Q99755 (PI51A_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 111.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha Short name=PIP5K1-alpha Short name=PtdIns(4)P-5-kinase 1 alpha EC=2.7.1.68 Alternative name(s): 68 kDa type I phosphatidylinositol 4-phosphate 5-kinase alpha Phosphatidylinositol 4-phosphate 5-kinase type I alpha Short name=PIP5KIalpha | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 562 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Catalyzes the phosphorylation of phosphatidylinositol 4-phosphate (PtdIns4P) to form phosphatidylinositol 4,5-bisphosphate (PtdIns(4,5)P2). PtdIns(4,5)P2 is involved in a variety of cellular processes and is the substrate to form phosphatidylinositol 3,4,5-trisphosphate (PtdIns(3,4,5)P3), another second messenger. The majority of PtdIns(4,5)P2 is thought to occur via type I phosphatidylinositol 4-phosphate 5-kinases given the abundance of PtdIns4P. Participates in a variety of cellular processes such as actin cytoskeleton organization, cell adhesion, migration and phagocytosis. Required for membrane ruffling formation, actin organization and focal adhesion formation during directional cell migration by controlling integrin-induced translocation of RAC1 to the plasma membrane. Together with PIP5K1C is required for phagocytosis, but they regulate different types of actin remodeling at sequential steps. Promotes particle ingestion by activating WAS that induces Arp2/3 dependent actin polymerization at the nascent phagocytic cup. Together with PIP5K1B is required after stimulation of G-protein coupled receptors for stable platelet adhesion. Plays a role during calcium-induced keratinocyte differentiation. Recruited to the plasma membrane by the E-cadherin/beta-catenin complex where it provides the substrate PtdIns(4,5)P2 for the production of PtdIns(3,4,5)P3, diacylglycerol and inositol 1,4,5-trisphosphate that mobilize internal calcium and drive keratinocyte differentiation. Together with PIP5K1C have a role during embryogenesis. Functions also in the nucleus where acts as an activator of TUT1 adenylyltransferase activity in nuclear speckles, thereby regulating mRNA polyadenylation of a select set of mRNAs. Ref.7 Ref.8 Ref.9 |
| Catalytic activity | ATP + 1-phosphatidyl-1D-myo-inositol 4-phosphate = ADP + 1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate. |
| Subunit structure | Interacts with RAC1 By similarity. Interacts with TUT1. Forms a complex with CDH1/E-cadherin, CTNNB1/beta-catenin and CTNND1 at the plasma membrane upon calcium stimulation. Ref.7 Ref.8 |
| Subcellular location | Cell membrane. Cytoplasm By similarity. Nucleus speckle. Cell projection › ruffle. Note: Colocalizes with RAC1 at actin-rich membrane ruffles. Localizes to nuclear speckles and associates with TUT1 to regulate polyadenylation of selected mRNAs. Ref.8 Ref.9 |
| Tissue specificity | Highly expressed in heart, placenta, skeletal muscle, kidney and pancreas. Detected at lower levels in brain, lung and liver. |
| Sequence similarities | Contains 1 PIPK domain. |
| Caution | There is confusion in the literature with phosphatidylinositol 4-phosphate 5-kinase type I nomenclature due to the fact that frequently mouse PIP5K1B is named Phosphatidylinositol 4-phosphate 5-kinase type I alpha. |
Ontologies
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q99755-1) Also known as: PIP5KIalpha2; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q99755-2) Also known as: PIP5KIalpha3; The sequence of this isoform differs from the canonical sequence as follows: 30-52: ASGIKRPMASEVLEARQDSYISL → SGIKRPMASE 455-504: LKPSPSKKFRSGSSFSRRAGSSGNSCITYQPSVSGEHKAQVTTKAEVEPG → C | ||||||
| Isoform 3 (identifier: Q99755-3) The sequence of this isoform differs from the canonical sequence as follows: 30-52: ASGIKRPMASEVLEARQDSYISL → SGIKRPMASE | ||||||
| Isoform 4 (identifier: Q99755-4) The sequence of this isoform differs from the canonical sequence as follows: 41-52: Missing. 382-410: HMGGIPARNSKGERLLLYIGIIDILQSYR → Q |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 562 | 562 | Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha | PRO_0000185456 | |||||
Regions | |||||||||
| Domain | 81 – 449 | 369 | PIPK | ||||||
Amino acid modifications | |||||||||
| Cross-link | 103 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) Ref.6 | |||||||
Natural variations | |||||||||
| Alternative sequence | 30 – 52 | 23 | ASGIK…SYISL → SGIKRPMASE in isoform 2 and isoform 3. | VSP_016007 | |||||
| Alternative sequence | 41 – 52 | 12 | Missing in isoform 4. | VSP_041912 | |||||
| Alternative sequence | 382 – 410 | 29 | HMGGI…LQSYR → Q in isoform 4. | VSP_041913 | |||||
| Alternative sequence | 455 – 504 | 50 | LKPSP…EVEPG → C in isoform 2. | VSP_016008 | |||||
Experimental info | |||||||||
| Mutagenesis | 322 | 1 | D → N: Does not affect targeting of RAC1 to the plasma membrane; when associated with Q-440. Ref.9 | ||||||
| Mutagenesis | 440 | 1 | R → Q: Does not affect targeting of RAC1 to the plasma membrane; when associated with N-322. Ref.9 | ||||||
| Sequence conflict | 257 | 1 | K → E in BAG58542. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Type I phosphatidylinositol-4-phosphate 5-kinases are distinct members of this novel lipid kinase family." Loijens J.C., Anderson R.A. J. Biol. Chem. 271:32937-32943(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2 AND 3). Tissue: Fetal brain. |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 4). Tissue: Hippocampus. |
| [3] | "The DNA sequence and biological annotation of human chromosome 1." Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. Bentley D.R.Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Muscle. |
| [6] | "Quantitative analysis of global ubiquitination in HeLa cells by mass spectrometry." Meierhofer D., Wang X., Huang L., Kaiser P. J. Proteome Res. 7:4566-4576(2008) [PubMed] [Europe PMC] [Abstract] Cited for: UBIQUITINATION [LARGE SCALE ANALYSIS] AT LYS-103, MASS SPECTROMETRY. |
| [7] | "A PtdIns4,5P2-regulated nuclear poly(A) polymerase controls expression of select mRNAs." Mellman D.L., Gonzales M.L., Song C., Barlow C.A., Wang P., Kendziorski C., Anderson R.A. Nature 451:1013-1017(2008) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH TUT1. |
| [8] | "Phosphatidylinositol-4-phosphate 5-kinase 1alpha mediates extracellular calcium-induced keratinocyte differentiation." Xie Z., Chang S.M., Pennypacker S.D., Liao E.-Y., Bikle D.D. Mol. Biol. Cell 20:1695-1704(2009) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION IN KERATINOCYTE DIFFERENTIATION, SUBCELLULAR LOCATION, IDENTIFICATION IN A COMPLEX WITH CDH1; CTNNB1 AND CTNND1. |
| [9] | "Type I PIPK-alpha regulates directed cell migration by modulating Rac1 plasma membrane targeting and activation." Chao W.-T., Daquinag A.C., Ashcroft F., Kunz J. J. Cell Biol. 190:247-262(2010) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION IN CELL MIGRATION, SUBCELLULAR LOCATION, MUTAGENESIS OF ASP-322 AND ARG-440. |
| [10] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | U78575 mRNA. Translation: AAC50910.1. U78576 mRNA. Translation: AAC50911.1. U78577 mRNA. Translation: AAC50912.1. AK291015 mRNA. Translation: BAF83704.1. AK295691 mRNA. Translation: BAG58542.1. AL592424 Genomic DNA. Translation: CAI16386.1. AL592424 Genomic DNA. Translation: CAI16387.1. AL592424 Genomic DNA. Translation: CAI16388.1. CH471121 Genomic DNA. Translation: EAW53461.1. BC007833 mRNA. Translation: AAH07833.1. |
| IPI | IPI00022149. IPI00022150. IPI00163602. |
| RefSeq | NP_001129108.1. NM_001135636.1. NP_001129109.1. NM_001135637.1. NP_001129110.1. NM_001135638.1. NP_003548.1. NM_003557.2. |
| UniGene | Hs.655131. Hs.661888. |
3D structure databases | |
| ProteinModelPortal | Q99755. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q99755. 2 interactions. |
| MINT | MINT-1406942. |
| STRING | 9606.ENSP00000357883. |
PTM databases | |
| PhosphoSite | Q99755. |
Polymorphism databases | |
| DMDM | 74752158. |
Proteomic databases | |
| PaxDb | Q99755. |
| PRIDE | Q99755. |
Protocols and materials databases | |
| DNASU | 8394. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000349792; ENSP00000271663; ENSG00000143398. ENST00000368888; ENSP00000357883; ENSG00000143398. ENST00000368890; ENSP00000357885; ENSG00000143398. ENST00000441902; ENSP00000415648; ENSG00000143398. |
| GeneID | 8394. |
| KEGG | hsa:8394. |
| UCSC | uc001exi.3. human. uc001exj.3. human. uc001exk.3. human. |
Organism-specific databases | |
| CTD | 8394. |
| GeneCards | GC01P151170. |
| HGNC | HGNC:8994. PIP5K1A. |
| HPA | HPA029366. |
| MIM | 603275. gene. |
| neXtProt | NX_Q99755. |
| PharmGKB | PA33327. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG5148. |
| HOGENOM | HOG000193876. |
| HOVERGEN | HBG052818. |
| InParanoid | Q99755. |
| KO | K00889. |
| OMA | RSVKMHM. |
Enzyme and pathway databases | |
| BioCyc | MetaCyc:HS07047-MONOMER. |
| BRENDA | 2.7.1.68. 2681. |
| Pathway_Interaction_DB | arf6downstreampathway. Arf6 downstream pathway. avb3_opn_pathway. Osteopontin-mediated events. |
| Reactome | REACT_111217. Metabolism. |
Gene expression databases | |
| ArrayExpress | Q99755. |
| Bgee | Q99755. |
| CleanEx | HS_PIP5K1A. |
| Genevestigator | Q99755. |
| GermOnline | ENSG00000143398. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR023610. PInositol-4-P-5-kinase. IPR002498. PInositol-4-P-5-kinase_core. IPR016034. PInositol-4P-5-kinase_core_sub. [Graphical view] |
| PANTHER | PTHR23086. PTHR23086. 1 hit. |
| Pfam | PF01504. PIP5K. 1 hit. [Graphical view] |
| SMART | SM00330. PIPKc. 1 hit. [Graphical view] |
| PROSITE | PS51455. PIPK. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| BindingDB | Q99755. |
| ChEMBL | CHEMBL5969. |
| ChiTaRS | PIP5K1A. human. |
| GenomeRNAi | 8394. |
| NextBio | 31416. |
| PMAP-CutDB | Q99755. |
| SOURCE | Search... |
Entry information
| Entry name | PI51A_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q99755 Secondary accession number(s): A8K4Q0 Q99756 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 1 Human chromosome 1: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
