SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q99759

- M3K3_HUMAN

UniProt

Q99759 - M3K3_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Mitogen-activated protein kinase kinase kinase 3
Gene
MAP3K3, MAPKKK3, MEKK3
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Component of a protein kinase signal transduction cascade. Mediates activation of the NF-kappa-B, AP1 and DDIT3 transcriptional regulators.4 Publications

Catalytic activityi

ATP + a protein = ADP + a phosphoprotein.

Cofactori

Magnesium.

Enzyme regulationi

Activated by phosphorylation on Thr-530 By similarity.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Binding sitei391 – 3911ATP By similarity
Active sitei489 – 4891Proton acceptor By similarity

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi368 – 3769ATP By similarity

GO - Molecular functioni

  1. ATP binding Source: UniProtKB-KW
  2. MAP kinase kinase kinase activity Source: ProtInc
  3. metal ion binding Source: UniProtKB-KW
  4. protein binding Source: IntAct
  5. protein kinase activity Source: MGI
Complete GO annotation...

GO - Biological processi

  1. MAPK cascade Source: ProtInc
  2. activation of MAPKK activity Source: GOC
  3. intracellular signal transduction Source: MGI
  4. positive regulation of I-kappaB kinase/NF-kappaB signaling Source: UniProtKB
  5. protein autophosphorylation Source: MGI
Complete GO annotation...

Keywords - Molecular functioni

Kinase, Serine/threonine-protein kinase, Transferase

Keywords - Ligandi

ATP-binding, Magnesium, Metal-binding, Nucleotide-binding

Enzyme and pathway databases

BRENDAi2.7.12.2. 2681.
ReactomeiREACT_22442. Interleukin-1 signaling.
SignaLinkiQ99759.

Names & Taxonomyi

Protein namesi
Recommended name:
Mitogen-activated protein kinase kinase kinase 3 (EC:2.7.11.25)
Alternative name(s):
MAPK/ERK kinase kinase 3
Short name:
MEK kinase 3
Short name:
MEKK 3
Gene namesi
Name:MAP3K3
Synonyms:MAPKKK3, MEKK3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 17

Organism-specific databases

HGNCiHGNC:6855. MAP3K3.

Subcellular locationi

GO - Cellular componenti

  1. cytosol Source: Reactome
Complete GO annotation...

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA30599.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 626626Mitogen-activated protein kinase kinase kinase 3
PRO_0000086245Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei166 – 1661Phosphoserine; by SGK11 Publication
Modified residuei250 – 2501Phosphoserine2 Publications
Modified residuei337 – 3371Phosphoserine; by SGK14 Publications
Modified residuei340 – 3401Phosphoserine3 Publications

Post-translational modificationi

Phosphorylation at Ser-166 and Ser-337 by SGK1 inhibits its activity.

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ99759.
PaxDbiQ99759.
PRIDEiQ99759.

PTM databases

PhosphoSiteiQ99759.

Expressioni

Gene expression databases

ArrayExpressiQ99759.
BgeeiQ99759.
CleanExiHS_MAP3K3.
GenevestigatoriQ99759.

Organism-specific databases

HPAiCAB007764.
HPA035410.
HPA035411.

Interactioni

Subunit structurei

Binds both upstream activators and downstream substrates in multimolecular complexes. Part of a complex with MAP2K3, RAC1 and CCM2. Interacts with MAP2K5 and SPAG9.3 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
TRAF7Q6Q0C02EBI-307281,EBI-307556
YWHABP319462EBI-307281,EBI-359815
YWHAEP622583EBI-307281,EBI-356498

Protein-protein interaction databases

BioGridi110379. 33 interactions.
DIPiDIP-27521N.
IntActiQ99759. 25 interactions.
MINTiMINT-272157.
STRINGi9606.ENSP00000354927.

Structurei

Secondary structure

Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi45 – 517
Beta strandi54 – 607
Helixi66 – 7712
Beta strandi82 – 865
Beta strandi91 – 933
Helixi97 – 10913
Turni111 – 1144
Beta strandi115 – 1217

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2C60X-ray1.25A37-124[»]
2JRHNMR-A42-126[»]
2O2VX-ray1.83B37-124[»]
2PPHNMR-A42-126[»]
ProteinModelPortaliQ99759.
SMRiQ99759. Positions 43-122, 325-624.

Miscellaneous databases

EvolutionaryTraceiQ99759.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini44 – 12380OPR
Add
BLAST
Domaini362 – 622261Protein kinase
Add
BLAST

Sequence similaritiesi

Contains 1 OPR domain.

