Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein SSX3

Gene

SSX3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Could act as a modulator of transcription.

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Transcription, Transcription regulation

Enzyme and pathway databases

BioCyciZFISH:ENSG00000165584-MONOMER.

Names & Taxonomyi

Protein namesi
Recommended name:
Protein SSX3
Alternative name(s):
Cancer/testis antigen 5.3
Short name:
CT5.3
Gene namesi
Name:SSX3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome X

Organism-specific databases

HGNCiHGNC:11337. SSX3.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000165584.
PharmGKBiPA36161.

Polymorphism and mutation databases

DMDMi84028266.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001818301 – 188Protein SSX3Add BLAST188

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei123PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ99909.
PeptideAtlasiQ99909.
PRIDEiQ99909.

PTM databases

iPTMnetiQ99909.
PhosphoSitePlusiQ99909.

Expressioni

Gene expression databases

BgeeiENSG00000165584.
CleanExiHS_SSX3.
ExpressionAtlasiQ99909. baseline and differential.
GenevisibleiQ99909. HS.

Organism-specific databases

HPAiHPA045683.

Interactioni

Subunit structurei

Interacts with SSX2IP.1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
AGTRAPQ6RW133EBI-10295431,EBI-741181
CEP63Q96MT83EBI-10295431,EBI-741977
CEP70Q8NHQ13EBI-10295431,EBI-739624
CMTM5Q96DZ93EBI-10295431,EBI-2548702
MED4Q9NPJ65EBI-10295431,EBI-394607
MEOX2A4D1273EBI-10295431,EBI-10172134
MIPOL1Q8TD105EBI-10295431,EBI-2548751
RHOJQ9H4E54EBI-10295431,EBI-6285694
SSX2IPQ9Y2D83EBI-10295431,EBI-2212028

Protein-protein interaction databases

BioGridi115509. 21 interactors.
IntActiQ99909. 12 interactors.

Structurei

3D structure databases

ProteinModelPortaliQ99909.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini20 – 83KRAB-relatedPROSITE-ProRule annotationAdd BLAST64

Sequence similaritiesi

Belongs to the SSX family.Curated
Contains 1 KRAB-related domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiENOG410JCMU. Eukaryota.
ENOG4111A52. LUCA.
GeneTreeiENSGT00390000012484.
HOGENOMiHOG000231461.
HOVERGENiHBG002056.
InParanoidiQ99909.
OMAiINMISGP.
PhylomeDBiQ99909.
TreeFamiTF338517.

Family and domain databases

CDDicd07765. KRAB_A-box. 1 hit.
InterProiIPR001909. KRAB.
IPR003655. Krueppel-associated_box-rel.
IPR028804. SSX.
IPR019041. SSXRD_motif.
[Graphical view]
PANTHERiPTHR14112. PTHR14112. 1 hit.
PfamiPF09514. SSXRD. 1 hit.
[Graphical view]
SMARTiSM00349. KRAB. 1 hit.
[Graphical view]
SUPFAMiSSF109640. SSF109640. 1 hit.
PROSITEiPS50806. KRAB_RELATED. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q99909-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MNGDDTFARR PTVGAQIPEK IQKAFDDIAK YFSKEEWEKM KVSEKIVYVY
60 70 80 90 100
MKRKYEAMTK LGFKAILPSF MRNKRVTDFQ GNDFDNDPNR GNQVQRPQMT
110 120 130 140 150
FGRLQGIFPK IMPKKPAEEG NVSKEVPEAS GPQNDGKQLC PPGKPTTSEK
160 170 180
INMISGPKRG EHAWTHRLRE RKQLVIYEEI SDPEEDDE
Length:188
Mass (Da):21,697
Last modified:December 20, 2005 - v2
Checksum:i988294793159C36E
GO
Isoform 2 (identifier: Q99909-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     157-188: PKRGEHAWTHRLRERKQLVIYEEISDPEEDDE → VLQRYCRFGSRPLQ

Note: No experimental confirmation available.
Show »
Length:170
Mass (Da):19,457
Checksum:iD981F807A9C7EAB1
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti95Q → L in AAB37436 (PubMed:8697803).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_042777157 – 188PKRGE…EEDDE → VLQRYCRFGSRPLQ in isoform 2. 1 PublicationAdd BLAST32

