Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q99784 (NOE1_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified March 19, 2014. Version 133. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (3) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Noelin
Alternative name(s):
Neuronal olfactomedin-related ER localized protein
Olfactomedin-1
Gene names
Name:OLFM1
Synonyms:NOE1, NOEL1
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length485 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

May play an important role in regulating the production of neural crest cells by the neural tube By similarity.

Subunit structure

Peripherally associated with AMPAR complex. AMPAR complex consists of an inner core made of 4 pore-forming GluA/GRIA proteins (GRIA1, GRIA2, GRIA3 and GRIA4) and 4 major auxiliary subunits arranged in a twofold symmetry. One of the two pairs of distinct binding sites is occupied either by CNIH2, CNIH3 or CACNG2, CACNG3. The other harbors CACNG2, CACNG3, CACNG4, CACNG8 or GSG1L. This inner core of AMPAR complex is complemented by outer core constituents binding directly to the GluA/GRIA proteins at sites distinct from the interaction sites of the inner core constituents. Outer core constituents include at least PRRT1, PRRT2, CKAMP44/SHISA9, FRRS1L and NRN1. The proteins of the inner and outer core serve as a platform for other, more peripherally associated AMPAR constituents, including OLFM1. Alone or in combination, these auxiliary subunits control the gating and pharmacology of the AMPAR complex and profoundly impact their biogenesis and protein processing By similarity.

Subcellular location

Secreted Potential. Cell junctionsynapse By similarity.

Sequence similarities

Contains 1 olfactomedin-like domain.

Binary interactions

With

Entry

#Exp.

IntAct

Notes

DISC1Q9NRI53EBI-1105073,EBI-529989

Alternative products

This entry describes 4 isoforms produced by alternative splicing. [Align] [Select]

Note: Experimental confirmation may be lacking for some isoforms.
Isoform 1 (identifier: Q99784-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q99784-2)

The sequence of this isoform differs from the canonical sequence as follows:
     153-153: A → G
     154-485: Missing.
Isoform 3 (identifier: Q99784-3)

The sequence of this isoform differs from the canonical sequence as follows:
     1-50: MSVPLLKIGV...GGGTLDRSTG → MPGRWRWQRDMHPARKLLSLLFLILMGTELTQ
Isoform 4 (identifier: Q99784-4)

Also known as: AMY;

The sequence of this isoform differs from the canonical sequence as follows:
     1-50: MSVPLLKIGV...GGGTLDRSTG → MPGRWRWQRDMHPARKLLSLLFLILMGTELTQ
     153-153: A → G
     154-485: Missing.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Signal peptide1 – 1616 Potential
Chain17 – 485469Noelin
PRO_0000020074

Regions

Domain226 – 478253Olfactomedin-like
Coiled coil87 – 225139 Potential

Amino acid modifications

Glycosylation331N-linked (GlcNAc...) Potential
Glycosylation1031N-linked (GlcNAc...) Ref.7
Glycosylation1871N-linked (GlcNAc...) Ref.7
Glycosylation2881N-linked (GlcNAc...) Ref.7
Glycosylation3071N-linked (GlcNAc...) Potential
Glycosylation3941N-linked (GlcNAc...) Ref.7
Glycosylation4311N-linked (GlcNAc...) Potential
Glycosylation4731N-linked (GlcNAc...) Potential
Disulfide bond227 ↔ 409 By similarity

Natural variations

Alternative sequence1 – 5050MSVPL…DRSTG → MPGRWRWQRDMHPARKLLSL LFLILMGTELTQ in isoform 3 and isoform 4.
VSP_003759
Alternative sequence1531A → G in isoform 2 and isoform 4.
VSP_003760
Alternative sequence154 – 485332Missing in isoform 2 and isoform 4.
VSP_003761

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified September 23, 2008. Version 4.
Checksum: D94BBDDAC60CF674

FASTA48555,343
        10         20         30         40         50         60 
MSVPLLKIGV VLSTMAMITN WMSQTLPSLV GLNTTKLSAA GGGTLDRSTG VLPTNPEESW 

        70         80         90        100        110        120 
QVYSSAQDSE GRCICTVVAP QQTMCSRDAR TKQLRQLLEK VQNMSQSIEV LDRRTQRDLQ 

       130        140        150        160        170        180 
YVEKMENQMK GLESKFKQVE ESHKQHLARQ FKAIKAKMDE LRPLIPVLEE YKADAKLVLQ 

       190        200        210        220        230        240 
FKEEVQNLTS VLNELQEEIG AYDYDELQSR VSNLEERLRA CMQKLACGKL TGISDPVTVK 

       250        260        270        280        290        300 
TSGSRFGSWM TDPLAPEGDN RVWYMDGYHN NRFVREYKSM VDFMNTDNFT SHRLPHPWSG 

       310        320        330        340        350        360 
TGQVVYNGSI YFNKFQSHII IRFDLKTETI LKTRSLDYAG YNNMYHYAWG GHSDIDLMVD 

       370        380        390        400        410        420 
ESGLWAVYAT NQNAGNIVVS RLDPVSLQTL QTWNTSYPKR SAGEAFIICG TLYVTNGYSG 

       430        440        450        460        470        480 
GTKVHYAYQT NASTYEYIDI PFQNKYSHIS MLDYNPKDRA LYAWNNGHQI LYNVTLFHVI 


RSDEL 

« Hide

Isoform 2 [UniParc].