Phylogenomic databases

eggNOGiCOG0515.
HOGENOMiHOG000049130.
HOVERGENiHBG006303.
KOiK04421.
OMAiQALHSIM.
OrthoDBiEOG747PHJ.
PhylomeDBiQ99759.
TreeFamiTF105113.

Family and domain databases

InterProiIPR011009. Kinase-like_dom.
IPR000270. OPR_PB1.
IPR000719. Prot_kinase_dom.
IPR002290. Ser/Thr_dual-sp_kinase_dom.
[Graphical view]
PfamiPF00564. PB1. 1 hit.
PF00069. Pkinase. 1 hit.
[Graphical view]
SMARTiSM00666. PB1. 1 hit.
SM00220. S_TKc. 1 hit.
[Graphical view]
SUPFAMiSSF56112. SSF56112. 1 hit.
PROSITEiPS50011. PROTEIN_KINASE_DOM. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q99759-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MDEQEALNSI MNDLVALQMN RRHRMPGYET MKNKDTGHSN RQSDVRIKFE    50
HNGERRIIAF SRPVKYEDVE HKVTTVFGQP LDLHYMNNEL SILLKNQDDL 100
DKAIDILDRS SSMKSLRILL LSQDRNHNSS SPHSGVSRQV RIKASQSAGD 150
INTIYQPPEP RSRHLSVSSQ NPGRSSPPPG YVPERQQHIA RQGSYTSINS 200
EGEFIPETSE QCMLDPLSSA ENSLSGSCQS LDRSADSPSF RKSRMSRAQS 250
FPDNRQEYSD RETQLYDKGV KGGTYPRRYH VSVHHKDYSD GRRTFPRIRR 300
HQGNLFTLVP SSRSLSTNGE NMGLAVQYLD PRGRLRSADS ENALSVQERN 350
VPTKSPSAPI NWRRGKLLGQ GAFGRVYLCY DVDTGRELAS KQVQFDPDSP 400
ETSKEVSALE CEIQLLKNLQ HERIVQYYGC LRDRAEKTLT IFMEYMPGGS 450
VKDQLKAYGA LTESVTRKYT RQILEGMSYL HSNMIVHRDI KGANILRDSA 500
GNVKLGDFGA SKRLQTICMS GTGMRSVTGT PYWMSPEVIS GEGYGRKADV 550
WSLGCTVVEM LTEKPPWAEY EAMAAIFKIA TQPTNPQLPS HISEHGRDFL 600
RRIFVEARQR PSAEELLTHH FAQLMY 626
Length:626
Mass (Da):70,898
Last modified:November 13, 2007 - v2
Checksum:i28129168A57571DD
GO
Isoform 2 (identifier: Q99759-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     42-42: Q → QKKHNSSSSALLNSPTVTTSSCAGASEKKKFL

Show »
Length:657
Mass (Da):74,089
Checksum:iDF37E5E568FE937E
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti281 – 2811V → M.1 Publication
Corresponds to variant rs36109904 [ dbSNP | Ensembl ].
VAR_040685
Natural varianti325 – 3251A → G.
Corresponds to variant rs34042309 [ dbSNP | Ensembl ].
VAR_037275
Natural varianti435 – 4351A → G.
Corresponds to variant rs9910858 [ dbSNP | Ensembl ].
VAR_037276

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei42 – 421Q → QKKHNSSSSALLNSPTVTTS SCAGASEKKKFL in isoform 2.
VSP_035967

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti135 – 1351G → E in AAB41729. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U78876 mRNA. Translation: AAB41729.1.
AK315305 mRNA. Translation: BAG37709.1.
AL834303 mRNA. Translation: CAD38973.1.
AC046185 Genomic DNA. No translation available.
CH471109 Genomic DNA. Translation: EAW94297.1.
CH471109 Genomic DNA. Translation: EAW94298.1.
CH471109 Genomic DNA. Translation: EAW94299.1.
BC090859 mRNA. Translation: AAH90859.1.
BC093672 mRNA. Translation: AAH93672.1.
BC093674 mRNA. Translation: AAH93674.1.
CCDSiCCDS32701.1. [Q99759-2]
CCDS32702.1. [Q99759-1]
RefSeqiNP_002392.2. NM_002401.3. [Q99759-1]
NP_976226.1. NM_203351.1. [Q99759-2]
UniGeneiHs.29282.

