Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Noelin

Gene

OLFM1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

May play an important role in regulating the production of neural crest cells by the neural tube.By similarity

GO - Molecular functioni

  1. beta-amyloid binding Source: Ensembl

GO - Biological processi

  1. negative regulation of beta-amyloid formation Source: Ensembl
  2. negative regulation of neuron migration Source: Ensembl
  3. nervous system development Source: ProtInc
  4. protein oligomerization Source: Ensembl
Complete GO annotation...

Keywords - Molecular functioni

Developmental protein

Names & Taxonomyi

Protein namesi
Recommended name:
Noelin
Alternative name(s):
Neuronal olfactomedin-related ER localized protein
Olfactomedin-1
Gene namesi
Name:OLFM1
Synonyms:NOE1, NOEL1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640 Componenti: Chromosome 9

Organism-specific databases

HGNCiHGNC:17187. OLFM1.

Subcellular locationi

Secreted Curated. Cell junctionsynapse By similarity

GO - Cellular componenti

  1. alpha-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid selective glutamate receptor complex Source: Ensembl
  2. cell junction Source: UniProtKB-KW
  3. extracellular space Source: Ensembl
  4. synapse Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Secreted, Synapse

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA31915.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 1616Sequence AnalysisAdd
BLAST
Chaini17 – 485469NoelinPRO_0000020074Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi33 – 331N-linked (GlcNAc...)Sequence Analysis
Glycosylationi103 – 1031N-linked (GlcNAc...)1 Publication
Glycosylationi187 – 1871N-linked (GlcNAc...)1 Publication
Disulfide bondi227 ↔ 409PROSITE-ProRule annotation
Glycosylationi288 – 2881N-linked (GlcNAc...)1 Publication
Glycosylationi307 – 3071N-linked (GlcNAc...)Sequence Analysis
Glycosylationi394 – 3941N-linked (GlcNAc...)1 Publication
Glycosylationi431 – 4311N-linked (GlcNAc...)Sequence Analysis
Glycosylationi473 – 4731N-linked (GlcNAc...)Sequence Analysis

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

MaxQBiQ99784.
PaxDbiQ99784.
PRIDEiQ99784.

PTM databases

PhosphoSiteiQ99784.

Expressioni

Gene expression databases

BgeeiQ99784.
CleanExiHS_OLFM1.
ExpressionAtlasiQ99784. baseline and differential.
GenevestigatoriQ99784.

Organism-specific databases

HPAiHPA057444.

Interactioni

Subunit structurei

Peripherally associated with AMPAR complex. AMPAR complex consists of an inner core made of 4 pore-forming GluA/GRIA proteins (GRIA1, GRIA2, GRIA3 and GRIA4) and 4 major auxiliary subunits arranged in a twofold symmetry. One of the two pairs of distinct binding sites is occupied either by CNIH2, CNIH3 or CACNG2, CACNG3. The other harbors CACNG2, CACNG3, CACNG4, CACNG8 or GSG1L. This inner core of AMPAR complex is complemented by outer core constituents binding directly to the GluA/GRIA proteins at sites distinct from the interaction sites of the inner core constituents. Outer core constituents include at least PRRT1, PRRT2, CKAMP44/SHISA9, FRRS1L and NRN1. The proteins of the inner and outer core serve as a platform for other, more peripherally associated AMPAR constituents, including OLFM1. Alone or in combination, these auxiliary subunits control the gating and pharmacology of the AMPAR complex and profoundly impact their biogenesis and protein processing (By similarity).By similarity

Binary interactionsi

WithEntry#Exp.IntActNotes
DISC1Q9NRI53EBI-1105073,EBI-529989

Protein-protein interaction databases

BioGridi115706. 12 interactions.
IntActiQ99784. 2 interactions.
STRINGi9606.ENSP00000252854.

Structurei

3D structure databases

ProteinModelPortaliQ99784.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini226 – 478253Olfactomedin-likePROSITE-ProRule annotationAdd
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili87 – 225139Sequence AnalysisAdd
BLAST

Sequence similaritiesi

Contains 1 olfactomedin-like domain.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil, Signal

Phylogenomic databases

eggNOGiNOG283888.
GeneTreeiENSGT00760000119005.
HOGENOMiHOG000232069.
HOVERGENiHBG006513.
InParanoidiQ99784.
OMAiMVDFMNT.
PhylomeDBiQ99784.
TreeFamiTF315964.

