Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q99784

- NOE1_HUMAN

UniProt

Q99784 - NOE1_HUMAN

Protein

Noelin

Gene

OLFM1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 138 (01 Oct 2014)
      Sequence version 4 (23 Sep 2008)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    May play an important role in regulating the production of neural crest cells by the neural tube.By similarity

    GO - Molecular functioni

    1. protein binding Source: IntAct

    GO - Biological processi

    1. nervous system development Source: ProtInc
    2. protein oligomerization Source: Ensembl

    Keywords - Molecular functioni

    Developmental protein

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Noelin
    Alternative name(s):
    Neuronal olfactomedin-related ER localized protein
    Olfactomedin-1
    Gene namesi
    Name:OLFM1
    Synonyms:NOE1, NOEL1
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 9

    Organism-specific databases

    HGNCiHGNC:17187. OLFM1.

    Subcellular locationi

    Secreted Curated. Cell junctionsynapse By similarity

    GO - Cellular componenti

    1. alpha-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid selective glutamate receptor complex Source: Ensembl
    2. cell junction Source: UniProtKB-KW
    3. extracellular space Source: Ensembl
    4. synapse Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Cell junction, Secreted, Synapse

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA31915.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 1616Sequence AnalysisAdd
    BLAST
    Chaini17 – 485469NoelinPRO_0000020074Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi33 – 331N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi103 – 1031N-linked (GlcNAc...)1 Publication
    Glycosylationi187 – 1871N-linked (GlcNAc...)1 Publication
    Disulfide bondi227 ↔ 409PROSITE-ProRule annotation
    Glycosylationi288 – 2881N-linked (GlcNAc...)1 Publication
    Glycosylationi307 – 3071N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi394 – 3941N-linked (GlcNAc...)1 Publication
    Glycosylationi431 – 4311N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi473 – 4731N-linked (GlcNAc...)Sequence Analysis

    Keywords - PTMi

    Disulfide bond, Glycoprotein

    Proteomic databases

    MaxQBiQ99784.
    PaxDbiQ99784.
    PRIDEiQ99784.

    PTM databases

    PhosphoSiteiQ99784.

    Expressioni

    Gene expression databases

    ArrayExpressiQ99784.
    BgeeiQ99784.
    CleanExiHS_OLFM1.
    GenevestigatoriQ99784.

    Organism-specific databases

    HPAiHPA057444.

    Interactioni

    Subunit structurei

    Peripherally associated with AMPAR complex. AMPAR complex consists of an inner core made of 4 pore-forming GluA/GRIA proteins (GRIA1, GRIA2, GRIA3 and GRIA4) and 4 major auxiliary subunits arranged in a twofold symmetry. One of the two pairs of distinct binding sites is occupied either by CNIH2, CNIH3 or CACNG2, CACNG3. The other harbors CACNG2, CACNG3, CACNG4, CACNG8 or GSG1L. This inner core of AMPAR complex is complemented by outer core constituents binding directly to the GluA/GRIA proteins at sites distinct from the interaction sites of the inner core constituents. Outer core constituents include at least PRRT1, PRRT2, CKAMP44/SHISA9, FRRS1L and NRN1. The proteins of the inner and outer core serve as a platform for other, more peripherally associated AMPAR constituents, including OLFM1. Alone or in combination, these auxiliary subunits control the gating and pharmacology of the AMPAR complex and profoundly impact their biogenesis and protein processing By similarity.By similarity

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    DISC1Q9NRI53EBI-1105073,EBI-529989

    Protein-protein interaction databases

    BioGridi115706. 4 interactions.
    IntActiQ99784. 2 interactions.
    STRINGi9606.ENSP00000252854.

    Structurei

    3D structure databases

    ProteinModelPortaliQ99784.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini226 – 478253Olfactomedin-likePROSITE-ProRule annotationAdd
    BLAST

    Coiled coil

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Coiled coili87 – 225139Sequence AnalysisAdd
    BLAST

    Sequence similaritiesi

    Contains 1 olfactomedin-like domain.PROSITE-ProRule annotation

    Keywords - Domaini

    Coiled coil, Signal

    Phylogenomic databases

    eggNOGiNOG283888.
    HOGENOMiHOG000232069.
    HOVERGENiHBG006513.
    InParanoidiQ99784.
    OMAiRSHERIP.
    PhylomeDBiQ99784.
    TreeFamiTF315964.

