Q99759 (M3K3_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 141.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Mitogen-activated protein kinase kinase kinase 3 EC=2.7.11.25 Alternative name(s): MAPK/ERK kinase kinase 3 Short name=MEK kinase 3 Short name=MEKK 3 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 626 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Component of a protein kinase signal transduction cascade. Mediates activation of the NF-kappa-B, AP1 and DDIT3 transcriptional regulators. Ref.1 Ref.8 Ref.9 Ref.10 |
| Catalytic activity | ATP + a protein = ADP + a phosphoprotein. |
| Cofactor | Magnesium. |
| Enzyme regulation | Activated by phosphorylation on Thr-530 By similarity. |
| Subunit structure | Binds both upstream activators and downstream substrates in multimolecular complexes. Part of a complex with MAP2K3, RAC1 and CCM2. Interacts with MAP2K5 and SPAG9. Ref.8 Ref.9 Ref.10 |
| Post-translational modification | Phosphorylation at Ser-166 and Ser-337 by SGK1 inhibits its activity. |
| Sequence similarities | Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. MAP kinase kinase kinase subfamily. Contains 1 OPR domain. Contains 1 protein kinase domain. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing Polymorphism |
| Ligand | ATP-binding Magnesium Metal-binding Nucleotide-binding |
| Molecular function | Kinase Serine/threonine-protein kinase Transferase |
| PTM | Phosphoprotein |
| Technical term | 3D-structure Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | positive regulation of I-kappaB kinase/NF-kappaB cascade Inferred from expression pattern PubMed 12761501. Source: UniProtKB protein autophosphorylationInferred from direct assay PubMed 15001576. Source: MGI |
| Cellular_component | cytosol Traceable author statement. Source: Reactome |
| Molecular_function | ATP binding Inferred from electronic annotation. Source: UniProtKB-KW MAP kinase kinase kinase activityTraceable author statement Ref.1. Source: ProtInc metal ion bindingInferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| TRAF7 | Q6Q0C0 | 3 | EBI-307281,EBI-307556 |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q99759-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q99759-2) The sequence of this isoform differs from the canonical sequence as follows: 42-42: Q → QKKHNSSSSALLNSPTVTTSSCAGASEKKKFL |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 626 | 626 | Mitogen-activated protein kinase kinase kinase 3 | PRO_0000086245 | ||||||||||||||||||||
Regions | ||||||||||||||||||||||||
| Domain | 44 – 123 | 80 | OPR | |||||||||||||||||||||
| Domain | 362 – 622 | 261 | Protein kinase | |||||||||||||||||||||
| Nucleotide binding | 368 – 376 | 9 | ATP By similarity | |||||||||||||||||||||
Sites | ||||||||||||||||||||||||
| Active site | 489 | 1 | Proton acceptor By similarity | |||||||||||||||||||||
| Binding site | 391 | 1 | ATP By similarity | |||||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||||
| Modified residue | 166 | 1 | Phosphoserine; by SGK1 Ref.7 | |||||||||||||||||||||
| Modified residue | 250 | 1 | Phosphoserine Ref.11 Ref.12 | |||||||||||||||||||||
| Modified residue | 337 | 1 | Phosphoserine; by SGK1 Ref.7 Ref.11 Ref.12 Ref.13 | |||||||||||||||||||||
| Modified residue | 340 | 1 | Phosphoserine Ref.11 Ref.12 Ref.13 | |||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||
| Alternative sequence | 42 | 1 | Q → QKKHNSSSSALLNSPTVTTS SCAGASEKKKFL in isoform 2. | VSP_035967 | ||||||||||||||||||||
| Natural variant | 281 | 1 | V → M. Ref.14 Corresponds to variant rs36109904 [ dbSNP | Ensembl ]. | VAR_040685 | ||||||||||||||||||||
| Natural variant | 325 | 1 | A → G. Corresponds to variant rs34042309 [ dbSNP | Ensembl ]. | VAR_037275 | ||||||||||||||||||||
| Natural variant | 435 | 1 | A → G. Corresponds to variant rs9910858 [ dbSNP | Ensembl ]. | VAR_037276 | ||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||
| Sequence conflict | 135 | 1 | G → E in AAB41729. Ref.1 | |||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||
| Beta strand | 45 – 51 | 7 | ||||||||||||||||||||||
| Beta strand | 54 – 60 | 7 | ||||||||||||||||||||||
