Q99732 (LITAF_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 115.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Lipopolysaccharide-induced tumor necrosis factor-alpha factor Short name=LPS-induced TNF-alpha factor Alternative name(s): Small integral membrane protein of lysosome/late endosome p53-induced gene 7 protein | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 161 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Probable role in regulating transcription of specific genes. May regulate through NFKB1 the expression of the CCL2/MCP-1 chemokine. May play a role in tumor necrosis factor alpha (TNF-alpha) gene expression. |
| Subunit structure | Interacts with NEDD4 By similarity. Interacts with WWOX. Isoform 2 may interact with STAT6. Ref.9 Ref.10 |
| Subcellular location | Lysosome membrane; Peripheral membrane protein; Cytoplasmic side. Note: Associated with membranes of lysosomes. Ref.3 |
| Tissue specificity | Ubiquitously and abundantly expressed. Expressed predominantly in the placenta, peripheral blood leukocytes, lymph nodes and spleen. Ref.2 Ref.3 |
| Induction | By bacterial lipopolysaccharides (LPS) or p53/TP53. In monocytes by the Bacillus Calmette-Guerin (BCG). Ref.1 Ref.2 Ref.3 |
| Domain | The WW-binding motif mediates interaction with WWOX and, probably NEDD4. Ref.9 |
| Involvement in disease | Charcot-Marie-Tooth disease 1C (CMT1C) [MIM:601098]: A dominant demyelinating form of Charcot-Marie-Tooth disease, a disorder of the peripheral nervous system, characterized by progressive weakness and atrophy, initially of the peroneal muscles and later of the distal muscles of the arms. Charcot-Marie-Tooth disease is classified in two main groups on the basis of electrophysiologic properties and histopathology: primary peripheral demyelinating neuropathies (designated CMT1 when they are dominantly inherited) and primary peripheral axonal neuropathies (CMT2). Demyelinating neuropathies are characterized by severely reduced nerve conduction velocities (less than 38 m/sec), segmental demyelination and remyelination with onion bulb formations on nerve biopsy, slowly progressive distal muscle atrophy and weakness, absent deep tendon reflexes, and hollow feet. Defects in LITAF may be involved in extramammary Paget disease (EMPD) carcinogenesis. EMPD is a cancerous disease representing about 8% of all malignant skin cancers; it usually appears in the anogenital area and can be fatal by metastasizing to internal organs when left untreated for a long time. The clinical features are usually those of eczematous eruptions with weeping and crust formation. Ref.12 |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| NEDD4 | P46934 | 4 | EBI-725647,EBI-726944 | |
| TSG101 | Q99816 | 3 | EBI-725647,EBI-346882 | |
| WWOX | Q9NZC7 | 5 | EBI-725647,EBI-4320739 |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q99732-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q99732-2) The sequence of this isoform differs from the canonical sequence as follows: 127-161: CIAGCCFIPFCVDALQDVDHYCPNCRALLGTYKRL → VHSGLLLHPL...TPEIAAWSRA | ||||||
| Note: May be due to a frameshift that creates an unconventional splicing site. Data inferred from this isoform must be interpreted with caution. | ||||||
| Isoform 3 (identifier: Q99732-3) The sequence of this isoform differs from the canonical sequence as follows: 127-161: CIAGCCFIPFCVDALQDVDHYCPNCRALLGTYKRL → QECSGTIVALRSFDLLGSCNPPSSAS | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 161 | 161 | Lipopolysaccharide-induced tumor necrosis factor-alpha factor | PRO_0000084440 | |||||
Regions | |||||||||
| Motif | 20 – 23 | 4 | WW-binding | ||||||
Natural variations | |||||||||
| Alternative sequence | 127 – 161 | 35 | CIAGC…TYKRL → VHSGLLLHPLLRGCPAGRGP LLSQLQSSPGHLQAFVGLSQ TWREPGAAGSPFHLSSSFTP GGGSALVVSPLQGAHLHVFF WGEYVAKLTNLQTPEIAAWS RA in isoform 2. | VSP_016461 | |||||
| Alternative sequence | 127 – 161 | 35 | CIAGC…TYKRL → QECSGTIVALRSFDLLGSCN PPSSAS in isoform 3. | VSP_045701 | |||||