    Family and domain databases

    InterProiIPR022082. Noelin-1.
    IPR003112. Olfac-like.
    IPR011044. Quino_amine_DH_bsu.
    [Graphical view]
    PfamiPF12308. Noelin-1. 1 hit.
    PF02191. OLF. 1 hit.
    [Graphical view]
    SMARTiSM00284. OLF. 1 hit.
    [Graphical view]
    SUPFAMiSSF50969. SSF50969. 2 hits.
    PROSITEiPS00014. ER_TARGET. 1 hit.
    PS51132. OLF. 1 hit.
    [Graphical view]

    Sequences (5)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 5 isoformsi produced by alternative splicing. Align

    Note: Experimental confirmation may be lacking for some isoforms.

    Isoform 1 (identifier: Q99784-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MSVPLLKIGV VLSTMAMITN WMSQTLPSLV GLNTTKLSAA GGGTLDRSTG    50
    VLPTNPEESW QVYSSAQDSE GRCICTVVAP QQTMCSRDAR TKQLRQLLEK 100
    VQNMSQSIEV LDRRTQRDLQ YVEKMENQMK GLESKFKQVE ESHKQHLARQ 150
    FKAIKAKMDE LRPLIPVLEE YKADAKLVLQ FKEEVQNLTS VLNELQEEIG 200
    AYDYDELQSR VSNLEERLRA CMQKLACGKL TGISDPVTVK TSGSRFGSWM 250
    TDPLAPEGDN RVWYMDGYHN NRFVREYKSM VDFMNTDNFT SHRLPHPWSG 300
    TGQVVYNGSI YFNKFQSHII IRFDLKTETI LKTRSLDYAG YNNMYHYAWG 350
    GHSDIDLMVD ESGLWAVYAT NQNAGNIVVS RLDPVSLQTL QTWNTSYPKR 400
    SAGEAFIICG TLYVTNGYSG GTKVHYAYQT NASTYEYIDI PFQNKYSHIS 450
    MLDYNPKDRA LYAWNNGHQI LYNVTLFHVI RSDEL 485
    Length:485
    Mass (Da):55,343
    Last modified:September 23, 2008 - v4
    Checksum:iD94BBDDAC60CF674
    GO
    Isoform 2 (identifier: Q99784-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         153-153: A → G
         154-485: Missing.

    Show »
    Length:153
    Mass (Da):17,160
    Checksum:i3B18DC0207992A74
    GO
    Isoform 3 (identifier: Q99784-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-50: MSVPLLKIGV...GGGTLDRSTG → MPGRWRWQRDMHPARKLLSLLFLILMGTELTQ

    Show »
    Length:467
    Mass (Da):54,117
    Checksum:i93D8EA9AD73562B6
    GO
    Isoform 4 (identifier: Q99784-4) [UniParc]FASTAAdd to Basket

    Also known as: AMY

    The sequence of this isoform differs from the canonical sequence as follows:
         1-50: MSVPLLKIGV...GGGTLDRSTG → MPGRWRWQRDMHPARKLLSLLFLILMGTELTQ
         153-153: A → G
         154-485: Missing.

    Show »
    Length:135
    Mass (Da):15,934
    Checksum:i8F6A30B160351055
    GO
    Isoform 5 (identifier: Q99784-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-50: MSVPLLKIGVVLSTMAMITNWMSQTLPSLVGLNTTKLSAAGGGTLDRSTG → MGEAPGREGRGPCPQLESPRRRR

    Note: No experimental confirmation available.

    Show »
    Length:458
    Mass (Da):52,815
    Checksum:iDFD8A706766D5244
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti127 – 1271N → T in BAC04756. (PubMed:14702039)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 5050MSVPL…DRSTG → MPGRWRWQRDMHPARKLLSL LFLILMGTELTQ in isoform 3 and isoform 4. 3 PublicationsVSP_003759Add
    BLAST
    Alternative sequencei1 – 5050MSVPL…DRSTG → MGEAPGREGRGPCPQLESPR RRR in isoform 5. 1 PublicationVSP_055625Add
    BLAST
    Alternative sequencei153 – 1531A → G in isoform 2 and isoform 4. 1 PublicationVSP_003760
    Alternative sequencei154 – 485332Missing in isoform 2 and isoform 4. 1 PublicationVSP_003761Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    D82343 mRNA. Translation: BAA11554.1.
    AK096304 mRNA. Translation: BAC04756.1.
    AK290478 mRNA. Translation: BAF83167.1.
    AL159992 Genomic DNA. No translation available.
    AL390778 Genomic DNA. No translation available.
    BC008763 mRNA. Translation: AAH08763.2.
    BC011741 mRNA. Translation: AAH11741.2.
    BT007146 mRNA. Translation: AAP35810.1.
    U79299 mRNA. Translation: AAB50225.1.
    AF035301 mRNA. Translation: AAB88184.1.
    BK001427 Genomic DNA. Translation: DAA01546.1.
    BK001427 Genomic DNA. Translation: DAA01547.1.
    CCDSiCCDS65184.1. [Q99784-1]
    CCDS6986.1. [Q99784-3]
    CCDS6987.1. [Q99784-4]
    PIRiJC5272.
    RefSeqiNP_001269540.1. NM_001282611.1. [Q99784-1]
    NP_006325.1. NM_006334.3. [Q99784-4]
    NP_055094.1. NM_014279.4. [Q99784-3]
    UniGeneiHs.522484.

