Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q99759

- M3K3_HUMAN

UniProt

Q99759 - M3K3_HUMAN

Protein

Mitogen-activated protein kinase kinase kinase 3

Gene

MAP3K3

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 156 (01 Oct 2014)
      Sequence version 2 (13 Nov 2007)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Component of a protein kinase signal transduction cascade. Mediates activation of the NF-kappa-B, AP1 and DDIT3 transcriptional regulators.4 Publications

    Catalytic activityi

    ATP + a protein = ADP + a phosphoprotein.

    Cofactori

    Magnesium.

    Enzyme regulationi

    Activated by phosphorylation on Thr-530.By similarity

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Binding sitei391 – 3911ATPPROSITE-ProRule annotation
    Active sitei489 – 4891Proton acceptorPROSITE-ProRule annotation

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Nucleotide bindingi368 – 3769ATPPROSITE-ProRule annotation

    GO - Molecular functioni

    1. ATP binding Source: UniProtKB-KW
    2. MAP kinase kinase kinase activity Source: ProtInc
    3. metal ion binding Source: UniProtKB-KW
    4. protein binding Source: IntAct
    5. protein kinase activity Source: MGI

    GO - Biological processi

    1. activation of MAPKK activity Source: GOC
    2. intracellular signal transduction Source: MGI
    3. MAPK cascade Source: ProtInc
    4. positive regulation of I-kappaB kinase/NF-kappaB signaling Source: UniProtKB
    5. protein autophosphorylation Source: MGI

    Keywords - Molecular functioni

    Kinase, Serine/threonine-protein kinase, Transferase

    Keywords - Ligandi

    ATP-binding, Magnesium, Metal-binding, Nucleotide-binding

    Enzyme and pathway databases

    BRENDAi2.7.12.2. 2681.
    ReactomeiREACT_22442. Interleukin-1 signaling.
    SignaLinkiQ99759.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Mitogen-activated protein kinase kinase kinase 3 (EC:2.7.11.25)
    Alternative name(s):
    MAPK/ERK kinase kinase 3
    Short name:
    MEK kinase 3
    Short name:
    MEKK 3
    Gene namesi
    Name:MAP3K3
    Synonyms:MAPKKK3, MEKK3
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 17

    Organism-specific databases

    HGNCiHGNC:6855. MAP3K3.

    Subcellular locationi

    GO - Cellular componenti

    1. cytosol Source: Reactome

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA30599.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 626626Mitogen-activated protein kinase kinase kinase 3PRO_0000086245Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei166 – 1661Phosphoserine; by SGK11 Publication
    Modified residuei250 – 2501Phosphoserine2 Publications
    Modified residuei337 – 3371Phosphoserine; by SGK14 Publications
    Modified residuei340 – 3401Phosphoserine3 Publications

    Post-translational modificationi

    Phosphorylation at Ser-166 and Ser-337 by SGK1 inhibits its activity.4 Publications

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    MaxQBiQ99759.
    PaxDbiQ99759.
    PRIDEiQ99759.

    PTM databases

    PhosphoSiteiQ99759.

    Expressioni

    Gene expression databases

    ArrayExpressiQ99759.
    BgeeiQ99759.
    CleanExiHS_MAP3K3.
    GenevestigatoriQ99759.

    Organism-specific databases

    HPAiCAB007764.
    HPA035410.
    HPA035411.

    Interactioni

    Subunit structurei

    Binds both upstream activators and downstream substrates in multimolecular complexes. Part of a complex with MAP2K3, RAC1 and CCM2. Interacts with MAP2K5 and SPAG9.3 Publications

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    MAP2K5Q131632EBI-307281,EBI-307294
    TRAF7Q6Q0C02EBI-307281,EBI-307556
    YWHABP319462EBI-307281,EBI-359815
    YWHAEP622583EBI-307281,EBI-356498

    Protein-protein interaction databases

    BioGridi110379. 33 interactions.
    DIPiDIP-27521N.
    IntActiQ99759. 30 interactions.
    MINTiMINT-272157.
    STRINGi9606.ENSP00000354927.

    Structurei

    Secondary structure

    1
    626
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Beta strandi45 – 517
    Beta strandi54 – 607
    Helixi66 – 7712
    Beta strandi82 – 865
    Beta strandi91 – 933
    Helixi97 – 10913
    Turni111 – 1144
    Beta strandi115 – 1217

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    2C60X-ray1.25A37-124[»]
    2JRHNMR-A42-126[»]
    2O2VX-ray1.83B37-124[»]
    2PPHNMR-A42-126[»]
    ProteinModelPortaliQ99759.
    SMRiQ99759. Positions 43-122, 325-624.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiQ99759.