Family and domain databases

InterProiIPR022082. Noelin-1.
IPR003112. Olfac-like.
IPR011044. Quino_amine_DH_bsu.
[Graphical view]
PfamiPF12308. Noelin-1. 1 hit.
PF02191. OLF. 1 hit.
[Graphical view]
SMARTiSM00284. OLF. 1 hit.
[Graphical view]
SUPFAMiSSF50969. SSF50969. 2 hits.
PROSITEiPS00014. ER_TARGET. 1 hit.
PS51132. OLF. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Note: Experimental confirmation may be lacking for some isoforms.

Isoform 1 (identifier: Q99784-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSVPLLKIGV VLSTMAMITN WMSQTLPSLV GLNTTKLSAA GGGTLDRSTG
60 70 80 90 100
VLPTNPEESW QVYSSAQDSE GRCICTVVAP QQTMCSRDAR TKQLRQLLEK
110 120 130 140 150
VQNMSQSIEV LDRRTQRDLQ YVEKMENQMK GLESKFKQVE ESHKQHLARQ
160 170 180 190 200
FKAIKAKMDE LRPLIPVLEE YKADAKLVLQ FKEEVQNLTS VLNELQEEIG
210 220 230 240 250
AYDYDELQSR VSNLEERLRA CMQKLACGKL TGISDPVTVK TSGSRFGSWM
260 270 280 290 300
TDPLAPEGDN RVWYMDGYHN NRFVREYKSM VDFMNTDNFT SHRLPHPWSG
310 320 330 340 350
TGQVVYNGSI YFNKFQSHII IRFDLKTETI LKTRSLDYAG YNNMYHYAWG
360 370 380 390 400
GHSDIDLMVD ESGLWAVYAT NQNAGNIVVS RLDPVSLQTL QTWNTSYPKR
410 420 430 440 450
SAGEAFIICG TLYVTNGYSG GTKVHYAYQT NASTYEYIDI PFQNKYSHIS
460 470 480
MLDYNPKDRA LYAWNNGHQI LYNVTLFHVI RSDEL
Length:485
Mass (Da):55,343
Last modified:September 23, 2008 - v4
Checksum:iD94BBDDAC60CF674
GO
Isoform 2 (identifier: Q99784-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     153-153: A → G
     154-485: Missing.

Show »
Length:153
Mass (Da):17,160
Checksum:i3B18DC0207992A74
GO
Isoform 3 (identifier: Q99784-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-50: MSVPLLKIGV...GGGTLDRSTG → MPGRWRWQRDMHPARKLLSLLFLILMGTELTQ

Show »
Length:467
Mass (Da):54,117
Checksum:i93D8EA9AD73562B6
GO
Isoform 4 (identifier: Q99784-4) [UniParc]FASTAAdd to basket

Also known as: AMY

The sequence of this isoform differs from the canonical sequence as follows:
     1-50: MSVPLLKIGV...GGGTLDRSTG → MPGRWRWQRDMHPARKLLSLLFLILMGTELTQ
     153-153: A → G
     154-485: Missing.

Show »
Length:135
Mass (Da):15,934
Checksum:i8F6A30B160351055
GO
Isoform 5 (identifier: Q99784-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-50: MSVPLLKIGVVLSTMAMITNWMSQTLPSLVGLNTTKLSAAGGGTLDRSTG → MGEAPGREGRGPCPQLESPRRRR

Note: No experimental confirmation available.

Show »
Length:458
Mass (Da):52,815
Checksum:iDFD8A706766D5244
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti127 – 1271N → T in BAC04756 (PubMed:14702039).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 5050MSVPL…DRSTG → MPGRWRWQRDMHPARKLLSL LFLILMGTELTQ in isoform 3 and isoform 4. 3 PublicationsVSP_003759Add
BLAST
Alternative sequencei1 – 5050MSVPL…DRSTG → MGEAPGREGRGPCPQLESPR RRR in isoform 5. 1 PublicationVSP_055625Add
BLAST
Alternative sequencei153 – 1531A → G in isoform 2 and isoform 4. 1 PublicationVSP_003760
Alternative sequencei154 – 485332Missing in isoform 2 and isoform 4. 1 PublicationVSP_003761Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D82343 mRNA. Translation: BAA11554.1.
AK096304 mRNA. Translation: BAC04756.1.
AK290478 mRNA. Translation: BAF83167.1.
AL159992 Genomic DNA. No translation available.
AL390778 Genomic DNA. No translation available.
BC008763 mRNA. Translation: AAH08763.2.
BC011741 mRNA. Translation: AAH11741.2.
BT007146 mRNA. Translation: AAP35810.1.
U79299 mRNA. Translation: AAB50225.1.
AF035301 mRNA. Translation: AAB88184.1.
BK001427 Genomic DNA. Translation: DAA01546.1.
BK001427 Genomic DNA. Translation: DAA01547.1.
CCDSiCCDS65183.1. [Q99784-5]
CCDS65184.1. [Q99784-1]
CCDS6986.1. [Q99784-3]
CCDS6987.1. [Q99784-4]
PIRiJC5272.
RefSeqiNP_001269540.1. NM_001282611.1. [Q99784-1]
NP_001269541.1. NM_001282612.1. [Q99784-5]
NP_006325.1. NM_006334.3. [Q99784-4]
NP_055094.1. NM_014279.4. [Q99784-3]
UniGeneiHs.522484.

