Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

HAUS augmin-like complex subunit 7

Gene

HAUS7

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Contributes to mitotic spindle assembly, maintenance of centrosome integrity and completion of cytokinesis as part of the HAUS augmin-like complex.2 Publications

GO - Molecular functioni

  • thioesterase binding Source: UniProtKB

GO - Biological processi

  • cell division Source: UniProtKB-KW
  • centrosome organization Source: UniProtKB
  • G2/M transition of mitotic cell cycle Source: Reactome
  • mitotic nuclear division Source: UniProtKB-KW
  • spindle assembly Source: UniProtKB
Complete GO annotation...

Keywords - Biological processi

Cell cycle, Cell division, Mitosis

Enzyme and pathway databases

ReactomeiR-HSA-2565942. Regulation of PLK1 Activity at G2/M Transition.
R-HSA-380259. Loss of Nlp from mitotic centrosomes.
R-HSA-380270. Recruitment of mitotic centrosome proteins and complexes.
R-HSA-5620912. Anchoring of the basal body to the plasma membrane.
R-HSA-8854518. AURKA Activation by TPX2.

Names & Taxonomyi

Protein namesi
Recommended name:
HAUS augmin-like complex subunit 7
Alternative name(s):
26S proteasome-associated UCH37-interacting protein 1
UCHL5-interacting protein
X-linked protein STS1769
Gene namesi
Name:HAUS7
Synonyms:UCHL5IP, UIP1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome X

Organism-specific databases

HGNCiHGNC:32979. HAUS7.

Subcellular locationi

GO - Cellular componenti

  • centrosome Source: UniProtKB
  • cytoplasm Source: HPA
  • cytosol Source: Reactome
  • HAUS complex Source: UniProtKB
  • microtubule Source: UniProtKB-KW
  • nucleolus Source: HPA
  • plasma membrane Source: HPA
  • spindle Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Microtubule

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA165756645.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 368368HAUS augmin-like complex subunit 7PRO_0000097552Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei26 – 261PhosphoserineCombined sources

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ99871.
MaxQBiQ99871.
PaxDbiQ99871.
PeptideAtlasiQ99871.
PRIDEiQ99871.

PTM databases

iPTMnetiQ99871.
PhosphoSiteiQ99871.

Expressioni

Tissue specificityi

Detected in spleen, thymus, testis, ovary, small intestine and colon, with highest levels of expression in testis and ovary.1 Publication

Gene expression databases

BgeeiQ99871.
CleanExiHS_UCHL5IP.
ExpressionAtlasiQ99871. baseline and differential.
GenevisibleiQ99871. HS.

Organism-specific databases

HPAiHPA003614.

Interactioni

Subunit structurei

Component of the HAUS augmin-like complex. The complex interacts with the gamma-tubulin ring complex and this interaction is required for spindle assembly. Binds UCHL5.3 Publications

GO - Molecular functioni

  • thioesterase binding Source: UniProtKB

Protein-protein interaction databases

BioGridi120718. 79 interactions.
DIPiDIP-32974N.
IntActiQ99871. 40 interactions.
MINTiMINT-4714067.
STRINGi9606.ENSP00000359239.

Structurei

3D structure databases

ProteinModelPortaliQ99871.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili213 – 24634Sequence analysisAdd
BLAST

Sequence similaritiesi

Belongs to the HAUS7 family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiENOG410IRC4. Eukaryota.
ENOG4111MKV. LUCA.
GeneTreeiENSGT00390000003937.
HOGENOMiHOG000231508.
HOVERGENiHBG074169.
InParanoidiQ99871.
KOiK16590.
OMAiVISDFHQ.
PhylomeDBiQ99871.
TreeFamiTF333445.

Family and domain databases

InterProiIPR029711. Haus7-like.
[Graphical view]
PANTHERiPTHR14352:SF2. PTHR14352:SF2. 1 hit.

