Q99784 (NOE1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 127.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Noelin Alternative name(s): Neuronal olfactomedin-related ER localized protein Olfactomedin-1 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 485 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | May play an important role in regulating the production of neural crest cells by the neural tube By similarity. |
| Subunit structure | Peripherally associated with AMPAR complex. AMPAR complex consists of an inner core made of 4 pore-forming GluA/GRIA proteins (GRIA1, GRIA2, GRIA3 and GRIA4) and 4 major auxiliary subunits arranged in a twofold symmetry. One of the two pairs of distinct binding sites is occupied either by CNIH2, CNIH3 or CACNG2, CACNG3. The other harbors CACNG2, CACNG3, CACNG4, CACNG8 or GSG1L. This inner core of AMPAR complex is complemented by outer core constituents binding directly to the GluA/GRIA proteins at sites distinct from the interaction sites of the inner core constituents. Outer core constituents include at least PRRT1, PRRT2, CKAMP44/SHISA9, FRRS1L and NRN1. The proteins of the inner and outer core serve as a platform for other, more peripherally associated AMPAR constituents, including OLFM1. Alone or in combination, these auxiliary subunits control the gating and pharmacology of the AMPAR complex and profoundly impact their biogenesis and protein processing By similarity. |
| Subcellular location | Secreted Potential. Cell junction › synapse By similarity. |
| Sequence similarities | Contains 1 olfactomedin-like domain. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cell junction Secreted Synapse |
| Coding sequence diversity | Alternative splicing |
| Domain | Coiled coil Signal |
| Molecular function | Developmental protein |
| PTM | Disulfide bond Glycoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | nervous system development Traceable author statement Ref.1. Source: ProtInc protein oligomerizationInferred from electronic annotation. Source: Compara |
| Cellular_component | cell junction Inferred from electronic annotation. Source: UniProtKB-KW extracellular spaceInferred from electronic annotation. Source: Compara synapseInferred from electronic annotation. Source: UniProtKB-SubCell |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| DISC1 | Q9NRI5 | 3 | EBI-1105073,EBI-529989 |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] Note: Experimental confirmation may be lacking for some isoforms. | ||||||
| Isoform 1 (identifier: Q99784-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q99784-2) The sequence of this isoform differs from the canonical sequence as follows: 153-153: A → G 154-485: Missing. | ||||||
| Isoform 3 (identifier: Q99784-3) The sequence of this isoform differs from the canonical sequence as follows: 1-50: MSVPLLKIGV...GGGTLDRSTG → MPGRWRWQRDMHPARKLLSLLFLILMGTELTQ | ||||||
| Isoform 4 (identifier: Q99784-4) Also known as: AMY; The sequence of this isoform differs from the canonical sequence as follows: 1-50: MSVPLLKIGV...GGGTLDRSTG → MPGRWRWQRDMHPARKLLSLLFLILMGTELTQ 153-153: A → G 154-485: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 16 | 16 | Potential | ||||||||
| Chain | 17 – 485 | 469 | Noelin | PRO_0000020074 | |||||||
Regions | |||||||||||
| Domain | 226 – 478 | 253 | Olfactomedin-like | ||||||||
| Coiled coil | 87 – 225 | 139 | Potential | ||||||||
Amino acid modifications | |||||||||||
| Glycosylation | 33 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 103 | 1 | N-linked (GlcNAc...) Ref.7 | ||||||||
| Glycosylation | 187 | 1 | N-linked (GlcNAc...) Ref.7 | ||||||||
| Glycosylation | 288 | 1 | N-linked (GlcNAc...) Ref.7 | ||||||||
| Glycosylation | 307 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 394 | 1 | N-linked (GlcNAc...) Ref.7 | ||||||||
| Glycosylation | 431 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 473 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 227 ↔ 409 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 1 – 50 | 50 | MSVPL…DRSTG → MPGRWRWQRDMHPARKLLSL LFLILMGTELTQ in isoform 3 and isoform 4. | VSP_003759 | |||||||
| Alternative sequence | 153 | 1 | A → G in isoform 2 and isoform 4. | VSP_003760 | |||||||