Genome annotation databases

EnsembliENST00000252854; ENSP00000252854; ENSG00000130558. [Q99784-3]
ENST00000277415; ENSP00000277415; ENSG00000130558. [Q99784-4]
ENST00000371793; ENSP00000360858; ENSG00000130558. [Q99784-1]
ENST00000371796; ENSP00000360861; ENSG00000130558. [Q99784-5]
ENST00000392991; ENSP00000376717; ENSG00000130558. [Q99784-2]
GeneIDi10439.
KEGGihsa:10439.
UCSCiuc010nar.3. human. [Q99784-1]

Polymorphism databases

DMDMi206729935.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D82343 mRNA. Translation: BAA11554.1.
AK096304 mRNA. Translation: BAC04756.1.
AK290478 mRNA. Translation: BAF83167.1.
AL159992 Genomic DNA. No translation available.
AL390778 Genomic DNA. No translation available.
BC008763 mRNA. Translation: AAH08763.2.
BC011741 mRNA. Translation: AAH11741.2.
BT007146 mRNA. Translation: AAP35810.1.
U79299 mRNA. Translation: AAB50225.1.
AF035301 mRNA. Translation: AAB88184.1.
BK001427 Genomic DNA. Translation: DAA01546.1.
BK001427 Genomic DNA. Translation: DAA01547.1.
CCDSiCCDS65183.1. [Q99784-5]
CCDS65184.1. [Q99784-1]
CCDS6986.1. [Q99784-3]
CCDS6987.1. [Q99784-4]
PIRiJC5272.
RefSeqiNP_001269540.1. NM_001282611.1. [Q99784-1]
NP_001269541.1. NM_001282612.1. [Q99784-5]
NP_006325.1. NM_006334.3. [Q99784-4]
NP_055094.1. NM_014279.4. [Q99784-3]
UniGeneiHs.522484.

3D structure databases

ProteinModelPortaliQ99784.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi115706. 12 interactions.
IntActiQ99784. 2 interactions.
STRINGi9606.ENSP00000252854.

PTM databases

PhosphoSiteiQ99784.

Polymorphism databases

DMDMi206729935.

Proteomic databases

MaxQBiQ99784.
PaxDbiQ99784.
PRIDEiQ99784.

Protocols and materials databases

DNASUi10439.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000252854; ENSP00000252854; ENSG00000130558. [Q99784-3]
ENST00000277415; ENSP00000277415; ENSG00000130558. [Q99784-4]
ENST00000371793; ENSP00000360858; ENSG00000130558. [Q99784-1]
ENST00000371796; ENSP00000360861; ENSG00000130558. [Q99784-5]
ENST00000392991; ENSP00000376717; ENSG00000130558. [Q99784-2]
GeneIDi10439.
KEGGihsa:10439.
UCSCiuc010nar.3. human. [Q99784-1]

Organism-specific databases

CTDi10439.
GeneCardsiGC09P137967.
HGNCiHGNC:17187. OLFM1.
HPAiHPA057444.
MIMi605366. gene.
neXtProtiNX_Q99784.
PharmGKBiPA31915.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiNOG283888.
GeneTreeiENSGT00760000119005.
HOGENOMiHOG000232069.
HOVERGENiHBG006513.
InParanoidiQ99784.
OMAiMVDFMNT.
PhylomeDBiQ99784.
TreeFamiTF315964.

Miscellaneous databases

ChiTaRSiOLFM1. human.
GeneWikiiOLFM1.
GenomeRNAii10439.
NextBioi39567.
PROiQ99784.
SOURCEiSearch...

Gene expression databases

BgeeiQ99784.
CleanExiHS_OLFM1.
ExpressionAtlasiQ99784. baseline and differential.
GenevestigatoriQ99784.