Genome annotation databases

EnsembliENST00000361357; ENSP00000354927; ENSG00000198909. [Q99759-2]
ENST00000361733; ENSP00000354485; ENSG00000198909. [Q99759-1]
ENST00000579585; ENSP00000461988; ENSG00000198909. [Q99759-2]
GeneIDi4215.
KEGGihsa:4215.
UCSCiuc002jbe.3. human. [Q99759-2]
uc002jbg.3. human. [Q99759-1]

Polymorphism databases

DMDMi160332306.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U78876 mRNA. Translation: AAB41729.1 .
AK315305 mRNA. Translation: BAG37709.1 .
AL834303 mRNA. Translation: CAD38973.1 .
AC046185 Genomic DNA. No translation available.
CH471109 Genomic DNA. Translation: EAW94297.1 .
CH471109 Genomic DNA. Translation: EAW94298.1 .
CH471109 Genomic DNA. Translation: EAW94299.1 .
BC090859 mRNA. Translation: AAH90859.1 .
BC093672 mRNA. Translation: AAH93672.1 .
BC093674 mRNA. Translation: AAH93674.1 .
CCDSi CCDS32701.1. [Q99759-2 ]
CCDS32702.1. [Q99759-1 ]
RefSeqi NP_002392.2. NM_002401.3. [Q99759-1 ]
NP_976226.1. NM_203351.1. [Q99759-2 ]
UniGenei Hs.29282.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
2C60 X-ray 1.25 A 37-124 [» ]
2JRH NMR - A 42-126 [» ]
2O2V X-ray 1.83 B 37-124 [» ]
2PPH NMR - A 42-126 [» ]
ProteinModelPortali Q99759.
SMRi Q99759. Positions 43-122, 325-624.
ModBasei Search...

Protein-protein interaction databases

BioGridi 110379. 33 interactions.
DIPi DIP-27521N.
IntActi Q99759. 25 interactions.
MINTi MINT-272157.
STRINGi 9606.ENSP00000354927.

Chemistry

BindingDBi Q99759.
ChEMBLi CHEMBL5970.
GuidetoPHARMACOLOGYi 2078.

PTM databases

PhosphoSitei Q99759.

Polymorphism databases

DMDMi 160332306.

Proteomic databases

MaxQBi Q99759.
PaxDbi Q99759.
PRIDEi Q99759.

Protocols and materials databases

DNASUi 4215.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000361357 ; ENSP00000354927 ; ENSG00000198909 . [Q99759-2 ]
ENST00000361733 ; ENSP00000354485 ; ENSG00000198909 . [Q99759-1 ]
ENST00000579585 ; ENSP00000461988 ; ENSG00000198909 . [Q99759-2 ]
GeneIDi 4215.
KEGGi hsa:4215.
UCSCi uc002jbe.3. human. [Q99759-2 ]
uc002jbg.3. human. [Q99759-1 ]

Organism-specific databases

CTDi 4215.
GeneCardsi GC17P061699.
HGNCi HGNC:6855. MAP3K3.
HPAi CAB007764.
HPA035410.
HPA035411.
MIMi 602539. gene.
neXtProti NX_Q99759.
PharmGKBi PA30599.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG0515.
HOGENOMi HOG000049130.
HOVERGENi HBG006303.
KOi K04421.
OMAi QALHSIM.
OrthoDBi EOG747PHJ.
PhylomeDBi Q99759.
TreeFami TF105113.

Enzyme and pathway databases

BRENDAi 2.7.12.2. 2681.
Reactomei REACT_22442. Interleukin-1 signaling.
SignaLinki Q99759.

Miscellaneous databases

ChiTaRSi MAP3K3. human.
EvolutionaryTracei Q99759.
GeneWikii MAP3K3.
GenomeRNAii 4215.
NextBioi 16621.
PROi Q99759.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q99759.
Bgeei Q99759.
CleanExi HS_MAP3K3.
Genevestigatori Q99759.