    Genome annotation databases

    EnsembliENST00000252854; ENSP00000252854; ENSG00000130558. [Q99784-3]
    ENST00000277415; ENSP00000277415; ENSG00000130558. [Q99784-4]
    ENST00000371793; ENSP00000360858; ENSG00000130558. [Q99784-1]
    ENST00000371796; ENSP00000360861; ENSG00000130558. [Q99784-5]
    ENST00000392991; ENSP00000376717; ENSG00000130558. [Q99784-2]
    GeneIDi10439.
    KEGGihsa:10439.
    UCSCiuc010nar.3. human. [Q99784-1]

    Polymorphism databases

    DMDMi206729935.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    D82343 mRNA. Translation: BAA11554.1 .
    AK096304 mRNA. Translation: BAC04756.1 .
    AK290478 mRNA. Translation: BAF83167.1 .
    AL159992 Genomic DNA. No translation available.
    AL390778 Genomic DNA. No translation available.
    BC008763 mRNA. Translation: AAH08763.2 .
    BC011741 mRNA. Translation: AAH11741.2 .
    BT007146 mRNA. Translation: AAP35810.1 .
    U79299 mRNA. Translation: AAB50225.1 .
    AF035301 mRNA. Translation: AAB88184.1 .
    BK001427 Genomic DNA. Translation: DAA01546.1 .
    BK001427 Genomic DNA. Translation: DAA01547.1 .
    CCDSi CCDS65184.1. [Q99784-1 ]
    CCDS6986.1. [Q99784-3 ]
    CCDS6987.1. [Q99784-4 ]
    PIRi JC5272.
    RefSeqi NP_001269540.1. NM_001282611.1. [Q99784-1 ]
    NP_006325.1. NM_006334.3. [Q99784-4 ]
    NP_055094.1. NM_014279.4. [Q99784-3 ]
    UniGenei Hs.522484.

    3D structure databases

    ProteinModelPortali Q99784.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 115706. 4 interactions.
    IntActi Q99784. 2 interactions.
    STRINGi 9606.ENSP00000252854.

    PTM databases

    PhosphoSitei Q99784.

    Polymorphism databases

    DMDMi 206729935.

    Proteomic databases

    MaxQBi Q99784.
    PaxDbi Q99784.
    PRIDEi Q99784.

    Protocols and materials databases

    DNASUi 10439.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000252854 ; ENSP00000252854 ; ENSG00000130558 . [Q99784-3 ]
    ENST00000277415 ; ENSP00000277415 ; ENSG00000130558 . [Q99784-4 ]
    ENST00000371793 ; ENSP00000360858 ; ENSG00000130558 . [Q99784-1 ]
    ENST00000371796 ; ENSP00000360861 ; ENSG00000130558 . [Q99784-5 ]
    ENST00000392991 ; ENSP00000376717 ; ENSG00000130558 . [Q99784-2 ]
    GeneIDi 10439.
    KEGGi hsa:10439.
    UCSCi uc010nar.3. human. [Q99784-1 ]

    Organism-specific databases

    CTDi 10439.
    GeneCardsi GC09P137967.
    HGNCi HGNC:17187. OLFM1.
    HPAi HPA057444.
    MIMi 605366. gene.
    neXtProti NX_Q99784.
    PharmGKBi PA31915.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG283888.
    HOGENOMi HOG000232069.
    HOVERGENi HBG006513.
    InParanoidi Q99784.
    OMAi RSHERIP.
    PhylomeDBi Q99784.
    TreeFami TF315964.

    Miscellaneous databases

    ChiTaRSi OLFM1. human.
    GeneWikii OLFM1.
    GenomeRNAii 10439.
    NextBioi 39567.
    PROi Q99784.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q99784.
    Bgeei Q99784.
    CleanExi HS_OLFM1.
    Genevestigatori Q99784.