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q99871-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGGARLGARN MAGQDAGCGR GGDDYSEDEG DSSVSRAAVE VFGKLKDLNC
60 70 80 90 100
PFLEGLYITE PKTIQELLCS PSEYRLEILE WMCTRVWPSL QDRFSSLKGV
110 120 130 140 150
PTEVKIQEMT KLGHELMLCA PDDQELLKGC ACAQKQLHFM DQLLDTIRSL
160 170 180 190 200
TIGCSSCSSL MEHFEDTREK NEALLGELFS SPHLQMLLNP ECDPWPLDMQ
210 220 230 240 250
PLLNKQSDDW QWASASAKSE EEEKLAELAR QLQESAAKLH ALRTEYFAQH
260 270 280 290 300
EQGAAAGAAD ISTLDQKLRL VTSDFHQLIL AFLQVYDDEL GECCQRPGPD
310 320 330 340 350
LHPCGPIIQA THQNLTSYSQ LLQVVMAVAD TSAKAVETVK KQQGEQICWG
360
GSSSVMSLAT KMNELMEK
Length:368
Mass (Da):40,778
Last modified:July 7, 2009 - v3
Checksum:i15E9A47D741DB26B
GO
Isoform 2 (identifier: Q99871-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     320-320: Q → QIPRGQPKKPALVTMTTVPTCATLPLAQGFRDVHFGFLSERLRAFQPLTGWSCETPRSGM

Note: Derived from EST data.
Show »
Length:427
Mass (Da):47,262
Checksum:iA46960622889427B
GO
Isoform 3 (identifier: Q99871-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     321-339: LLQVVMAVADTSAKAVETV → VRVPFPSPLTAPSPVHSD
     340-368: Missing.

Note: No experimental confirmation available.
Show »
Length:338
Mass (Da):37,524
Checksum:i796EC5EC818C9F62
GO

Sequence cautioni

The sequence AAF75785.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence BAG62338.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence CAA67665.1 differs from that shown.Chimera. The N-terminal part of the clone up to position 91 maps to another chromosome.Curated
The sequence CAA67665.1 differs from that shown. Reason: Frameshift at positions 258 and 260. Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei320 – 3201Q → QIPRGQPKKPALVTMTTVPT CATLPLAQGFRDVHFGFLSE RLRAFQPLTGWSCETPRSGM in isoform 2. 1 PublicationVSP_037669
Alternative sequencei321 – 33919LLQVV…AVETV → VRVPFPSPLTAPSPVHSD in isoform 3. 2 PublicationsVSP_040920Add
BLAST
Alternative sequencei340 – 36829Missing in isoform 3. 2 PublicationsVSP_040921Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U82695 Genomic DNA. No translation available.
CH471172 Genomic DNA. Translation: EAW72866.1.
CH471172 Genomic DNA. Translation: EAW72868.1.
CH471172 Genomic DNA. Translation: EAW72869.1.
CH471172 Genomic DNA. Translation: EAW72871.1.
BC008141 mRNA. Translation: AAH08141.3.
CA441020 mRNA. No translation available.
AK300650 mRNA. Translation: BAG62338.1. Different initiation.
AF267739 mRNA. Translation: AAF75785.1. Different initiation.
X99270 mRNA. Translation: CAA67665.1. Sequence problems.
AL122036 mRNA. Translation: CAB59176.1.
CCDSiCCDS35438.1. [Q99871-1]
PIRiT34551.
RefSeqiNP_059988.3. NM_017518.7. [Q99871-1]
UniGeneiHs.170835.
Hs.743822.

Genome annotation databases

EnsembliENST00000370211; ENSP00000359230; ENSG00000213397. [Q99871-1]
GeneIDi55559.
KEGGihsa:55559.
UCSCiuc004fho.3. human. [Q99871-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U82695 Genomic DNA. No translation available.
CH471172 Genomic DNA. Translation: EAW72866.1.
CH471172 Genomic DNA. Translation: EAW72868.1.
CH471172 Genomic DNA. Translation: EAW72869.1.
CH471172 Genomic DNA. Translation: EAW72871.1.
BC008141 mRNA. Translation: AAH08141.3.
CA441020 mRNA. No translation available.
AK300650 mRNA. Translation: BAG62338.1. Different initiation.
AF267739 mRNA. Translation: AAF75785.1. Different initiation.
X99270 mRNA. Translation: CAA67665.1. Sequence problems.
AL122036 mRNA. Translation: CAB59176.1.
CCDSiCCDS35438.1. [Q99871-1]
PIRiT34551.
RefSeqiNP_059988.3. NM_017518.7. [Q99871-1]
UniGeneiHs.170835.
Hs.743822.

3D structure databases

ProteinModelPortaliQ99871.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi120718. 79 interactions.
DIPiDIP-32974N.
IntActiQ99871. 40 interactions.
MINTiMINT-4714067.
STRINGi9606.ENSP00000359239.

PTM databases

iPTMnetiQ99871.
PhosphoSiteiQ99871.