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
S82471 mRNA. Translation: AAB37436.2.
U90840 mRNA. Translation: AAC05819.1.
AL606490 Genomic DNA. Translation: CAI40268.1.
CH471164 Genomic DNA. Translation: EAW59347.1.
BC005904 mRNA. Translation: AAH05904.1.
BC103862 mRNA. Translation: AAI03863.1.
CCDSiCCDS14291.1. [Q99909-1]
RefSeqiNP_066294.1. NM_021014.3. [Q99909-1]
XP_011542187.1. XM_011543885.2. [Q99909-2]
UniGeneiHs.558445.

Genome annotation databases

EnsembliENST00000298396; ENSP00000298396; ENSG00000165584. [Q99909-1]
ENST00000376893; ENSP00000366090; ENSG00000165584. [Q99909-2]
GeneIDi10214.
KEGGihsa:10214.
UCSCiuc004djd.3. human. [Q99909-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
S82471 mRNA. Translation: AAB37436.2.
U90840 mRNA. Translation: AAC05819.1.
AL606490 Genomic DNA. Translation: CAI40268.1.
CH471164 Genomic DNA. Translation: EAW59347.1.
BC005904 mRNA. Translation: AAH05904.1.
BC103862 mRNA. Translation: AAI03863.1.
CCDSiCCDS14291.1. [Q99909-1]
RefSeqiNP_066294.1. NM_021014.3. [Q99909-1]
XP_011542187.1. XM_011543885.2. [Q99909-2]
UniGeneiHs.558445.

3D structure databases

ProteinModelPortaliQ99909.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi115509. 21 interactors.
IntActiQ99909. 12 interactors.

PTM databases

iPTMnetiQ99909.
PhosphoSitePlusiQ99909.

Polymorphism and mutation databases

DMDMi84028266.

Proteomic databases

PaxDbiQ99909.
PeptideAtlasiQ99909.
PRIDEiQ99909.

Protocols and materials databases

DNASUi10214.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000298396; ENSP00000298396; ENSG00000165584. [Q99909-1]
ENST00000376893; ENSP00000366090; ENSG00000165584. [Q99909-2]
GeneIDi10214.
KEGGihsa:10214.
UCSCiuc004djd.3. human. [Q99909-1]

Organism-specific databases

CTDi10214.
GeneCardsiSSX3.
HGNCiHGNC:11337. SSX3.
HPAiHPA045683.
MIMi300325. gene.
neXtProtiNX_Q99909.
OpenTargetsiENSG00000165584.
PharmGKBiPA36161.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410JCMU. Eukaryota.
ENOG4111A52. LUCA.
GeneTreeiENSGT00390000012484.
HOGENOMiHOG000231461.
HOVERGENiHBG002056.
InParanoidiQ99909.
OMAiINMISGP.
PhylomeDBiQ99909.
TreeFamiTF338517.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000165584-MONOMER.

Miscellaneous databases

GenomeRNAii10214.
PROiQ99909.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000165584.
CleanExiHS_SSX3.
ExpressionAtlasiQ99909. baseline and differential.
GenevisibleiQ99909. HS.

Family and domain databases

CDDicd07765. KRAB_A-box. 1 hit.
InterProiIPR001909. KRAB.
IPR003655. Krueppel-associated_box-rel.
IPR028804. SSX.
IPR019041. SSXRD_motif.
[Graphical view]
PANTHERiPTHR14112. PTHR14112. 1 hit.
PfamiPF09514. SSXRD. 1 hit.
[Graphical view]
SMARTiSM00349. KRAB. 1 hit.
[Graphical view]
SUPFAMiSSF109640. SSF109640. 1 hit.
PROSITEiPS50806. KRAB_RELATED. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiSSX3_HUMAN
AccessioniPrimary (citable) accession number: Q99909
Secondary accession number(s): O60223, Q5JQZ3, Q9BRW7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 15, 1998
Last sequence update: December 20, 2005
Last modified: November 30, 2016
This is version 133 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.