    Family and domain databases

    InterProi IPR022082. Noelin-1.
    IPR003112. Olfac-like.
    IPR011044. Quino_amine_DH_bsu.
    [Graphical view ]
    Pfami PF12308. Noelin-1. 1 hit.
    PF02191. OLF. 1 hit.
    [Graphical view ]
    SMARTi SM00284. OLF. 1 hit.
    [Graphical view ]
    SUPFAMi SSF50969. SSF50969. 2 hits.
    PROSITEi PS00014. ER_TARGET. 1 hit.
    PS51132. OLF. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Identification and cloning of neuroblastoma-specific and nerve tissue-specific genes through compiled expression profiles."
      Yokoyama M., Nishi Y., Yoshii J., Okubo K., Matsubara K.
      DNA Res. 3:311-320(1996) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4).
    2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 5).
      Tissue: Brain.
    3. "DNA sequence and analysis of human chromosome 9."
      Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E., Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C., Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S., Babbage A.K., Babbage S., Bagguley C.L.
      , Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beasley H., Beasley O., Bird C.P., Bray-Allen S., Brown A.J., Brown J.Y., Burford D., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Chen Y., Clarke G., Clark S.Y., Clee C.M., Clegg S., Collier R.E., Corby N., Crosier M., Cummings A.T., Davies J., Dhami P., Dunn M., Dutta I., Dyer L.W., Earthrowl M.E., Faulkner L., Fleming C.J., Frankish A., Frankland J.A., French L., Fricker D.G., Garner P., Garnett J., Ghori J., Gilbert J.G.R., Glison C., Grafham D.V., Gribble S., Griffiths C., Griffiths-Jones S., Grocock R., Guy J., Hall R.E., Hammond S., Harley J.L., Harrison E.S.I., Hart E.A., Heath P.D., Henderson C.D., Hopkins B.L., Howard P.J., Howden P.J., Huckle E., Johnson C., Johnson D., Joy A.A., Kay M., Keenan S., Kershaw J.K., Kimberley A.M., King A., Knights A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C., Lloyd D.M., Lovell J., Martin S., Mashreghi-Mohammadi M., Matthews L., McLaren S., McLay K.E., McMurray A., Milne S., Nickerson T., Nisbett J., Nordsiek G., Pearce A.V., Peck A.I., Porter K.M., Pandian R., Pelan S., Phillimore B., Povey S., Ramsey Y., Rand V., Scharfe M., Sehra H.K., Shownkeen R., Sims S.K., Skuce C.D., Smith M., Steward C.A., Swarbreck D., Sycamore N., Tester J., Thorpe A., Tracey A., Tromans A., Thomas D.W., Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L., Williams S.A., Wilming L., Wray P.W., Young L., Ashurst J.L., Coulson A., Blocker H., Durbin R.M., Sulston J.E., Hubbard T., Jackson M.J., Bentley D.R., Beck S., Rogers J., Dunham I.
      Nature 429:369-374(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
      Tissue: Eye.
    5. "Cloning of human full-length CDSs in BD Creator(TM) system donor vector."
      Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A.
      Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 29-485 (ISOFORM 3).
    6. "Large-scale concatenation cDNA sequencing."
      Yu W., Andersson B., Worley K.C., Muzny D.M., Ding Y., Liu W., Ricafrente J.Y., Wentland M.A., Lennon G., Gibbs R.A.
      Genome Res. 7:353-358(1997) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 228-485 (ISOFORM 1).
      Tissue: Brain.
    7. "Bioinformatic approaches for identification and characterization of olfactomedin related genes with a potential role in pathogenesis of ocular disorders."
      Mukhopadhyay A., Talukdar S., Bhattacharjee A., Ray K.
      Mol. Vis. 10:304-314(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION.
    8. "Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry."
      Liu T., Qian W.-J., Gritsenko M.A., Camp D.G. II, Monroe M.E., Moore R.J., Smith R.D.
      J. Proteome Res. 4:2070-2080(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-103; ASN-187; ASN-288 AND ASN-394.
      Tissue: Plasma.

    Entry informationi

    Entry nameiNOE1_HUMAN
    AccessioniPrimary (citable) accession number: Q99784
    Secondary accession number(s): Q53XZ8
    , Q6IMJ4, Q6IMJ5, Q8N8R0, Q969S7, Q99452
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: July 15, 1998
    Last sequence update: September 23, 2008
    Last modified: October 1, 2014
    This is version 138 of the entry and version 4 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 9
      Human chromosome 9: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3