| Helix | 66 – 77 | 12 | ||||||||||||||||||||||
| Beta strand | 82 – 86 | 5 | ||||||||||||||||||||||
| Beta strand | 91 – 93 | 3 | ||||||||||||||||||||||
| Helix | 97 – 109 | 13 | ||||||||||||||||||||||
| Turn | 111 – 114 | 4 | ||||||||||||||||||||||
| Beta strand | 115 – 121 | 7 | ||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Direct activation of the stress-activated protein kinase (SAPK) and extracellular signal-regulated protein kinase (ERK) pathways by an inducible mitogen-activated protein kinase/ERK kinase kinase 3 (MEKK) derivative." Ellinger-Ziegelbauer H.C., Brown K., Kelly K., Siebenlist U. J. Biol. Chem. 272:2668-2674(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION. |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Placenta. |
| [3] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Melanoma. |
| [4] | "DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage." Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L. Nusbaum C.Nature 440:1045-1049(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain and PNS. |
| [7] | "Inhibition of mitogen-activated kinase kinase kinase 3 activity through phosphorylation by the serum- and glucocorticoid-induced kinase 1." Chun J., Kwon T., Kim D.J., Park I., Chung G., Lee E.J., Hong S.K., Chang S.I., Kim H.Y., Kang S.S. J. Biochem. 133:103-108(2003) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION AT SER-166 AND SER-337 BY SGK1. |
| [8] | "PB1 domains of MEKK2 and MEKK3 interact with the MEK5 PB1 domain for activation of the ERK5 pathway." Nakamura K., Johnson G.L. J. Biol. Chem. 278:36989-36992(2003) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH MAP2K5. |
| [9] | "Differential regulation of interleukin 1 receptor and Toll-like receptor signaling by MEKK3." Huang Q., Yang J., Lin Y., Walker C., Cheng J., Liu Z.G., Su B. Nat. Immunol. 5:98-103(2004) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH TRAF6. |
| [10] | "A physical and functional map of the human TNF-alpha/NF-kappa B signal transduction pathway." Bouwmeester T., Bauch A., Ruffner H., Angrand P.-O., Bergamini G., Croughton K., Cruciat C., Eberhard D., Gagneur J., Ghidelli S., Hopf C., Huhse B., Mangano R., Michon A.-M., Schirle M., Schlegl J., Schwab M., Stein M.A. Superti-Furga G.Nat. Cell Biol. 6:97-105(2004) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH TRAF7. |
| [11] | "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle." Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M. Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-250; SER-337 AND SER-340, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [12] | "Large-scale proteomics analysis of the human kinome." Oppermann F.S., Gnad F., Olsen J.V., Hornberger R., Greff Z., Keri G., Mann M., Daub H. Mol. Cell. Proteomics 8:1751-1764(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-250; SER-337 AND SER-340, MASS SPECTROMETRY. |
| [13] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-337 AND SER-340, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| [14] | "Patterns of somatic mutation in human cancer genomes." Greenman C., Stephens P., Smith R., Dalgliesh G.L., Hunter C., Bignell G., Davies H., Teague J., Butler A., Stevens C., Edkins S., O'Meara S., Vastrik I., Schmidt E.E., Avis T., Barthorpe S., Bhamra G., Buck G. Stratton M.R.Nature 446:153-158(2007) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT [LARGE SCALE ANALYSIS] MET-281. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | U78876 mRNA. Translation: AAB41729.1. AK315305 mRNA. Translation: BAG37709.1. AL834303 mRNA. Translation: CAD38973.1. AC046185 Genomic DNA. No translation available. CH471109 Genomic DNA. Translation: EAW94297.1. CH471109 Genomic DNA. Translation: EAW94298.1. CH471109 Genomic DNA. Translation: EAW94299.1. BC090859 mRNA. Translation: AAH90859.1. BC093672 mRNA. Translation: AAH93672.1. BC093674 mRNA. Translation: AAH93674.1. | ||||||||||||||||||||||||||||||
| IPI | IPI00017801. IPI00181703. | ||||||||||||||||||||||||||||||
| RefSeq | NP_002392.2. NM_002401.3. NP_976226.1. NM_203351.1. | ||||||||||||||||||||||||||||||
