Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Sperm-associated antigen 8

Gene

SPAG8

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Plays a role in spermatogenesis by enhancing the binding of CREM isoform tau to its coactivator FHL5 and increasing the FHL5-regulated transcriptional activation of CREM isoform tau (By similarity). Involved in the acrosome reaction and in binding of sperm to the zona pellucida (By similarity). Plays a role in regulation of the cell cycle by controlling progression through the G2/M phase, possibly by delaying the activation of CDK1 which is required for entry into mitosis (PubMed:19548270). May play a role in fertility and microtubule formation through interaction with RANBP9 (PubMed:10500252).By similarity2 Publications

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Cell cycle, Differentiation, Fertilization, Spermatogenesis

Enzyme and pathway databases

BioCyciZFISH:ENSG00000137098-MONOMER.

Names & Taxonomyi

Protein namesi
Recommended name:
Sperm-associated antigen 8
Alternative name(s):
HSD-1
Sperm membrane protein 1
Short name:
SMP-1
Sperm membrane protein BS-84
Gene namesi
Name:SPAG8
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 9

Organism-specific databases

HGNCiHGNC:14105. SPAG8.

Subcellular locationi

GO - Cellular componenti

  • acrosomal vesicle Source: UniProtKB-SubCell
  • cytoplasm Source: GO_Central
  • membrane Source: UniProtKB
  • nucleus Source: GO_Central
  • spindle Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Cytoplasmic vesicle, Cytoskeleton, Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi26206.
OpenTargetsiENSG00000137098.
PharmGKBiPA37843.

Polymorphism and mutation databases

BioMutaiSPAG8.
DMDMi62511128.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000720991 – 426Sperm-associated antigen 8Add BLAST426

Proteomic databases

PaxDbiQ99932.
PeptideAtlasiQ99932.
PRIDEiQ99932.

PTM databases

iPTMnetiQ99932.
PhosphoSitePlusiQ99932.

Expressioni

Tissue specificityi

Expressed in testis (germ cells), but not in liver, kidney, prostate and small intestine.1 Publication

Gene expression databases

BgeeiENSG00000137098.
CleanExiHS_SPAG8.
ExpressionAtlasiQ99932. baseline and differential.
GenevisibleiQ99932. HS.

Organism-specific databases

HPAiHPA068012.

Interactioni

Subunit structurei

Interacts with FHL5 (via second LIM domain) (By similarity). Interacts with RANBP9 (PubMed:15014887).By similarity1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
CSTF2P332403EBI-954419,EBI-711360
DTX2Q86UW93EBI-954419,EBI-740376
KLHL32Q5THT13EBI-954419,EBI-10247181
SNRPCQ5TAL43EBI-954419,EBI-10246938

Protein-protein interaction databases

BioGridi117606. 15 interactors.
IntActiQ99932. 15 interactors.
MINTiMINT-2872010.
STRINGi9606.ENSP00000340982.

Structurei

3D structure databases

ProteinModelPortaliQ99932.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi43 – 71Ala-richAdd BLAST29
Compositional biasi136 – 204Gly-richAdd BLAST69

Sequence similaritiesi

Belongs to the SPAG8 family.Curated

Phylogenomic databases

eggNOGiENOG410IYX0. Eukaryota.
ENOG4111NK4. LUCA.
GeneTreeiENSGT00640000091617.
HOGENOMiHOG000294170.
HOVERGENiHBG059013.
InParanoidiQ99932.
OMAiIAQDPCT.
OrthoDBiEOG091G0GY7.
PhylomeDBiQ99932.
TreeFamiTF329075.

Family and domain databases

InterProiIPR026124. Sperm-assoc_Ag8.
[Graphical view]
PANTHERiPTHR15510. PTHR15510. 1 hit.

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q99932-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
METNESTEGS RSRSRSLDIQ PSSEGLGPTS EPFPSSDDSP RSALAAATAA
60 70 80 90 100
AAAAASAAAA TAAFTTAKAA ALSTKTPAPC SEFMEPSSDP SLLGEPCAGP
110 120 130 140 150
GFTHNIAHGS LGFEPVYVSC IAQDTCTTTD HSSNPGPVPG SSSGPVLGSS
160 170 180 190 200
SGAGHGSGSG SGPGCGSVPG SGSGPGPGSG PGSGPGHGSG SHPGPASGPG
210 220 230 240 250
PDTGPDSELS PCIPPGFRNL VADRVPNYTS WSQHCPWEPQ KQPPWEFLQV
260 270 280 290 300
LEPGARGLWK PPDIKGKLMV CYETLPRGQC LLYNWEEERA TNHLDQVPSM
310 320 330 340 350
QDGSESFFFR HGHRGLLTMQ LKSPMPSSTT QKDSYQPPGN VYWPLRGKRE
360 370 380 390 400
AMLEMLLQHQ ICKEVQAEQE PTRKLFEVES VTHHDYRMEL AQAGTPAPTK
410 420
PHDYRQEQPE TFWIQRAPQL PVCEGD
Length:426
Mass (Da):44,819
Last modified:April 12, 2005 - v2
Checksum:i7CFF3447202CA270
GO
Isoform 2 (identifier: Q99932-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     422-426: VCEGD → TWWPLPTQVP...KTVTQEDRGW

Note: No experimental confirmation available.
Show »
Length:501
Mass (Da):53,507
Checksum:iF7A14ED49DF6CE03
GO
Isoform 3 (identifier: Q99932-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     422-426: VCEGD → GVSNIRTLDTPFRKNCSFSTPVPLSLGKLLPYEPENYPYQLGEISSLPCPGGRLGGGGGRMTPF

Note: No experimental confirmation available.Curated
Show »
Length:485
Mass (Da):51,139
Checksum:i206A2AE68C5A4887
GO

Sequence cautioni

The sequence AAB46833 differs from that shown. Reason: Erroneous termination at position 427. Translated as stop.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti5E → G in AAH19247 (PubMed:15489334).Curated1
Sequence conflicti48T → A in BAG63651 (PubMed:14702039).Curated1
Sequence conflicti49A → S in AAB46833 (PubMed:8788182).Curated1
Sequence conflicti176 – 179Missing in BAG63651 (PubMed:14702039).Curated4
Sequence conflicti269M → Q in AAB46833 (PubMed:8788182).Curated1
Sequence conflicti322K → T in AAB46833 (PubMed:8788182).Curated1
Isoform 3 (identifier: Q99932-3)
Sequence conflicti438S → G in BAG63651 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_05699269A → T.Corresponds to variant rs13299596dbSNPEnsembl.1
Natural variantiVAR_069166226P → L.1 PublicationCorresponds to variant rs17851728dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_013274422 – 426VCEGD → TWWPLPTQVPAAEDYLTWKE WGFTGVQEVLSALLRATPGE YSVNICGMNEHPVCSRTWTN RLCHQEMGSKKTVTQEDRGW in isoform 2. 1 Publication5
Alternative sequenceiVSP_046325422 – 426VCEGD → GVSNIRTLDTPFRKNCSFST PVPLSLGKLLPYEPENYPYQ LGEISSLPCPGGRLGGGGGR MTPF in isoform 3. 1 Publication5

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
S83157 mRNA. Translation: AAB46833.1. Sequence problems.
U12978 mRNA. Translation: AAA21129.2.
AK302313 mRNA. Translation: BAG63651.1.
AL133410 Genomic DNA. Translation: CAI10989.1.
BC019247 mRNA. Translation: AAH19247.1.
CCDSiCCDS43798.1. [Q99932-3]
CCDS6592.1. [Q99932-2]
RefSeqiNP_001034681.1. NM_001039592.1. [Q99932-3]
NP_758516.1. NM_172312.1. [Q99932-2]
UniGeneiHs.256747.

Genome annotation databases

EnsembliENST00000340291; ENSP00000340982; ENSG00000137098. [Q99932-2]
ENST00000396638; ENSP00000379878; ENSG00000137098. [Q99932-3]
ENST00000475644; ENSP00000418530; ENSG00000137098. [Q99932-1]
GeneIDi26206.
KEGGihsa:26206.
UCSCiuc003zye.4. human. [Q99932-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
S83157 mRNA. Translation: AAB46833.1. Sequence problems.
U12978 mRNA. Translation: AAA21129.2.
AK302313 mRNA. Translation: BAG63651.1.
AL133410 Genomic DNA. Translation: CAI10989.1.
BC019247 mRNA. Translation: AAH19247.1.
CCDSiCCDS43798.1. [Q99932-3]
CCDS6592.1. [Q99932-2]
RefSeqiNP_001034681.1. NM_001039592.1. [Q99932-3]
NP_758516.1. NM_172312.1. [Q99932-2]
UniGeneiHs.256747.

3D structure databases

ProteinModelPortaliQ99932.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi117606. 15 interactors.
IntActiQ99932. 15 interactors.
MINTiMINT-2872010.
STRINGi9606.ENSP00000340982.

PTM databases

iPTMnetiQ99932.
PhosphoSitePlusiQ99932.

Polymorphism and mutation databases

BioMutaiSPAG8.
DMDMi62511128.

Proteomic databases

PaxDbiQ99932.
PeptideAtlasiQ99932.
PRIDEiQ99932.

Protocols and materials databases

DNASUi26206.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000340291; ENSP00000340982; ENSG00000137098. [Q99932-2]
ENST00000396638; ENSP00000379878; ENSG00000137098. [Q99932-3]
ENST00000475644; ENSP00000418530; ENSG00000137098. [Q99932-1]
GeneIDi26206.
KEGGihsa:26206.
UCSCiuc003zye.4. human. [Q99932-1]

Organism-specific databases

CTDi26206.
DisGeNETi26206.
GeneCardsiSPAG8.
H-InvDBHIX0201390.
HGNCiHGNC:14105. SPAG8.
HPAiHPA068012.
MIMi605731. gene.
neXtProtiNX_Q99932.
OpenTargetsiENSG00000137098.
PharmGKBiPA37843.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IYX0. Eukaryota.
ENOG4111NK4. LUCA.
GeneTreeiENSGT00640000091617.
HOGENOMiHOG000294170.
HOVERGENiHBG059013.
InParanoidiQ99932.
OMAiIAQDPCT.
OrthoDBiEOG091G0GY7.
PhylomeDBiQ99932.
TreeFamiTF329075.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000137098-MONOMER.

Miscellaneous databases

GeneWikiiSPAG8.
GenomeRNAii26206.
PROiQ99932.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000137098.
CleanExiHS_SPAG8.
ExpressionAtlasiQ99932. baseline and differential.
GenevisibleiQ99932. HS.

Family and domain databases

InterProiIPR026124. Sperm-assoc_Ag8.
[Graphical view]
PANTHERiPTHR15510. PTHR15510. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiSPAG8_HUMAN
AccessioniPrimary (citable) accession number: Q99932
Secondary accession number(s): B4DY89
, E9PDV6, Q12937, Q5TCV8, Q8WWB4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 12, 2005
Last sequence update: April 12, 2005
Last modified: November 30, 2016
This is version 117 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 9
    Human chromosome 9: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.