| Natural variant | 23 | 1 | Y → H in one EMPD primary tumor; somatic mutation. Ref.12 | VAR_024014 | |||||
| Natural variant | 49 | 1 | T → M in CMT1C. Ref.14 | VAR_024015 | |||||
| Natural variant | 92 | 1 | I → V. Ref.13 Ref.14 Corresponds to variant rs4280262 [ dbSNP | Ensembl ]. | VAR_024016 | |||||
| Natural variant | 112 | 1 | G → S in CMT1C. Ref.11 Ref.13 Ref.14 | VAR_024017 | |||||
| Natural variant | 115 | 1 | T → N in CMT1C. Ref.11 | VAR_024018 | |||||
| Natural variant | 116 | 1 | W → G in CMT1C. Ref.11 | VAR_024019 | |||||
| Natural variant | 122 | 1 | L → V in CMT1C. Ref.14 | VAR_024020 | |||||
| Isoform 2: | |||||||||
| Natural variant | 174 | 1 | A → S Found as a somatic mutation in a EMPD primary tumor. | ||||||
Experimental info | |||||||||
| Mutagenesis | 23 | 1 | Y → A: Abolishes interactions with WWOX. Ref.9 | ||||||
| Mutagenesis | 61 | 1 | Y → A: No effect on interaction with WWOX. Ref.9 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "A model for p53-induced apoptosis." Polyak K., Xia Y., Zweier J.L., Kinzler K.W., Vogelstein B. Nature 389:300-306(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), INDUCTION BY TP53. Tissue: Colon cancer. |
| [2] | "A novel lipopolysaccharide-induced transcription factor regulating tumor necrosis factor alpha gene expression: molecular cloning, sequencing, characterization, and chromosomal assignment." Myokai F., Takashiba S., Lebo R., Amar S. Proc. Natl. Acad. Sci. U.S.A. 96:4518-4523(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), INDUCTION, TISSUE SPECIFICITY. Tissue: Monocyte. |
| [3] | "Mycobacterium bovis Bacillus Calmette-Guerin and its cell wall complex induce a novel lysosomal membrane protein, SIMPLE, that bridges the missing link between lipopolysaccharide and p53-inducible gene, LITAF(PIG7), and estrogen-inducible gene, EET-1." Moriwaki Y., Begum N.A., Kobayashi M., Matsumoto M., Toyoshima K., Seya T. J. Biol. Chem. 276:23065-23076(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY, INDUCTION, SUBCELLULAR LOCATION. Tissue: Monocyte. |
| [4] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3). Tissue: Hair follicle dermal papilla. |
| [5] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Esophageal carcinoma. |
| [6] | "The sequence and analysis of duplication-rich human chromosome 16." Martin J., Han C., Gordon L.A., Terry A., Prabhakar S., She X., Xie G., Hellsten U., Chan Y.M., Altherr M., Couronne O., Aerts A., Bajorek E., Black S., Blumer H., Branscomb E., Brown N.C., Bruno W.J. Pennacchio L.A.Nature 432:988-994(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [8] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Kidney, Pancreas, PNS and Skin. |
| [9] | "WWOX binds the specific proline-rich ligand PPXY: identification of candidate interacting proteins." Ludes-Meyers J.H., Kil H., Bednarek A.K., Drake J., Bedford M.T., Aldaz C.M. Oncogene 23:5049-5055(2004) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH WWOX, DOMAIN, MUTAGENESIS OF TYR-23 AND TYR-61. |
| [10] | "LPS induces the interaction of a transcription factor, LPS-induced TNF-alpha factor, and STAT6(B) with effects on multiple cytokines." Tang X., Marciano D.L., Leeman S.E., Amar S. Proc. Natl. Acad. Sci. U.S.A. 102:5132-5137(2005) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH STAT6. |
| [11] | "Mutation of a putative protein degradation gene LITAF/SIMPLE in Charcot-Marie-Tooth disease 1C." Street V.A., Bennett C.L., Goldy J.D., Shirk A.J., Kleopa K.A., Tempel B.L., Lipe H.P., Scherer S.S., Bird T.D., Chance P.F. Neurology 60:22-26(2003) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS CMT1C SER-112; ASN-115 AND GLY-116. |
| [12] | "PIG7/LITAF gene mutation and overexpression of its gene product in extramammary Paget's disease." Matsumura Y., Matsumura Y., Nishigori C., Horio T., Miyachi Y. Int. J. Cancer 111:218-223(2004) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT EMPD HIS-23. |
| [13] | "Early onset neuropathy in a compound form of Charcot-Marie-Tooth disease." Meggouh F., de Visser M., Arts W.F.M., De Coo R.I.F.M., van Schaik I.N., Baas F. Ann. Neurol. 57:589-591(2005) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT CMT1C SER-112, VARIANT VAL-92. |
| [14] | "SIMPLE mutations in Charcot-Marie-Tooth disease and the potential role of its protein product in protein degradation." Saifi G.M., Szigeti K., Wiszniewski W., Shy M.E., Krajewski K., Hausmanowa-Petrusewicz I., Kochanski A., Reeser S., Mancias P., Butler I., Lupski J.R. Hum. Mutat. 25:372-383(2005) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS CMT1C MET-49; SER-112 AND VAL-122, VARIANT VAL-92. |
| + | Additional computationally mapped references. |
Web resources
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF010312 mRNA. Translation: AAC39530.1. U77396 mRNA. Translation: AAB36550.1. AB034747 mRNA. Translation: BAB32547.1. AK095955 mRNA. No translation available. BX537543 mRNA. Translation: CAD97778.1. AC007616 Genomic DNA. No translation available. AC099489 Genomic DNA. No translation available. CH471112 Genomic DNA. Translation: EAW85150.1. CH471112 Genomic DNA. Translation: EAW85151.1. CH471112 Genomic DNA. Translation: EAW85152.1. CH471112 Genomic DNA. Translation: EAW85153.1. BC000053 mRNA. Translation: AAH00053.1. BC008309 mRNA. Translation: AAH08309.1. BC016491 mRNA. Translation: AAH16491.1. BC039840 mRNA. Translation: AAH39840.1. BC046154 mRNA. Translation: AAH46154.1. BC096063 mRNA. Translation: AAH96063.1. BC096065 mRNA. Translation: AAH96065.1. BC096066 mRNA. Translation: AAH96066.1. BC101401 mRNA. Translation: AAI01402.1. BC101402 mRNA. Translation: AAI01403.1. BC101969 mRNA. Translation: AAI01970.1. |
| IPI | IPI00017762. IPI00645256. |
| RefSeq | NP_001129944.1. NM_001136472.1. NP_001129945.1. NM_001136473.1. NP_004853.2. NM_004862.3. |
| UniGene | Hs.459940. |
3D structure databases | |
| ProteinModelPortal | Q99732. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q99732. 6 interactions. |
| MINT | MINT-1391850. |
| STRING | 9606.ENSP00000340118. |
PTM databases | |
| PhosphoSite | Q99732. |
Polymorphism databases | |
| DMDM | 83304387. |
Proteomic databases | |
| PRIDE | Q99732. |
Protocols and materials databases | |
| DNASU | 9516. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000339430; ENSP00000340118; ENSG00000189067. ENST00000381810; ENSP00000371231; ENSG00000189067. ENST00000413364; ENSP00000397958; ENSG00000189067. ENST00000570904; ENSP00000459138; ENSG00000189067. ENST00000571688; ENSP00000459533; ENSG00000189067. ENST00000574763; ENSP00000461813; ENSG00000189067. ENST00000576036; ENSP00000461667; ENSG00000189067. |
| GeneID | 9516. |
| KEGG | hsa:9516. |
| UCSC | uc002daz.3. human. |
Organism-specific databases | |
| CTD | 9516. |
| GeneCards | GC16M011641. |
| H-InvDB | HIX0134387. |
| HGNC | HGNC:16841. LITAF. |
| HPA | HPA006960. |
| MIM | 601098. phenotype. 603795. gene. |
| neXtProt | NX_Q99732. |
| Orphanet | 101083. Charcot-Marie-Tooth disease type 1C. |
| PharmGKB | PA134879224. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG41852. |
| HOGENOM | HOG000039585. |
| HOVERGEN | HBG006272. |
| PhylomeDB | Q99732. |
Gene expression databases | |
| ArrayExpress | Q99732. |
| Bgee | Q99732. |
| CleanEx | HS_LITAF. |
| Genevestigator | Q99732. |
| GermOnline | ENSG00000189067. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR006629. LITAF. [Graphical view] |
| Pfam | PF10601. zf-LITAF-like. 1 hit. [Graphical view] |
| SMART | SM00714. LITAF. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| BindingDB | Q99732. |
| ChiTaRS | LITAF. human. |
| GenomeRNAi | 9516. |
| NextBio | 35662. |
| SOURCE | Search... |
Entry information
| Entry name | LITAF_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q99732 Secondary accession number(s): D3DUG1 Q9C0L6 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 16 Human chromosome 16: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |

Clusters with