Checksum: 3B18DC0207992A74
Show »

FASTA15317,160
Isoform 3 [UniParc].

Checksum: 93D8EA9AD73562B6
Show »

FASTA46754,117
Isoform 4 (AMY) [UniParc].

Checksum: 8F6A30B160351055
Show »

FASTA13515,934

References

« Hide 'large scale' references
[1]"Identification and cloning of neuroblastoma-specific and nerve tissue-specific genes through compiled expression profiles."
Yokoyama M., Nishi Y., Yoshii J., Okubo K., Matsubara K.
DNA Res. 3:311-320(1996) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4).
[2]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Brain.
[3]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
Tissue: Eye.
[4]"Cloning of human full-length CDSs in BD Creator(TM) system donor vector."
Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A.
Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 29-485 (ISOFORM 3).
[5]"Large-scale concatenation cDNA sequencing."
Yu W., Andersson B., Worley K.C., Muzny D.M., Ding Y., Liu W., Ricafrente J.Y., Wentland M.A., Lennon G., Gibbs R.A.
Genome Res. 7:353-358(1997) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 228-485 (ISOFORM 1).
Tissue: Brain.
[6]"Bioinformatic approaches for identification and characterization of olfactomedin related genes with a potential role in pathogenesis of ocular disorders."
Mukhopadhyay A., Talukdar S., Bhattacharjee A., Ray K.
Mol. Vis. 10:304-314(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION.
[7]"Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry."
Liu T., Qian W.-J., Gritsenko M.A., Camp D.G. II, Monroe M.E., Moore R.J., Smith R.D.
J. Proteome Res. 4:2070-2080(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-103; ASN-187; ASN-288 AND ASN-394.
Tissue: Plasma.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
D82343 mRNA. Translation: BAA11554.1.
AK290478 mRNA. Translation: BAF83167.1.
BC011741 mRNA. Translation: AAH11741.2.
BC008763 mRNA. Translation: AAH08763.2.
BT007146 mRNA. Translation: AAP35810.1.
U79299 mRNA. Translation: AAB50225.1.
AF035301 mRNA. Translation: AAB88184.1.
BK001427 Genomic DNA. Translation: DAA01547.1.
PIRJC5272.
RefSeqNP_001269540.1. NM_001282611.1.
NP_006325.1. NM_006334.3.
NP_055094.1. NM_014279.4.
UniGeneHs.522484.

3D structure databases

ProteinModelPortalQ99784.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid115706. 4 interactions.
IntActQ99784. 2 interactions.
STRING9606.ENSP00000252854.

PTM databases

PhosphoSiteQ99784.

Polymorphism databases

DMDM206729935.

Proteomic databases

PaxDbQ99784.
PRIDEQ99784.

Protocols and materials databases

DNASU10439.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000252854; ENSP00000252854; ENSG00000130558. [Q99784-3]
ENST00000277415; ENSP00000277415; ENSG00000130558. [Q99784-4]
ENST00000371793; ENSP00000360858; ENSG00000130558. [Q99784-1]
ENST00000392991; ENSP00000376717; ENSG00000130558. [Q99784-2]
GeneID10439.
KEGGhsa:10439.
UCSCuc010nar.3. human. [Q99784-1]

Organism-specific databases

CTD10439.
GeneCardsGC09P137967.
HGNCHGNC:17187. OLFM1.
HPAHPA057444.
MIM605366. gene.
neXtProtNX_Q99784.
PharmGKBPA31915.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG283888.
HOGENOMHOG000232069.
HOVERGENHBG006513.
InParanoidQ99784.
OMAQILQTWN.
PhylomeDBQ99784.
TreeFamTF315964.

Gene expression databases

ArrayExpressQ99784.
BgeeQ99784.
CleanExHS_OLFM1.
GenevestigatorQ99784.

Family and domain databases

InterProIPR022082. Noelin-1.
IPR003112. Olfac-like.
IPR011044. Quino_amine_DH_bsu.
[Graphical view]
PfamPF12308. Noelin-1. 1 hit.
PF02191. OLF. 1 hit.
[Graphical view]
SMARTSM00284. OLF. 1 hit.
[Graphical view]
SUPFAMSSF50969. SSF50969. 2 hits.
PROSITEPS00014. ER_TARGET. 1 hit.
PS51132. OLF. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSOLFM1. human.
GeneWikiOLFM1.
GenomeRNAi10439.
NextBio39567.
PROQ99784.
SOURCESearch...

Entry information

Entry nameNOE1_HUMAN
AccessionPrimary (citable) accession number: Q99784
Secondary accession number(s): Q53XZ8 expand/collapse secondary AC list , Q6IMJ4, Q969S7, Q99452
Entry history
Integrated into UniProtKB/Swiss-Prot: July 15, 1998
Last sequence update: September 23, 2008
Last modified: March 19, 2014
This is version 133 of the entry and version 4 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human chromosome 9

Human chromosome 9: entries, gene names and cross-references to MIM