Reviewed,
UniProtKB/Swiss-Prot Q99732 (LITAF_HUMAN)
Last modified
June 16, 2009.
Version 75.
History...
Clusters with 100%,
90%,
50% identity |
Documents (4) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Lipopolysaccharide-induced tumor necrosis factor-alpha factor Short name=LPS-induced TNF-alpha factor Alternative name(s): p53-induced gene 7 protein Small integral membrane protein of lysosome/late endosome | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 161 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Probable role in regulating transcription of specific genes. May regulate through NFKB1 the expression of the CCL2/MCP-1 chemokine. May play a role in tumor necrosis factor alpha (TNF-alpha) gene expression. |
| Subunit structure | Interacts with NEDD4 By similarity. Interacts with WWOX. Isoform 2 may interact with STAT6. |
| Subcellular location | Lysosome membrane; Peripheral membrane protein; Cytoplasmic side. Note: Associated with membranes of lysosomes. Ref.3 |
| Tissue specificity | Ubiquitously and abundantly expressed. Expressed predominantly in the placenta, peripheral blood leukocytes, lymph nodes and spleen. Ref.3 Ref.2 |
| Induction | By lipopolysaccharides (LPS) or TP53/p53. In monocytes by the Bacillus Calmette-Guerin (BCG). Ref.3 Ref.2 Ref.1 |
| Domain | The WW-binding motif mediates interaction with WWOX and, probably NEDD4. Ref.6 |
| Involvement in disease | Defects in LITAF are the cause of Charcot-Marie-Tooth disease type 1C (CMT1C) [MIM:601098]. CMT1C is a form of Charcot-Marie-Tooth disease, the most common inherited disorder of the peripheral nervous system. Charcot-Marie-Tooth disease is classified in two main groups on the basis of electrophysiologic properties and histopathology: primary peripheral demyelinating neuropathy or CMT1, and primary peripheral axonal neuropathy or CMT2. Neuropathies of the CMT1 group are characterized by severely reduced nerve conduction velocities (less than 38 m/sec), segmental demyelination and remyelination with onion bulb formations on nerve biopsy, slowly progressive distal muscle atrophy and weakness, absent deep tendon reflexes, and hollow feet. Ref.8 Ref.10 Ref.11 Defects in LITAF may be involved in extramammary Paget disease (EMPD) carcinogenesis. EMPD is a cancerous disease representing about 8% of all malignant skin cancers; it usually appears in the anogenital area and can be fatal by metastasizing to internal organs when left untreated for a long time. The clinical features are usually those of eczematous eruptions with weeping and crust formation. Ref.9 |
Ontologies
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | |||||||||
| Isoform 1 (identifier: Q99732-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | |||||||||
| Isoform 2 (identifier: Q99732-2) The sequence of this isoform differs from the canonical sequence as follows: 127-161: CIAGCCFIPFCVDALQDVDHYCPNCRALLGTYKRL → VHSGLLLHPL...TPEIAAWSRA | |||||||||
| Note: May be due to a frameshift that creates an unconventional splicing site. Data inferred from this isoform must be interpreted with caution. | |||||||||
Sequence annotation (Features) | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
| Natural variant | 174 | 1 | A → S Found as a somatic mutation in a EMPD primary tumor. | ||||||
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 161 | 161 | Lipopolysaccharide-induced tumor necrosis factor-alpha factor | PRO_0000084440 | |||||
Regions | |||||||||
| Motif | 20 – 23 | 4 | WW-binding | ||||||
Natural variations | |||||||||
| Alternative sequence | 127 – 161 | 35 | CIAGC…TYKRL → VHSGLLLHPLLRGCPAGRGP LLSQLQSSPGHLQAFVGLSQ TWREPGAAGSPFHLSSSFTP GGGSALVVSPLQGAHLHVFF WGEYVAKLTNLQTPEIAAWS RA in isoform 2. | VSP_016461 | |||||
| Natural variant | 23 | 1 | Y → H in one EMPD primary tumor; somatic mutation. Ref.9 | VAR_024014 | |||||
| Natural variant | 49 | 1 | T → M in CMT1C. Ref.11 | VAR_024015 | |||||
| Natural variant | 92 | 1 | I → V: dbSNP rs4280262. Ref.10 Ref.11 | VAR_024016 | |||||
| Natural variant | 112 | 1 | G → S in CMT1C. Ref.8 Ref.10 Ref.11 | VAR_024017 | |||||
| Natural variant | 115 | 1 | T → N in CMT1C. Ref.8 | VAR_024018 | |||||
| Natural variant | 116 | 1 | W → G in CMT1C. Ref.8 | VAR_024019 | |||||
| Natural variant | 122 | 1 | L → V in CMT1C. Ref.11 | VAR_024020 | |||||
Experimental info | |||||||||
| Mutagenesis | 23 | 1 | Y → A: Abolishes interactions with WWOX. Ref.6 | ||||||
| Mutagenesis | 61 | 1 | Y → A: No effect on interaction with WWOX. Ref.6 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "A model for p53-induced apoptosis." Polyak K., Xia Y., Zweier J.L., Kinzler K.W., Vogelstein B. Nature 389:300-306(1997) [PubMed: 9305847] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), INDUCTION BY TP53. Tissue: Colon cancer. |
| [2] | "A novel lipopolysaccharide-induced transcription factor regulating tumor necrosis factor alpha gene expression: molecular cloning, sequencing, characterization, and chromosomal assignment." Myokai F., Takashiba S., Lebo R., Amar S. Proc. Natl. Acad. Sci. U.S.A. 96:4518-4523(1999) [PubMed: 10200294] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), INDUCTION, TISSUE SPECIFICITY. Tissue: Monocyte. |
| [3] | "Mycobacterium bovis Bacillus Calmette-Guerin and its cell wall complex induce a novel lysosomal membrane protein, SIMPLE, that bridges the missing link between lipopolysaccharide and p53-inducible gene, LITAF(PIG7), and estrogen-inducible gene, EET-1." Moriwaki Y., Begum N.A., Kobayashi M., Matsumoto M., Toyoshima K., Seya T. J. Biol. Chem. 276:23065-23076(2001) [PubMed: 11274176] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY, INDUCTION, SUBCELLULAR LOCATION. Tissue: Monocyte. |
| [4] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Blocker H., Heubner D., Hoerlein A., Michel G., Wedler H., Kohrer K., Ottenwalder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed: 17974005] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Oesophageal carcinoma. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Kidney, Pancreas, PNS and Skin. |
| [6] | "WWOX binds the specific proline-rich ligand PPXY: identification of candidate interacting proteins." Ludes-Meyers J.H., Kil H., Bednarek A.K., Drake J., Bedford M.T., Aldaz C.M. Oncogene 23:5049-5055(2004) [PubMed: 15064722] [Abstract] Cited for: INTERACTION WITH WWOX, DOMAIN, MUTAGENESIS OF TYR-23 AND TYR-61. |
| [7] | "LPS induces the interaction of a transcription factor, LPS-induced TNF-alpha factor, and STAT6(B) with effects on multiple cytokines." Tang X., Marciano D.L., Leeman S.E., Amar S. Proc. Natl. Acad. Sci. U.S.A. 102:5132-5137(2005) [PubMed: 15793005] [Abstract] Cited for: INTERACTION WITH STAT6. |
| [8] | "Mutation of a putative protein degradation gene LITAF/SIMPLE in Charcot-Marie-Tooth disease 1C." Street V.A., Bennett C.L., Goldy J.D., Shirk A.J., Kleopa K.A., Tempel B.L., Lipe H.P., Scherer S.S., Bird T.D., Chance P.F. Neurology 60:22-26(2003) [PubMed: 12525712] [Abstract] Cited for: VARIANTS CMT1C SER-112; ASN-115 AND GLY-116. |
| [9] | "PIG7/LITAF gene mutation and overexpression of its gene product in extramammary Paget's disease." Matsumura Y., Matsumura Y., Nishigori C., Horio T., Miyachi Y. Int. J. Cancer 111:218-223(2004) [PubMed: 15197774] [Abstract] Cited for: VARIANT EMPD HIS-23. |
| [10] | "Early onset neuropathy in a compound form of Charcot-Marie-Tooth disease." Meggouh F., de Visser M., Arts W.F.M., De Coo R.I.F.M., van Schaik I.N., Baas F. Ann. Neurol. 57:589-591(2005) [PubMed: 15786462] [Abstract] Cited for: VARIANT CMT1C SER-112, VARIANT VAL-92. |
| [11] | "SIMPLE mutations in Charcot-Marie-Tooth disease and the potential role of its protein product in protein degradation." Saifi G.M., Szigeti K., Wiszniewski W., Shy M.E., Krajewski K., Hausmanowa-Petrusewicz I., Kochanski A., Reeser S., Mancias P., Butler I., Lupski J.R. Hum. Mutat. 25:372-383(2005) [PubMed: 15776429] [Abstract] Cited for: VARIANTS CMT1C MET-49; SER-112 AND VAL-122, VARIANT VAL-92. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| AF010312 mRNA. Translation: AAC39530.1. U77396 mRNA. Translation: AAB36550.1. AB034747 mRNA. Translation: BAB32547.1. BX537543 mRNA. Translation: CAD97778.1. BC000053 mRNA. Translation: AAH00053.1. BC008309 mRNA. Translation: AAH08309.1. BC016491 mRNA. Translation: AAH16491.1. BC039840 mRNA. Translation: AAH39840.1. BC046154 mRNA. Translation: AAH46154.1. BC096063 mRNA. Translation: AAH96063.1. BC096065 mRNA. Translation: AAH96065.1. BC096066 mRNA. Translation: AAH96066.1. BC101401 mRNA. Translation: AAI01402.1. BC101402 mRNA. Translation: AAI01403.1. BC101969 mRNA. Translation: AAI01970.1. | |
| IPI | IPI00017762. IPI00645256. |
| RefSeq | NP_001129944.1. NP_001129945.1. NP_004853.2. |
| UniGene | Hs.459940 |
3D structure databases | |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q99732. 2 interactions. |
PTM databases | |
| PhosphoSite | Q99732. |
Genome annotation databases | |
| Ensembl | ENSG00000189067. Homo sapiens. [Contig view] |
| GeneID | 9516. |
| KEGG | hsa:9516. |
Organism-specific databases | |
| GeneCards | GC16M011549. |
| H-InvDB | HIX0012818. HIX0042981. |
| HGNC | HGNC:16841. LITAF. |
| HPA | HPA006960. |
| MIM | 601098. phenotype. 603795. gene. |
| Orphanet | 65753. Charcot-Marie-Tooth disease, type 1. 101083. Charcot-Marie-Tooth disease, type 1C. |
| PharmGKB | PA134879224. |
| GenAtlas | Search... |
Phylogenomic databases | |
| HOVERGEN | Q99732. |
| OMA | Q99732. HLQAFVG. |
Gene expression databases | |
| ArrayExpress | Q99732. |
| Bgee | Q99732. |
| CleanEx | HS_LITAF. |
| GermOnline | ENSG00000189067. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR006629. LITAF. IPR019584. Znf_LITAF-like. [Graphical view] |
| Pfam | PF10601. zf-LITAF-like. 1 hit. [Graphical view] |
| SMART | SM00714. LITAF. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 35662. |
| SOURCE | Search... |
Entry information
| Entry name | LITAF_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q99732 Secondary accession number(s): Q05DW0, Q9C0L6 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| Human chromosome 16 Human chromosome 16: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |

Clusters with