Family and domain databases

InterProi IPR011009. Kinase-like_dom.
IPR000270. OPR_PB1.
IPR000719. Prot_kinase_dom.
IPR002290. Ser/Thr_dual-sp_kinase_dom.
[Graphical view ]
Pfami PF00564. PB1. 1 hit.
PF00069. Pkinase. 1 hit.
[Graphical view ]
SMARTi SM00666. PB1. 1 hit.
SM00220. S_TKc. 1 hit.
[Graphical view ]
SUPFAMi SSF56112. SSF56112. 1 hit.
PROSITEi PS50011. PROTEIN_KINASE_DOM. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Direct activation of the stress-activated protein kinase (SAPK) and extracellular signal-regulated protein kinase (ERK) pathways by an inducible mitogen-activated protein kinase/ERK kinase kinase 3 (MEKK) derivative."
    Ellinger-Ziegelbauer H.C., Brown K., Kelly K., Siebenlist U.
    J. Biol. Chem. 272:2668-2674(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Placenta.
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Melanoma.
  4. "DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage."
    Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L.
    , Chen C.-K., Cook A., Corum B., Cuomo C.A., de Jong P.J., DeCaprio D., Dewar K., FitzGerald M., Gilbert J., Gibson R., Gnerre S., Goldstein S., Grafham D.V., Grocock R., Hafez N., Hagopian D.S., Hart E., Norman C.H., Humphray S., Jaffe D.B., Jones M., Kamal M., Khodiyar V.K., LaButti K., Laird G., Lehoczky J., Liu X., Lokyitsang T., Loveland J., Lui A., Macdonald P., Major J.E., Matthews L., Mauceli E., McCarroll S.A., Mihalev A.H., Mudge J., Nguyen C., Nicol R., O'Leary S.B., Osoegawa K., Schwartz D.C., Shaw-Smith C., Stankiewicz P., Steward C., Swarbreck D., Venkataraman V., Whittaker C.A., Yang X., Zimmer A.R., Bradley A., Hubbard T., Birren B.W., Rogers J., Lander E.S., Nusbaum C.
    Nature 440:1045-1049(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Brain and PNS.
  7. "Inhibition of mitogen-activated kinase kinase kinase 3 activity through phosphorylation by the serum- and glucocorticoid-induced kinase 1."
    Chun J., Kwon T., Kim D.J., Park I., Chung G., Lee E.J., Hong S.K., Chang S.I., Kim H.Y., Kang S.S.
    J. Biochem. 133:103-108(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION AT SER-166 AND SER-337 BY SGK1.
  8. "PB1 domains of MEKK2 and MEKK3 interact with the MEK5 PB1 domain for activation of the ERK5 pathway."
    Nakamura K., Johnson G.L.
    J. Biol. Chem. 278:36989-36992(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, INTERACTION WITH MAP2K5.
  9. "Differential regulation of interleukin 1 receptor and Toll-like receptor signaling by MEKK3."
    Huang Q., Yang J., Lin Y., Walker C., Cheng J., Liu Z.G., Su B.
    Nat. Immunol. 5:98-103(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, INTERACTION WITH TRAF6.
  10. Cited for: FUNCTION, INTERACTION WITH TRAF7.
  11. "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle."
    Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M.
    Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-250; SER-337 AND SER-340, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  12. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-250; SER-337 AND SER-340, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  13. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
    Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
    Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-337 AND SER-340, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Leukemic T-cell.
  14. "Patterns of somatic mutation in human cancer genomes."
    Greenman C., Stephens P., Smith R., Dalgliesh G.L., Hunter C., Bignell G., Davies H., Teague J., Butler A., Stevens C., Edkins S., O'Meara S., Vastrik I., Schmidt E.E., Avis T., Barthorpe S., Bhamra G., Buck G.
    , Choudhury B., Clements J., Cole J., Dicks E., Forbes S., Gray K., Halliday K., Harrison R., Hills K., Hinton J., Jenkinson A., Jones D., Menzies A., Mironenko T., Perry J., Raine K., Richardson D., Shepherd R., Small A., Tofts C., Varian J., Webb T., West S., Widaa S., Yates A., Cahill D.P., Louis D.N., Goldstraw P., Nicholson A.G., Brasseur F., Looijenga L., Weber B.L., Chiew Y.-E., DeFazio A., Greaves M.F., Green A.R., Campbell P., Birney E., Easton D.F., Chenevix-Trench G., Tan M.-H., Khoo S.K., Teh B.T., Yuen S.T., Leung S.Y., Wooster R., Futreal P.A., Stratton M.R.
    Nature 446:153-158(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANT [LARGE SCALE ANALYSIS] MET-281.

Entry informationi

Entry nameiM3K3_HUMAN
AccessioniPrimary (citable) accession number: Q99759
Secondary accession number(s): B2RCW2
, D3DU15, Q5BKZ6, Q8N3I9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: November 13, 2007
Last modified: September 3, 2014
This is version 155 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. Human and mouse protein kinases
    Human and mouse protein kinases: classification and index
  7. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi