiQ99963.
PaxDbiQ99963.
PeptideAtlasiQ99963.
PRIDEiQ99963.

Protocols and materials databases

DNASUi6457.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000324537; ENSP00000320092; ENSG00000140600. [Q99963-3]
ENST00000427482; ENSP00000391372; ENSG00000140600. [Q99963-1]
GeneIDi6457.
KEGGihsa:6457.
UCSCiuc002bju.4. human. [Q99963-1]

Organism-specific databases

CTDi6457.
DisGeNETi6457.
GeneCardsiSH3GL3.
H-InvDBHIX0026775.
HGNCiHGNC:10832. SH3GL3.
HPAiHPA039381.
MIMi603362. gene.
neXtProtiNX_Q99963.
OpenTargetsiENSG00000140600.
PharmGKBiPA35738.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1118. Eukaryota.
ENOG410XNYB. LUCA.
GeneTreeiENSGT00550000074464.
HOGENOMiHOG000231641.
HOVERGENiHBG052866.
InParanoidiQ99963.
KOiK11247.
OMAiQMAEVKD.
OrthoDBiEOG091G16FW.
PhylomeDBiQ99963.
TreeFamiTF313281.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000140600-MONOMER.
ReactomeiR-HSA-182971. EGFR downregulation.
R-HSA-6807004. Negative regulation of MET activity.
R-HSA-8856825. Cargo recognition for clathrin-mediated endocytosis.
R-HSA-8856828. Clathrin-mediated endocytosis.

Miscellaneous databases

ChiTaRSiSH3GL3. human.
EvolutionaryTraceiQ99963.
GeneWikiiSH3GL3.
GenomeRNAii6457.
PROiQ99963.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000140600.
CleanExiHS_SH3GL3.
ExpressionAtlasiQ99963. baseline and differential.
GenevisibleiQ99963. HS.

Family and domain databases

Gene3Di1.20.1270.60. 1 hit.
InterProiIPR027267. AH/BAR-dom.
IPR004148. BAR_dom.
IPR032469. Endophilin-A3.
IPR011511. SH3_2.
IPR001452. SH3_domain.
[Graphical view]
PANTHERiPTHR10663:SF158. PTHR10663:SF158. 1 hit.
PfamiPF03114. BAR. 1 hit.
PF07653. SH3_2. 1 hit.
[Graphical view]
PRINTSiPR00452. SH3DOMAIN.
SMARTiSM00721. BAR. 1 hit.
SM00326. SH3. 1 hit.
[Graphical view]
SUPFAMiSSF50044. SSF50044. 1 hit.
PROSITEiPS51021. BAR. 1 hit.
PS50002. SH3. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiSH3G3_HUMAN
AccessioniPrimary (citable) accession number: Q99963
Secondary accession number(s): O43553, O43554
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: May 1, 1997
Last modified: November 30, 2016
This is version 160 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 15
    Human chromosome 15: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.