SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q99784

- NOE1_HUMAN

UniProt

Q99784 - NOE1_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Noelin

Gene
OLFM1, NOE1, NOEL1
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

May play an important role in regulating the production of neural crest cells by the neural tube By similarity.

GO - Molecular functioni

  1. protein binding Source: IntAct

GO - Biological processi

  1. nervous system development Source: ProtInc
  2. protein oligomerization Source: Ensembl
Complete GO annotation...

Keywords - Molecular functioni

Developmental protein

Names & Taxonomyi

Protein namesi
Recommended name:
Noelin
Alternative name(s):
Neuronal olfactomedin-related ER localized protein
Olfactomedin-1
Gene namesi
Name:OLFM1
Synonyms:NOE1, NOEL1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 9

Organism-specific databases

HGNCiHGNC:17187. OLFM1.

Subcellular locationi

Secreted Reviewed prediction. Cell junctionsynapse By similarity

GO - Cellular componenti

  1. alpha-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid selective glutamate receptor complex Source: Ensembl
  2. cell junction Source: UniProtKB-KW
  3. extracellular space Source: Ensembl
  4. synapse Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Secreted, Synapse

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA31915.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 1616 Reviewed predictionAdd
BLAST
Chaini17 – 485469NoelinPRO_0000020074Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi33 – 331N-linked (GlcNAc...) Reviewed prediction
Glycosylationi103 – 1031N-linked (GlcNAc...)1 Publication
Glycosylationi187 – 1871N-linked (GlcNAc...)1 Publication
Disulfide bondi227 ↔ 409 By similarity
Glycosylationi288 – 2881N-linked (GlcNAc...)1 Publication
Glycosylationi307 – 3071N-linked (GlcNAc...) Reviewed prediction
Glycosylationi394 – 3941N-linked (GlcNAc...)1 Publication
Glycosylationi431 – 4311N-linked (GlcNAc...) Reviewed prediction
Glycosylationi473 – 4731N-linked (GlcNAc...) Reviewed prediction

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

MaxQBiQ99784.
PaxDbiQ99784.
PRIDEiQ99784.

PTM databases

PhosphoSiteiQ99784.

Expressioni

Gene expression databases

ArrayExpressiQ99784.
BgeeiQ99784.
CleanExiHS_OLFM1.
GenevestigatoriQ99784.

Organism-specific databases

HPAiHPA057444.

Interactioni

Subunit structurei

Peripherally associated with AMPAR complex. AMPAR complex consists of an inner core made of 4 pore-forming GluA/GRIA proteins (GRIA1, GRIA2, GRIA3 and GRIA4) and 4 major auxiliary subunits arranged in a twofold symmetry. One of the two pairs of distinct binding sites is occupied either by CNIH2, CNIH3 or CACNG2, CACNG3. The other harbors CACNG2, CACNG3, CACNG4, CACNG8 or GSG1L. This inner core of AMPAR complex is complemented by outer core constituents binding directly to the GluA/GRIA proteins at sites distinct from the interaction sites of the inner core constituents. Outer core constituents include at least PRRT1, PRRT2, CKAMP44/SHISA9, FRRS1L and NRN1. The proteins of the inner and outer core serve as a platform for other, more peripherally associated AMPAR constituents, including OLFM1. Alone or in combination, these auxiliary subunits control the gating and pharmacology of the AMPAR complex and profoundly impact their biogenesis and protein processing By similarity.

Binary interactionsi

WithEntry#Exp.IntActNotes
DISC1Q9NRI53EBI-1105073,EBI-529989

Protein-protein interaction databases

BioGridi115706. 4 interactions.
IntActiQ99784. 2 interactions.
STRINGi9606.ENSP00000252854.

Structurei

3D structure databases

ProteinModelPortaliQ99784.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini226 – 478253Olfactomedin-likeAdd
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili87 – 225139 Reviewed predictionAdd
BLAST

Sequence similaritiesi

Keywords - Domaini

Coiled coil, Signal

Phylogenomic databases

eggNOGiNOG283888.
HOGENOMiHOG000232069.
HOVERGENiHBG006513.
InParanoidiQ99784.
OMAiRSHERIP.
PhylomeDBiQ99784.
TreeFamiTF315964.