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini44 – 12380OPRAdd
    BLAST
    Domaini362 – 622261Protein kinasePROSITE-ProRule annotationAdd
    BLAST

    Sequence similaritiesi

    Contains 1 OPR domain.Curated
    Contains 1 protein kinase domain.PROSITE-ProRule annotation

    Phylogenomic databases

    eggNOGiCOG0515.
    HOGENOMiHOG000049130.
    HOVERGENiHBG006303.
    KOiK04421.
    OMAiQALHSIM.
    OrthoDBiEOG747PHJ.
    PhylomeDBiQ99759.
    TreeFamiTF105113.

    Family and domain databases

    InterProiIPR011009. Kinase-like_dom.
    IPR000270. OPR_PB1.
    IPR000719. Prot_kinase_dom.
    IPR002290. Ser/Thr_dual-sp_kinase_dom.
    [Graphical view]
    PfamiPF00564. PB1. 1 hit.
    PF00069. Pkinase. 1 hit.
    [Graphical view]
    SMARTiSM00666. PB1. 1 hit.
    SM00220. S_TKc. 1 hit.
    [Graphical view]
    SUPFAMiSSF56112. SSF56112. 1 hit.
    PROSITEiPS50011. PROTEIN_KINASE_DOM. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q99759-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MDEQEALNSI MNDLVALQMN RRHRMPGYET MKNKDTGHSN RQSDVRIKFE    50
    HNGERRIIAF SRPVKYEDVE HKVTTVFGQP LDLHYMNNEL SILLKNQDDL 100
    DKAIDILDRS SSMKSLRILL LSQDRNHNSS SPHSGVSRQV RIKASQSAGD 150
    INTIYQPPEP RSRHLSVSSQ NPGRSSPPPG YVPERQQHIA RQGSYTSINS 200
    EGEFIPETSE QCMLDPLSSA ENSLSGSCQS LDRSADSPSF RKSRMSRAQS 250
    FPDNRQEYSD RETQLYDKGV KGGTYPRRYH VSVHHKDYSD GRRTFPRIRR 300
    HQGNLFTLVP SSRSLSTNGE NMGLAVQYLD PRGRLRSADS ENALSVQERN 350
    VPTKSPSAPI NWRRGKLLGQ GAFGRVYLCY DVDTGRELAS KQVQFDPDSP 400
    ETSKEVSALE CEIQLLKNLQ HERIVQYYGC LRDRAEKTLT IFMEYMPGGS 450
    VKDQLKAYGA LTESVTRKYT RQILEGMSYL HSNMIVHRDI KGANILRDSA 500
    GNVKLGDFGA SKRLQTICMS GTGMRSVTGT PYWMSPEVIS GEGYGRKADV 550
    WSLGCTVVEM LTEKPPWAEY EAMAAIFKIA TQPTNPQLPS HISEHGRDFL 600
    RRIFVEARQR PSAEELLTHH FAQLMY 626
    Length:626
    Mass (Da):70,898
    Last modified:November 13, 2007 - v2
    Checksum:i28129168A57571DD
    GO
    Isoform 2 (identifier: Q99759-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         42-42: Q → QKKHNSSSSALLNSPTVTTSSCAGASEKKKFL

    Show »
    Length:657
    Mass (Da):74,089
    Checksum:iDF37E5E568FE937E
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti135 – 1351G → E in AAB41729. (PubMed:9006902)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti281 – 2811V → M.1 Publication
    Corresponds to variant rs36109904 [ dbSNP | Ensembl ].
    VAR_040685
    Natural varianti325 – 3251A → G.
    Corresponds to variant rs34042309 [ dbSNP | Ensembl ].
    VAR_037275
    Natural varianti435 – 4351A → G.
    Corresponds to variant rs9910858 [ dbSNP | Ensembl ].
    VAR_037276

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei42 – 421Q → QKKHNSSSSALLNSPTVTTS SCAGASEKKKFL in isoform 2. 1 PublicationVSP_035967

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U78876 mRNA. Translation: AAB41729.1.
    AK315305 mRNA. Translation: BAG37709.1.
    AL834303 mRNA. Translation: CAD38973.1.
    AC046185 Genomic DNA. No translation available.
    CH471109 Genomic DNA. Translation: EAW94297.1.
    CH471109 Genomic DNA. Translation: EAW94298.1.
    CH471109 Genomic DNA. Translation: EAW94299.1.
    BC090859 mRNA. Translation: AAH90859.1.
    BC093672 mRNA. Translation: AAH93672.1.
    BC093674 mRNA. Translation: AAH93674.1.
    CCDSiCCDS32701.1. [Q99759-2]
    CCDS32702.1. [Q99759-1]
    RefSeqiNP_002392.2. NM_002401.3. [Q99759-1]
    NP_976226.1. NM_203351.1. [Q99759-2]
    UniGeneiHs.29282.

    Genome annotation databases

    EnsembliENST00000361357; ENSP00000354927; ENSG00000198909. [Q99759-2]
    ENST00000361733; ENSP00000354485; ENSG00000198909. [Q99759-1]
    ENST00000579585; ENSP00000461988; ENSG00000198909. [Q99759-2]
    GeneIDi4215.
    KEGGihsa:4215.
    UCSCiuc002jbe.3. human. [Q99759-2]
    uc002jbg.3. human. [Q99759-1]

    Polymorphism databases

    DMDMi160332306.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U78876 mRNA. Translation: AAB41729.1 .
    AK315305 mRNA. Translation: BAG37709.1 .
    AL834303 mRNA. Translation: CAD38973.1 .
    AC046185 Genomic DNA. No translation available.
    CH471109 Genomic DNA. Translation: EAW94297.1 .
    CH471109 Genomic DNA. Translation: EAW94298.1 .
    CH471109 Genomic DNA. Translation: EAW94299.1 .
    BC090859 mRNA. Translation: AAH90859.1 .
    BC093672 mRNA. Translation: AAH93672.1 .
    BC093674 mRNA. Translation: AAH93674.1 .
    CCDSi CCDS32701.1. [Q99759-2 ]
    CCDS32702.1. [Q99759-1 ]
    RefSeqi NP_002392.2. NM_002401.3. [Q99759-1 ]
    NP_976226.1. NM_203351.1. [Q99759-2 ]
    UniGenei Hs.29282.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    2C60 X-ray 1.25 A 37-124 [» ]
    2JRH NMR - A 42-126 [» ]
    2O2V X-ray 1.83 B 37-124 [» ]
    2PPH NMR - A 42-126 [» ]
    ProteinModelPortali Q99759.
    SMRi Q99759. Positions 43-122, 325-624.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 110379. 33 interactions.
    DIPi DIP-27521N.
    IntActi Q99759. 30 interactions.
    MINTi MINT-272157.
    STRINGi 9606.ENSP00000354927.

    Chemistry

    BindingDBi Q99759.
    ChEMBLi CHEMBL5970.
    GuidetoPHARMACOLOGYi 2078.

    PTM databases

    PhosphoSitei Q99759.

    Polymorphism databases

    DMDMi 160332306.

    Proteomic databases

    MaxQBi Q99759.
    PaxDbi Q99759.
    PRIDEi Q99759.

    Protocols and materials databases

    DNASUi 4215.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000361357 ; ENSP00000354927 ; ENSG00000198909 . [Q99759-2 ]
    ENST00000361733 ; ENSP00000354485 ; ENSG00000198909 . [Q99759-1 ]
    ENST00000579585 ; ENSP00000461988 ; ENSG00000198909 . [Q99759-2 ]
    GeneIDi 4215.
    KEGGi hsa:4215.
    UCSCi uc002jbe.3. human. [Q99759-2 ]
    uc002jbg.3. human. [Q99759-1 ]

    Organism-specific databases

    CTDi 4215.
    GeneCardsi GC17P061699.
    HGNCi HGNC:6855. MAP3K3.
    HPAi CAB007764.
    HPA035410.
    HPA035411.
    MIMi 602539. gene.
    neXtProti NX_Q99759.
    PharmGKBi PA30599.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG0515.
    HOGENOMi HOG000049130.
    HOVERGENi HBG006303.
    KOi K04421.
    OMAi QALHSIM.
    OrthoDBi EOG747PHJ.
    PhylomeDBi Q99759.
    TreeFami TF105113.

    Enzyme and pathway databases

    BRENDAi 2.7.12.2. 2681.
    Reactomei REACT_22442. Interleukin-1 signaling.
    SignaLinki Q99759.

    Miscellaneous databases

    ChiTaRSi MAP3K3. human.
    EvolutionaryTracei Q99759.
    GeneWikii MAP3K3.
    GenomeRNAii 4215.
    NextBioi 16621.
    PROi Q99759.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q99759.
    Bgeei Q99759.
    CleanExi HS_MAP3K3.
    Genevestigatori Q99759.

    Family and domain databases

    InterProi IPR011009. Kinase-like_dom.
    IPR000270. OPR_PB1.
    IPR000719. Prot_kinase_dom.
    IPR002290. Ser/Thr_dual-sp_kinase_dom.
    [Graphical view ]
    Pfami PF00564. PB1. 1 hit.
    PF00069. Pkinase. 1 hit.
    [Graphical view ]
    SMARTi SM00666. PB1. 1 hit.
    SM00220. S_TKc. 1 hit.
    [Graphical view ]
    SUPFAMi SSF56112. SSF56112. 1 hit.
    PROSITEi PS50011. PROTEIN_KINASE_DOM. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Direct activation of the stress-activated protein kinase (SAPK) and extracellular signal-regulated protein kinase (ERK) pathways by an inducible mitogen-activated protein kinase/ERK kinase kinase 3 (MEKK) derivative."
      Ellinger-Ziegelbauer H.C., Brown K., Kelly K., Siebenlist U.
      J. Biol. Chem. 272:2668-2674(1997) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION.
    2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Placenta.
    3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Melanoma.
    4. "DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage."
      Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L.
      , Chen C.-K., Cook A., Corum B., Cuomo C.A., de Jong P.J., DeCaprio D., Dewar K., FitzGerald M., Gilbert J., Gibson R., Gnerre S., Goldstein S., Grafham D.V., Grocock R., Hafez N., Hagopian D.S., Hart E., Norman C.H., Humphray S., Jaffe D.B., Jones M., Kamal M., Khodiyar V.K., LaButti K., Laird G., Lehoczky J., Liu X., Lokyitsang T., Loveland J., Lui A., Macdonald P., Major J.E., Matthews L., Mauceli E., McCarroll S.A., Mihalev A.H., Mudge J., Nguyen C., Nicol R., O'Leary S.B., Osoegawa K., Schwartz D.C., Shaw-Smith C., Stankiewicz P., Steward C., Swarbreck D., Venkataraman V., Whittaker C.A., Yang X., Zimmer A.R., Bradley A., Hubbard T., Birren B.W., Rogers J., Lander E.S., Nusbaum C.
      Nature 440:1045-1049(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Brain and PNS.
    7. "Inhibition of mitogen-activated kinase kinase kinase 3 activity through phosphorylation by the serum- and glucocorticoid-induced kinase 1."
      Chun J., Kwon T., Kim D.J., Park I., Chung G., Lee E.J., Hong S.K., Chang S.I., Kim H.Y., Kang S.S.
      J. Biochem. 133:103-108(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION AT SER-166 AND SER-337 BY SGK1.
    8. "PB1 domains of MEKK2 and MEKK3 interact with the MEK5 PB1 domain for activation of the ERK5 pathway."
      Nakamura K., Johnson G.L.
      J. Biol. Chem. 278:36989-36992(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, INTERACTION WITH MAP2K5.
    9. "Differential regulation of interleukin 1 receptor and Toll-like receptor signaling by MEKK3."
      Huang Q., Yang J., Lin Y., Walker C., Cheng J., Liu Z.G., Su B.
      Nat. Immunol. 5:98-103(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, INTERACTION WITH TRAF6.
    10. Cited for: FUNCTION, INTERACTION WITH TRAF7.
    11. "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle."
      Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M.
      Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-250; SER-337 AND SER-340, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    12. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-250; SER-337 AND SER-340, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    13. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
      Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
      Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-337 AND SER-340, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Leukemic T-cell.
    14. "Patterns of somatic mutation in human cancer genomes."
      Greenman C., Stephens P., Smith R., Dalgliesh G.L., Hunter C., Bignell G., Davies H., Teague J., Butler A., Stevens C., Edkins S., O'Meara S., Vastrik I., Schmidt E.E., Avis T., Barthorpe S., Bhamra G., Buck G.
      , Choudhury B., Clements J., Cole J., Dicks E., Forbes S., Gray K., Halliday K., Harrison R., Hills K., Hinton J., Jenkinson A., Jones D., Menzies A., Mironenko T., Perry J., Raine K., Richardson D., Shepherd R., Small A., Tofts C., Varian J., Webb T., West S., Widaa S., Yates A., Cahill D.P., Louis D.N., Goldstraw P., Nicholson A.G., Brasseur F., Looijenga L., Weber B.L., Chiew Y.-E., DeFazio A., Greaves M.F., Green A.R., Campbell P., Birney E., Easton D.F., Chenevix-Trench G., Tan M.-H., Khoo S.K., Teh B.T., Yuen S.T., Leung S.Y., Wooster R., Futreal P.A., Stratton M.R.
      Nature 446:153-158(2007) [PubMed] [Europe PMC] [Abstract]
      Cited for: VARIANT [LARGE SCALE ANALYSIS] MET-281.

    Entry informationi

    Entry nameiM3K3_HUMAN
    AccessioniPrimary (citable) accession number: Q99759
    Secondary accession number(s): B2RCW2
    , D3DU15, Q5BKZ6, Q8N3I9
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: November 1, 1997
    Last sequence update: November 13, 2007
    Last modified: October 1, 2014
    This is version 156 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. Human chromosome 17
      Human chromosome 17: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    6. Human and mouse protein kinases
      Human and mouse protein kinases: classification and index
    7. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3