| UniGene | Hs.29282. | ||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||
| ProteinModelPortal | Q99759. | ||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||
| DIP | DIP-27521N. | ||||||||||||||||||||||||||||||
| IntAct | Q99759. 5 interactions. | ||||||||||||||||||||||||||||||
| MINT | MINT-272157. | ||||||||||||||||||||||||||||||
| STRING | 9606.ENSP00000354927. | ||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||
| PhosphoSite | Q99759. | ||||||||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||||||||
| DMDM | 160332306. | ||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||
| PaxDb | Q99759. | ||||||||||||||||||||||||||||||
| PRIDE | Q99759. | ||||||||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||||||||
| DNASU | 4215. | ||||||||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||
| Ensembl | ENST00000361357; ENSP00000354927; ENSG00000198909. ENST00000361733; ENSP00000354485; ENSG00000198909. ENST00000579585; ENSP00000461988; ENSG00000198909. | ||||||||||||||||||||||||||||||
| GeneID | 4215. | ||||||||||||||||||||||||||||||
| KEGG | hsa:4215. | ||||||||||||||||||||||||||||||
| UCSC | uc002jbe.3. human. uc002jbg.3. human. | ||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||
| CTD | 4215. | ||||||||||||||||||||||||||||||
| GeneCards | GC17P061699. | ||||||||||||||||||||||||||||||
| HGNC | HGNC:6855. MAP3K3. | ||||||||||||||||||||||||||||||
| HPA | CAB007764. | ||||||||||||||||||||||||||||||
| MIM | 602539. gene. | ||||||||||||||||||||||||||||||
| neXtProt | NX_Q99759. | ||||||||||||||||||||||||||||||
| PharmGKB | PA30599. | ||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||
| eggNOG | COG0515. | ||||||||||||||||||||||||||||||
| HOGENOM | HOG000049130. | ||||||||||||||||||||||||||||||
| HOVERGEN | HBG006303. | ||||||||||||||||||||||||||||||
| KO | K04421. | ||||||||||||||||||||||||||||||
| OMA | QALHSIM. | ||||||||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||||||||
| BRENDA | 2.7.12.2. 2681. | ||||||||||||||||||||||||||||||
| Pathway_Interaction_DB | il1pathway. IL1-mediated signaling events. p38_mkk3_6pathway. p38 MAPK signaling pathway. p38alphabetapathway. Regulation of p38-alpha and p38-beta. tnfpathway. TNF receptor signaling pathway. | ||||||||||||||||||||||||||||||
| Reactome | REACT_6900. Immune System. | ||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||
| ArrayExpress | Q99759. | ||||||||||||||||||||||||||||||
| Bgee | Q99759. | ||||||||||||||||||||||||||||||
| CleanEx | HS_MAP3K3. | ||||||||||||||||||||||||||||||
| Genevestigator | Q99759. | ||||||||||||||||||||||||||||||
| GermOnline | ENSG00000198909. Homo sapiens. | ||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||
| InterPro | IPR011009. Kinase-like_dom. IPR000270. OPR_PB1. IPR000719. Prot_kinase_cat_dom. IPR002290. Ser/Thr_dual-sp_kinase_dom. [Graphical view] | ||||||||||||||||||||||||||||||
| Pfam | PF00564. PB1. 1 hit. PF00069. Pkinase. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||
| SMART | SM00666. PB1. 1 hit. SM00220. S_TKc. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||
| SUPFAM | SSF56112. Kinase_like. 1 hit. | ||||||||||||||||||||||||||||||
| PROSITE | PS00107. PROTEIN_KINASE_ATP. False negative. PS50011. PROTEIN_KINASE_DOM. 1 hit. PS00108. PROTEIN_KINASE_ST. False negative. [Graphical view] | ||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||
Other | |||||||||||||||||||||||||||||||
| BindingDB | Q99759. | ||||||||||||||||||||||||||||||
| ChEMBL | CHEMBL5970. | ||||||||||||||||||||||||||||||
| ChiTaRS | MAP3K3. human. | ||||||||||||||||||||||||||||||
| EvolutionaryTrace | Q99759. | ||||||||||||||||||||||||||||||
| GenomeRNAi | 4215. | ||||||||||||||||||||||||||||||
| NextBio | 16621. | ||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||
Entry information
| Entry name | M3K3_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q99759 Secondary accession number(s): B2RCW2 Q8N3I9 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human and mouse protein kinases Human and mouse protein kinases: classification and index |
| Human chromosome 17 Human chromosome 17: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