Family and domain databases

InterProiIPR022082. Noelin-1.
IPR003112. Olfac-like.
IPR011044. Quino_amine_DH_bsu.
[Graphical view]
PfamiPF12308. Noelin-1. 1 hit.
PF02191. OLF. 1 hit.
[Graphical view]
SMARTiSM00284. OLF. 1 hit.
[Graphical view]
SUPFAMiSSF50969. SSF50969. 2 hits.
PROSITEiPS00014. ER_TARGET. 1 hit.
PS51132. OLF. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Identification and cloning of neuroblastoma-specific and nerve tissue-specific genes through compiled expression profiles."
    Yokoyama M., Nishi Y., Yoshii J., Okubo K., Matsubara K.
    DNA Res. 3:311-320(1995) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4).
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 5).
    Tissue: Brain.
  3. "DNA sequence and analysis of human chromosome 9."
    Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E., Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C., Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S., Babbage A.K., Babbage S., Bagguley C.L.
    , Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beasley H., Beasley O., Bird C.P., Bray-Allen S., Brown A.J., Brown J.Y., Burford D., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Chen Y., Clarke G., Clark S.Y., Clee C.M., Clegg S., Collier R.E., Corby N., Crosier M., Cummings A.T., Davies J., Dhami P., Dunn M., Dutta I., Dyer L.W., Earthrowl M.E., Faulkner L., Fleming C.J., Frankish A., Frankland J.A., French L., Fricker D.G., Garner P., Garnett J., Ghori J., Gilbert J.G.R., Glison C., Grafham D.V., Gribble S., Griffiths C., Griffiths-Jones S., Grocock R., Guy J., Hall R.E., Hammond S., Harley J.L., Harrison E.S.I., Hart E.A., Heath P.D., Henderson C.D., Hopkins B.L., Howard P.J., Howden P.J., Huckle E., Johnson C., Johnson D., Joy A.A., Kay M., Keenan S., Kershaw J.K., Kimberley A.M., King A., Knights A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C., Lloyd D.M., Lovell J., Martin S., Mashreghi-Mohammadi M., Matthews L., McLaren S., McLay K.E., McMurray A., Milne S., Nickerson T., Nisbett J., Nordsiek G., Pearce A.V., Peck A.I., Porter K.M., Pandian R., Pelan S., Phillimore B., Povey S., Ramsey Y., Rand V., Scharfe M., Sehra H.K., Shownkeen R., Sims S.K., Skuce C.D., Smith M., Steward C.A., Swarbreck D., Sycamore N., Tester J., Thorpe A., Tracey A., Tromans A., Thomas D.W., Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L., Williams S.A., Wilming L., Wray P.W., Young L., Ashurst J.L., Coulson A., Blocker H., Durbin R.M., Sulston J.E., Hubbard T., Jackson M.J., Bentley D.R., Beck S., Rogers J., Dunham I.
    Nature 429:369-374(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    Tissue: Eye.
  5. "Cloning of human full-length CDSs in BD Creator(TM) system donor vector."
    Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A.
    Submitted (APR-2003) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 29-485 (ISOFORM 3).
  6. "Large-scale concatenation cDNA sequencing."
    Yu W., Andersson B., Worley K.C., Muzny D.M., Ding Y., Liu W., Ricafrente J.Y., Wentland M.A., Lennon G., Gibbs R.A.
    Genome Res. 7:353-358(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 228-485 (ISOFORM 1).
    Tissue: Brain.
  7. "Bioinformatic approaches for identification and characterization of olfactomedin related genes with a potential role in pathogenesis of ocular disorders."
    Mukhopadhyay A., Talukdar S., Bhattacharjee A., Ray K.
    Mol. Vis. 10:304-314(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION.
  8. "Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry."
    Liu T., Qian W.-J., Gritsenko M.A., Camp D.G. II, Monroe M.E., Moore R.J., Smith R.D.
    J. Proteome Res. 4:2070-2080(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-103; ASN-187; ASN-288 AND ASN-394.
    Tissue: Plasma.

Entry informationi

Entry nameiNOE1_HUMAN
AccessioniPrimary (citable) accession number: Q99784
Secondary accession number(s): Q53XZ8
, Q6IMJ4, Q6IMJ5, Q8N8R0, Q969S7, Q99452
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 15, 1998
Last sequence update: September 23, 2008
Last modified: January 7, 2015
This is version 141 of the entry and version 4 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 9
    Human chromosome 9: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.