Family and domain databases

InterProiIPR022082. Noelin-1.
IPR003112. Olfac-like.
IPR011044. Quino_amine_DH_bsu.
[Graphical view]
PfamiPF12308. Noelin-1. 1 hit.
PF02191. OLF. 1 hit.
[Graphical view]
SMARTiSM00284. OLF. 1 hit.
[Graphical view]
SUPFAMiSSF50969. SSF50969. 2 hits.
PROSITEiPS00014. ER_TARGET. 1 hit.
PS51132. OLF. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 isoformsi produced by alternative splicing. Align

Note: Experimental confirmation may be lacking for some isoforms.

Isoform 1 (identifier: Q99784-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MSVPLLKIGV VLSTMAMITN WMSQTLPSLV GLNTTKLSAA GGGTLDRSTG    50
VLPTNPEESW QVYSSAQDSE GRCICTVVAP QQTMCSRDAR TKQLRQLLEK 100
VQNMSQSIEV LDRRTQRDLQ YVEKMENQMK GLESKFKQVE ESHKQHLARQ 150
FKAIKAKMDE LRPLIPVLEE YKADAKLVLQ FKEEVQNLTS VLNELQEEIG 200
AYDYDELQSR VSNLEERLRA CMQKLACGKL TGISDPVTVK TSGSRFGSWM 250
TDPLAPEGDN RVWYMDGYHN NRFVREYKSM VDFMNTDNFT SHRLPHPWSG 300
TGQVVYNGSI YFNKFQSHII IRFDLKTETI LKTRSLDYAG YNNMYHYAWG 350
GHSDIDLMVD ESGLWAVYAT NQNAGNIVVS RLDPVSLQTL QTWNTSYPKR 400
SAGEAFIICG TLYVTNGYSG GTKVHYAYQT NASTYEYIDI PFQNKYSHIS 450
MLDYNPKDRA LYAWNNGHQI LYNVTLFHVI RSDEL 485
Length:485
Mass (Da):55,343
Last modified:September 23, 2008 - v4
Checksum:iD94BBDDAC60CF674
GO
Isoform 2 (identifier: Q99784-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     153-153: A → G
     154-485: Missing.

Show »
Length:153
Mass (Da):17,160
Checksum:i3B18DC0207992A74
GO
Isoform 3 (identifier: Q99784-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-50: MSVPLLKIGV...GGGTLDRSTG → MPGRWRWQRDMHPARKLLSLLFLILMGTELTQ

Show »
Length:467
Mass (Da):54,117
Checksum:i93D8EA9AD73562B6
GO
Isoform 4 (identifier: Q99784-4) [UniParc]FASTAAdd to Basket

Also known as: AMY

The sequence of this isoform differs from the canonical sequence as follows:
     1-50: MSVPLLKIGV...GGGTLDRSTG → MPGRWRWQRDMHPARKLLSLLFLILMGTELTQ
     153-153: A → G
     154-485: Missing.

Show »
Length:135
Mass (Da):15,934
Checksum:i8F6A30B160351055
GO
Isoform 5 (identifier: Q99784-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-50: MSVPLLKIGVVLSTMAMITNWMSQTLPSLVGLNTTKLSAAGGGTLDRSTG → MGEAPGREGRGPCPQLESPRRRR

Note: No experimental confirmation available.

Show »
Length:458
Mass (Da):52,815
Checksum:iDFD8A706766D5244
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 5050MSVPL…DRSTG → MPGRWRWQRDMHPARKLLSL LFLILMGTELTQ in isoform 3 and isoform 4. VSP_003759Add
BLAST
Alternative sequencei1 – 5050MSVPL…DRSTG → MGEAPGREGRGPCPQLESPR RRR in isoform 5. VSP_055625Add
BLAST
Alternative sequencei153 – 1531A → G in isoform 2 and isoform 4. VSP_003760
Alternative sequencei154 – 485332Missing in isoform 2 and isoform 4. VSP_003761Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti127 – 1271N → T in BAC04756. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
D82343 mRNA. Translation: BAA11554.1.
AK096304 mRNA. Translation: BAC04756.1.
AK290478 mRNA. Translation: BAF83167.1.
AL159992 Genomic DNA. No translation available.
AL390778 Genomic DNA. No translation available.
BC008763 mRNA. Translation: AAH08763.2.
BC011741 mRNA. Translation: AAH11741.2.
BT007146 mRNA. Translation: AAP35810.1.
U79299 mRNA. Translation: AAB50225.1.
AF035301 mRNA. Translation: AAB88184.1.
BK001427 Genomic DNA. Translation: DAA01546.1.
BK001427 Genomic DNA. Translation: DAA01547.1.
CCDSiCCDS65184.1. [Q99784-1]
CCDS6986.1. [Q99784-3]
CCDS6987.1. [Q99784-4]
PIRiJC5272.
RefSeqiNP_001269540.1. NM_001282611.1. [Q99784-1]
NP_006325.1. NM_006334.3. [Q99784-4]
NP_055094.1. NM_014279.4. [Q99784-3]
UniGeneiHs.522484.