| Alternative sequence | 154 – 485 | 332 | Missing in isoform 2 and isoform 4. | VSP_003761 | |||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Identification and cloning of neuroblastoma-specific and nerve tissue-specific genes through compiled expression profiles." Yokoyama M., Nishi Y., Yoshii J., Okubo K., Matsubara K. DNA Res. 3:311-320(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4). |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3). Tissue: Eye. |
| [4] | "Cloning of human full-length CDSs in BD Creator(TM) system donor vector." Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A. Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 29-485 (ISOFORM 3). |
| [5] | "Large-scale concatenation cDNA sequencing." Yu W., Andersson B., Worley K.C., Muzny D.M., Ding Y., Liu W., Ricafrente J.Y., Wentland M.A., Lennon G., Gibbs R.A. Genome Res. 7:353-358(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 228-485 (ISOFORM 1). Tissue: Brain. |
| [6] | "Bioinformatic approaches for identification and characterization of olfactomedin related genes with a potential role in pathogenesis of ocular disorders." Mukhopadhyay A., Talukdar S., Bhattacharjee A., Ray K. Mol. Vis. 10:304-314(2004) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION. |
| [7] | "Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry." Liu T., Qian W.-J., Gritsenko M.A., Camp D.G. II, Monroe M.E., Moore R.J., Smith R.D. J. Proteome Res. 4:2070-2080(2005) [PubMed] [Europe PMC] [Abstract] Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-103; ASN-187; ASN-288 AND ASN-394, MASS SPECTROMETRY. Tissue: Plasma. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | D82343 mRNA. Translation: BAA11554.1. AK290478 mRNA. Translation: BAF83167.1. BC011741 mRNA. Translation: AAH11741.2. BC008763 mRNA. Translation: AAH08763.2. BT007146 mRNA. Translation: AAP35810.1. U79299 mRNA. Translation: AAB50225.1. AF035301 mRNA. Translation: AAB88184.1. BK001427 Genomic DNA. Translation: DAA01547.1. |
| IPI | IPI00017841. IPI00419820. IPI00419822. IPI00472517. |
| PIR | JC5272. |
| RefSeq | NP_006325.1. NM_006334.3. NP_055094.1. NM_014279.4. |
| UniGene | Hs.522484. |
3D structure databases | |
| ProteinModelPortal | Q99784. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q99784. 2 interactions. |
| STRING | 9606.ENSP00000252854. |
PTM databases | |
| PhosphoSite | Q99784. |
Polymorphism databases | |
| DMDM | 206729935. |
Proteomic databases | |
| PaxDb | Q99784. |
| PRIDE | Q99784. |
Protocols and materials databases | |
| DNASU | 10439. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000252854; ENSP00000252854; ENSG00000130558. ENST00000277415; ENSP00000277415; ENSG00000130558. ENST00000371793; ENSP00000360858; ENSG00000130558. ENST00000392991; ENSP00000376717; ENSG00000130558. |
| GeneID | 10439. |
| KEGG | hsa:10439. |
| UCSC | uc010nar.3. human. |
Organism-specific databases | |
| CTD | 10439. |
| GeneCards | GC09P137967. |
| HGNC | HGNC:17187. OLFM1. |
| MIM | 605366. gene. |
| neXtProt | NX_Q99784. |
| PharmGKB | PA31915. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG283888. |
| HOGENOM | HOG000232069. |
| HOVERGEN | HBG006513. |
| InParanoid | Q99784. |
| OMA | MVDFMNT. |
| PhylomeDB | Q99784. |
Gene expression databases | |
| ArrayExpress | Q99784. |
| Bgee | Q99784. |
| CleanEx | HS_OLFM1. |
| Genevestigator | Q99784. |
| GermOnline | ENSG00000130558. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR022082. Noelin-1. IPR003112. Olfac-like. IPR011047. Quinonprotein_ADH-like_supfam. [Graphical view] |
| Pfam | PF12308. Noelin-1. 1 hit. PF02191. OLF. 1 hit. [Graphical view] |
| SMART | SM00284. OLF. 1 hit. [Graphical view] |
| SUPFAM | SSF50998. Quin_alc_DH_like. 1 hit. |
| PROSITE | PS00014. ER_TARGET. 1 hit. PS51132. OLF. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | OLFM1. human. |
| GenomeRNAi | 10439. |
| NextBio | 39567. |
| SOURCE | Search... |
Entry information
| Entry name | NOE1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q99784 Secondary accession number(s): Q53XZ8 Q99452 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 9 Human chromosome 9: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