Proteomic databases

EPDiQ99871.
MaxQBiQ99871.
PaxDbiQ99871.
PeptideAtlasiQ99871.
PRIDEiQ99871.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000370211; ENSP00000359230; ENSG00000213397. [Q99871-1]
GeneIDi55559.
KEGGihsa:55559.
UCSCiuc004fho.3. human. [Q99871-1]

Organism-specific databases

CTDi55559.
GeneCardsiHAUS7.
HGNCiHGNC:32979. HAUS7.
HPAiHPA003614.
MIMi300540. gene.
neXtProtiNX_Q99871.
PharmGKBiPA165756645.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IRC4. Eukaryota.
ENOG4111MKV. LUCA.
GeneTreeiENSGT00390000003937.
HOGENOMiHOG000231508.
HOVERGENiHBG074169.
InParanoidiQ99871.
KOiK16590.
OMAiVISDFHQ.
PhylomeDBiQ99871.
TreeFamiTF333445.

Enzyme and pathway databases

ReactomeiR-HSA-2565942. Regulation of PLK1 Activity at G2/M Transition.
R-HSA-380259. Loss of Nlp from mitotic centrosomes.
R-HSA-380270. Recruitment of mitotic centrosome proteins and complexes.
R-HSA-5620912. Anchoring of the basal body to the plasma membrane.
R-HSA-8854518. AURKA Activation by TPX2.

Miscellaneous databases

ChiTaRSiHAUS7. human.
GenomeRNAii55559.
PROiQ99871.
SOURCEiSearch...

Gene expression databases

BgeeiQ99871.
CleanExiHS_UCHL5IP.
ExpressionAtlasiQ99871. baseline and differential.
GenevisibleiQ99871. HS.

Family and domain databases

InterProiIPR029711. Haus7-like.
[Graphical view]
PANTHERiPTHR14352:SF2. PTHR14352:SF2. 1 hit.
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "The DNA sequence of the human X chromosome."
    Ross M.T., Grafham D.V., Coffey A.J., Scherer S., McLay K., Muzny D., Platzer M., Howell G.R., Burrows C., Bird C.P., Frankish A., Lovell F.L., Howe K.L., Ashurst J.L., Fulton R.S., Sudbrak R., Wen G., Jones M.C.
    , Hurles M.E., Andrews T.D., Scott C.E., Searle S., Ramser J., Whittaker A., Deadman R., Carter N.P., Hunt S.E., Chen R., Cree A., Gunaratne P., Havlak P., Hodgson A., Metzker M.L., Richards S., Scott G., Steffen D., Sodergren E., Wheeler D.A., Worley K.C., Ainscough R., Ambrose K.D., Ansari-Lari M.A., Aradhya S., Ashwell R.I., Babbage A.K., Bagguley C.L., Ballabio A., Banerjee R., Barker G.E., Barlow K.F., Barrett I.P., Bates K.N., Beare D.M., Beasley H., Beasley O., Beck A., Bethel G., Blechschmidt K., Brady N., Bray-Allen S., Bridgeman A.M., Brown A.J., Brown M.J., Bonnin D., Bruford E.A., Buhay C., Burch P., Burford D., Burgess J., Burrill W., Burton J., Bye J.M., Carder C., Carrel L., Chako J., Chapman J.C., Chavez D., Chen E., Chen G., Chen Y., Chen Z., Chinault C., Ciccodicola A., Clark S.Y., Clarke G., Clee C.M., Clegg S., Clerc-Blankenburg K., Clifford K., Cobley V., Cole C.G., Conquer J.S., Corby N., Connor R.E., David R., Davies J., Davis C., Davis J., Delgado O., Deshazo D., Dhami P., Ding Y., Dinh H., Dodsworth S., Draper H., Dugan-Rocha S., Dunham A., Dunn M., Durbin K.J., Dutta I., Eades T., Ellwood M., Emery-Cohen A., Errington H., Evans K.L., Faulkner L., Francis F., Frankland J., Fraser A.E., Galgoczy P., Gilbert J., Gill R., Gloeckner G., Gregory S.G., Gribble S., Griffiths C., Grocock R., Gu Y., Gwilliam R., Hamilton C., Hart E.A., Hawes A., Heath P.D., Heitmann K., Hennig S., Hernandez J., Hinzmann B., Ho S., Hoffs M., Howden P.J., Huckle E.J., Hume J., Hunt P.J., Hunt A.R., Isherwood J., Jacob L., Johnson D., Jones S., de Jong P.J., Joseph S.S., Keenan S., Kelly S., Kershaw J.K., Khan Z., Kioschis P., Klages S., Knights A.J., Kosiura A., Kovar-Smith C., Laird G.K., Langford C., Lawlor S., Leversha M., Lewis L., Liu W., Lloyd C., Lloyd D.M., Loulseged H., Loveland J.E., Lovell J.D., Lozado R., Lu J., Lyne R., Ma J., Maheshwari M., Matthews L.H., McDowall J., McLaren S., McMurray A., Meidl P., Meitinger T., Milne S., Miner G., Mistry S.L., Morgan M., Morris S., Mueller I., Mullikin J.C., Nguyen N., Nordsiek G., Nyakatura G., O'dell C.N., Okwuonu G., Palmer S., Pandian R., Parker D., Parrish J., Pasternak S., Patel D., Pearce A.V., Pearson D.M., Pelan S.E., Perez L., Porter K.M., Ramsey Y., Reichwald K., Rhodes S., Ridler K.A., Schlessinger D., Schueler M.G., Sehra H.K., Shaw-Smith C., Shen H., Sheridan E.M., Shownkeen R., Skuce C.D., Smith M.L., Sotheran E.C., Steingruber H.E., Steward C.A., Storey R., Swann R.M., Swarbreck D., Tabor P.E., Taudien S., Taylor T., Teague B., Thomas K., Thorpe A., Timms K., Tracey A., Trevanion S., Tromans A.C., d'Urso M., Verduzco D., Villasana D., Waldron L., Wall M., Wang Q., Warren J., Warry G.L., Wei X., West A., Whitehead S.L., Whiteley M.N., Wilkinson J.E., Willey D.L., Williams G., Williams L., Williamson A., Williamson H., Wilming L., Woodmansey R.L., Wray P.W., Yen J., Zhang J., Zhou J., Zoghbi H., Zorilla S., Buck D., Reinhardt R., Poustka A., Rosenthal A., Lehrach H., Meindl A., Minx P.J., Hillier L.W., Willard H.F., Wilson R.K., Waterston R.H., Rice C.M., Vaudin M., Coulson A., Nelson D.L., Weinstock G., Sulston J.E., Durbin R.M., Hubbard T., Gibbs R.A., Beck S., Rogers J., Bentley D.R.
    Nature 434:325-337(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 286-368 (ISOFORM 2).
    Tissue: Bone and Oligodendroglioma.
  4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 3-368 (ISOFORM 3).
    Tissue: Rectum.
  5. "Identification of two proteins, S14 and UIP1, that interact with UCH37."
    Li T., Duan W., Yang H., Lee M.K., Bte Mustafa F., Lee B.H., Teo T.S.
    FEBS Lett. 488:201-205(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 10-368 (ISOFORM 1), INTERACTION WITH UCHL5, TISSUE SPECIFICITY.
  6. Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 92-368 (ISOFORM 1).
    Tissue: Fetal brain.
  7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 142-368 (ISOFORM 3).
    Tissue: Testis.
  8. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-26, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  9. "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
    Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
    Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  10. Cited for: IDENTIFICATION IN THE HAUS AUGMIN-LIKE COMPLEX, FUNCTION, SUBCELLULAR LOCATION.
  11. "The augmin complex plays a critical role in spindle microtubule generation for mitotic progression and cytokinesis in human cells."
    Uehara R., Nozawa R.-S., Tomioka A., Petry S., Vale R.D., Obuse C., Goshima G.
    Proc. Natl. Acad. Sci. U.S.A. 106:6998-7003(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION IN THE HAUS AUGMIN-LIKE COMPLEX, FUNCTION, SUBCELLULAR LOCATION.
  12. "Toward a comprehensive characterization of a human cancer cell phosphoproteome."
    Zhou H., Di Palma S., Preisinger C., Peng M., Polat A.N., Heck A.J., Mohammed S.
    J. Proteome Res. 12:260-271(2013) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-26, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma and Erythroleukemia.

Entry informationi

Entry nameiHAUS7_HUMAN
AccessioniPrimary (citable) accession number: Q99871
Secondary accession number(s): B4DUH6
, D3DWT9, Q96HS8, Q9NP54, Q9UFH9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: July 7, 2009
Last modified: July 6, 2016
This is version 130 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Caution

The gene for this protein is either identical to or adjacent to that of TREX2. Most mRNAs that encode UCHL5IP also include the N-terminal part of TREX2.Curated
It is uncertain whether Met-1 or Met-11 is the initiator.Curated

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.