Genome annotation databases

EnsembliENST00000252854; ENSP00000252854; ENSG00000130558. [Q99784-3]
ENST00000277415; ENSP00000277415; ENSG00000130558. [Q99784-4]
ENST00000371793; ENSP00000360858; ENSG00000130558. [Q99784-1]
ENST00000371796; ENSP00000360861; ENSG00000130558.
ENST00000392991; ENSP00000376717; ENSG00000130558. [Q99784-2]
GeneIDi10439.
KEGGihsa:10439.
UCSCiuc010nar.3. human. [Q99784-1]

Polymorphism databases

DMDMi206729935.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
D82343 mRNA. Translation: BAA11554.1 .
AK096304 mRNA. Translation: BAC04756.1 .
AK290478 mRNA. Translation: BAF83167.1 .
AL159992 Genomic DNA. No translation available.
AL390778 Genomic DNA. No translation available.
BC008763 mRNA. Translation: AAH08763.2 .
BC011741 mRNA. Translation: AAH11741.2 .
BT007146 mRNA. Translation: AAP35810.1 .
U79299 mRNA. Translation: AAB50225.1 .
AF035301 mRNA. Translation: AAB88184.1 .
BK001427 Genomic DNA. Translation: DAA01546.1 .
BK001427 Genomic DNA. Translation: DAA01547.1 .
CCDSi CCDS65184.1. [Q99784-1 ]
CCDS6986.1. [Q99784-3 ]
CCDS6987.1. [Q99784-4 ]
PIRi JC5272.
RefSeqi NP_001269540.1. NM_001282611.1. [Q99784-1 ]
NP_006325.1. NM_006334.3. [Q99784-4 ]
NP_055094.1. NM_014279.4. [Q99784-3 ]
UniGenei Hs.522484.

3D structure databases

ProteinModelPortali Q99784.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 115706. 4 interactions.
IntActi Q99784. 2 interactions.
STRINGi 9606.ENSP00000252854.

PTM databases

PhosphoSitei Q99784.

Polymorphism databases

DMDMi 206729935.

Proteomic databases

MaxQBi Q99784.
PaxDbi Q99784.
PRIDEi Q99784.

Protocols and materials databases

DNASUi 10439.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000252854 ; ENSP00000252854 ; ENSG00000130558 . [Q99784-3 ]
ENST00000277415 ; ENSP00000277415 ; ENSG00000130558 . [Q99784-4 ]
ENST00000371793 ; ENSP00000360858 ; ENSG00000130558 . [Q99784-1 ]
ENST00000371796 ; ENSP00000360861 ; ENSG00000130558 .
ENST00000392991 ; ENSP00000376717 ; ENSG00000130558 . [Q99784-2 ]
GeneIDi 10439.
KEGGi hsa:10439.
UCSCi uc010nar.3. human. [Q99784-1 ]

Organism-specific databases

CTDi 10439.
GeneCardsi GC09P137967.
HGNCi HGNC:17187. OLFM1.
HPAi HPA057444.
MIMi 605366. gene.
neXtProti NX_Q99784.
PharmGKBi PA31915.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG283888.
HOGENOMi HOG000232069.
HOVERGENi HBG006513.
InParanoidi Q99784.
OMAi RSHERIP.
PhylomeDBi Q99784.
TreeFami TF315964.

Miscellaneous databases

ChiTaRSi OLFM1. human.
GeneWikii OLFM1.
GenomeRNAii 10439.
NextBioi 39567.
PROi Q99784.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q99784.
Bgeei Q99784.
CleanExi HS_OLFM1.
Genevestigatori Q99784.

