Q99784 (NOE1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 113.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Noelin Alternative name(s): Neuronal olfactomedin-related ER localized protein Olfactomedin-1 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 485 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Seems to play an important role in regulating the production of neural crest cells by the neural tube By similarity. |
| Subcellular location | Endoplasmic reticulum lumen Potential. |
| Sequence similarities | Contains 1 olfactomedin-like domain. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Endoplasmic reticulum |
| Coding sequence diversity | Alternative splicing |
| Domain | Coiled coil Signal |
| Molecular function | Developmental protein |
| PTM | Disulfide bond Glycoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological process | nervous system development Traceable author statement. Source: ProtInc |
| Cellular component | endoplasmic reticulum lumen Inferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular function | protein binding Inferred from physical interaction. Source: IntAct |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| DISC1 | Q9NRI5 | 3 | EBI-1105073,EBI-529989 |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] Note: Experimental confirmation may be lacking for some isoforms. | ||||||
| Isoform 1 (identifier: Q99784-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q99784-2) The sequence of this isoform differs from the canonical sequence as follows: 153-153: A → G 154-485: Missing. | ||||||
| Isoform 3 (identifier: Q99784-3) The sequence of this isoform differs from the canonical sequence as follows: 1-50: MSVPLLKIGV...GGGTLDRSTG → MPGRWRWQRDMHPARKLLSLLFLILMGTELTQ | ||||||
| Isoform 4 (identifier: Q99784-4) Also known as: AMY; The sequence of this isoform differs from the canonical sequence as follows: 1-50: MSVPLLKIGV...GGGTLDRSTG → MPGRWRWQRDMHPARKLLSLLFLILMGTELTQ 153-153: A → G 154-485: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 16 | 16 | Potential | ||||||||
| Chain | 17 – 485 | 469 | Noelin | PRO_0000020074 | |||||||
Regions | |||||||||||
| Domain | 226 – 478 | 253 | Olfactomedin-like | ||||||||
| Coiled coil | 87 – 225 | 139 | Potential | ||||||||
| Motif | 482 – 485 | 4 | Prevents secretion from ER Potential | ||||||||
Amino acid modifications | |||||||||||
| Glycosylation | 33 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 103 | 1 | N-linked (GlcNAc...) Ref.7 | ||||||||
| Glycosylation | 187 | 1 | N-linked (GlcNAc...) Ref.7 | ||||||||
| Glycosylation | 288 | 1 | N-linked (GlcNAc...) Ref.7 | ||||||||
| Glycosylation | 307 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 394 | 1 | N-linked (GlcNAc...) Ref.7 | ||||||||
| Glycosylation | 431 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 473 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 227 ↔ 409 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 1 – 50 | 50 | MSVPL…DRSTG → MPGRWRWQRDMHPARKLLSL LFLILMGTELTQ in isoform 3 and isoform 4. | VSP_003759 | |||||||
| Alternative sequence | 153 | 1 | A → G in isoform 2 and isoform 4. | VSP_003760 | |||||||
| Alternative sequence | 154 – 485 | 332 | Missing in isoform 2 and isoform 4. | VSP_003761 | |||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Identification and cloning of neuroblastoma-specific and nerve tissue-specific genes through compiled expression profiles." Yokoyama M., Nishi Y., Yoshii J., Okubo K., Matsubara K. DNA Res. 3:311-320(1996) [PubMed: 9039501] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4). |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3). Tissue: Eye. |
| [4] | "Cloning of human full-length CDSs in BD Creator(TM) system donor vector." Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A. Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 29-485 (ISOFORM 3). |
| [5] | "Large-scale concatenation cDNA sequencing." Yu W., Andersson B., Worley K.C., Muzny D.M., Ding Y., Liu W., Ricafrente J.Y., Wentland M.A., Lennon G., Gibbs R.A. Genome Res. 7:353-358(1997) [PubMed: 9110174] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 228-485 (ISOFORM 1). Tissue: Brain. |
| [6] | "Bioinformatic approaches for identification and characterization of olfactomedin related genes with a potential role in pathogenesis of ocular disorders." Mukhopadhyay A., Talukdar S., Bhattacharjee A., Ray K. Mol. Vis. 10:304-314(2004) [PubMed: 15123989] [Abstract] Cited for: IDENTIFICATION. |
| [7] | "Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry." Liu T., Qian W.-J., Gritsenko M.A., Camp D.G. II, Monroe M.E., Moore R.J., Smith R.D. J. Proteome Res. 4:2070-2080(2005) [PubMed: 16335952] [Abstract] Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-103; ASN-187; ASN-288 AND ASN-394, MASS SPECTROMETRY. Tissue: Plasma. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | D82343 mRNA. Translation: BAA11554.1. AK290478 mRNA. Translation: BAF83167.1. BC011741 mRNA. Translation: AAH11741.2. BC008763 mRNA. Translation: AAH08763.2. BT007146 mRNA. Translation: AAP35810.1. U79299 mRNA. Translation: AAB50225.1. AF035301 mRNA. Translation: AAB88184.1. BK001427 Genomic DNA. Translation: DAA01547.1. |
| IPI | IPI00017841. IPI00419820. IPI00419822. IPI00472517. |
| PIR | JC5272. |
| RefSeq | NP_006325.1. NM_006334.3. NP_055094.1. NM_014279.4. |
| UniGene | Hs.522484. |
3D structure databases | |
| ProteinModelPortal | Q99784. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q99784. 2 interactions. |
| STRING | Q99784. |
Polymorphism databases | |
| DMDM | 206729935. |
Proteomic databases | |
| PRIDE | Q99784. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000371793; ENSP00000360858; ENSG00000130558. |
| GeneID | 10439. |
| KEGG | hsa:10439. |
| UCSC | uc004cfk.2. human. uc004cfm.2. human. |
Organism-specific databases | |
| CTD | 10439. |
| GeneCards | GC09P137967. |
| HGNC | HGNC:17187. OLFM1. |
| MIM | 605366. gene. |
| neXtProt | NX_Q99784. |
| GenAtlas | Search... |
Phylogenomic databases | |
| GeneTree | ENSGT00560000076789. |
| HOGENOM | HBG717166. |
| HOVERGEN | HBG006513. |
| InParanoid | Q99784. |
| OMA | QILQTWN. |
| PhylomeDB | Q99784. |
Gene expression databases | |
| ArrayExpress | Q99784. |
| Bgee | Q99784. |
| CleanEx | HS_OLFM1. |
| Genevestigator | Q99784. |
| GermOnline | ENSG00000130558. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR022082. Noelin-1. IPR003112. Olfac-like. IPR011047. Quinonprotein_ADH-like. [Graphical view] |
| Pfam | PF12308. Noelin-1. 1 hit. PF02191. OLF. 1 hit. [Graphical view] |
| SMART | SM00284. OLF. 1 hit. [Graphical view] |
| SUPFAM | SSF50998. Quin_alc_DH_like. 1 hit. |
| PROSITE | PS00014. ER_TARGET. 1 hit. PS51132. OLF. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 39567. |
| SOURCE | Search... |
Entry information
| Entry name | NOE1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q99784 Secondary accession number(s): Q53XZ8 Q99452 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 9 Human chromosome 9: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with