Family and domain databases

InterProi IPR022082. Noelin-1.
IPR003112. Olfac-like.
IPR011044. Quino_amine_DH_bsu.
[Graphical view ]
Pfami PF12308. Noelin-1. 1 hit.
PF02191. OLF. 1 hit.
[Graphical view ]
SMARTi SM00284. OLF. 1 hit.
[Graphical view ]
SUPFAMi SSF50969. SSF50969. 2 hits.
PROSITEi PS00014. ER_TARGET. 1 hit.
PS51132. OLF. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Identification and cloning of neuroblastoma-specific and nerve tissue-specific genes through compiled expression profiles."
    Yokoyama M., Nishi Y., Yoshii J., Okubo K., Matsubara K.
    DNA Res. 3:311-320(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4).
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 5).
    Tissue: Brain.
  3. "DNA sequence and analysis of human chromosome 9."
    Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E., Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C., Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S., Babbage A.K., Babbage S., Bagguley C.L.
    , Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beasley H., Beasley O., Bird C.P., Bray-Allen S., Brown A.J., Brown J.Y., Burford D., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Chen Y., Clarke G., Clark S.Y., Clee C.M., Clegg S., Collier R.E., Corby N., Crosier M., Cummings A.T., Davies J., Dhami P., Dunn M., Dutta I., Dyer L.W., Earthrowl M.E., Faulkner L., Fleming C.J., Frankish A., Frankland J.A., French L., Fricker D.G., Garner P., Garnett J., Ghori J., Gilbert J.G.R., Glison C., Grafham D.V., Gribble S., Griffiths C., Griffiths-Jones S., Grocock R., Guy J., Hall R.E., Hammond S., Harley J.L., Harrison E.S.I., Hart E.A., Heath P.D., Henderson C.D., Hopkins B.L., Howard P.J., Howden P.J., Huckle E., Johnson C., Johnson D., Joy A.A., Kay M., Keenan S., Kershaw J.K., Kimberley A.M., King A., Knights A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C., Lloyd D.M., Lovell J., Martin S., Mashreghi-Mohammadi M., Matthews L., McLaren S., McLay K.E., McMurray A., Milne S., Nickerson T., Nisbett J., Nordsiek G., Pearce A.V., Peck A.I., Porter K.M., Pandian R., Pelan S., Phillimore B., Povey S., Ramsey Y., Rand V., Scharfe M., Sehra H.K., Shownkeen R., Sims S.K., Skuce C.D., Smith M., Steward C.A., Swarbreck D., Sycamore N., Tester J., Thorpe A., Tracey A., Tromans A., Thomas D.W., Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L., Williams S.A., Wilming L., Wray P.W., Young L., Ashurst J.L., Coulson A., Blocker H., Durbin R.M., Sulston J.E., Hubbard T., Jackson M.J., Bentley D.R., Beck S., Rogers J., Dunham I.
    Nature 429:369-374(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    Tissue: Eye.
  5. "Cloning of human full-length CDSs in BD Creator(TM) system donor vector."
    Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A.
    Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 29-485 (ISOFORM 3).
  6. "Large-scale concatenation cDNA sequencing."
    Yu W., Andersson B., Worley K.C., Muzny D.M., Ding Y., Liu W., Ricafrente J.Y., Wentland M.A., Lennon G., Gibbs R.A.
    Genome Res. 7:353-358(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 228-485 (ISOFORM 1).
    Tissue: Brain.
  7. "Bioinformatic approaches for identification and characterization of olfactomedin related genes with a potential role in pathogenesis of ocular disorders."
    Mukhopadhyay A., Talukdar S., Bhattacharjee A., Ray K.
    Mol. Vis. 10:304-314(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION.
  8. "Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry."
    Liu T., Qian W.-J., Gritsenko M.A., Camp D.G. II, Monroe M.E., Moore R.J., Smith R.D.
    J. Proteome Res. 4:2070-2080(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-103; ASN-187; ASN-288 AND ASN-394.
    Tissue: Plasma.

Entry informationi

Entry nameiNOE1_HUMAN
AccessioniPrimary (citable) accession number: Q99784
Secondary accession number(s): Q53XZ8
, Q6IMJ4, Q6IMJ5, Q8N8R0, Q969S7, Q99452
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 15, 1998
Last sequence update: September 23, 2008
Last modified: September 3, 2014
This is version 137 of the entry and version 4 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 9
    Human chromosome 9: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi