Q99666 (RGPD5_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 98.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: RANBP2-like and GRIP domain-containing protein 5/6 Alternative name(s): Ran-binding protein 2-like 1/2 Short name=RanBP2-like 1/2 Short name=RanBP2L1 Short name=RanBP2L2 Sperm membrane protein BS-63 | |||||||||
| Gene names |
| |||||||||
| Organism | Homo sapiens (Human) [Reference proteome] | |||||||||
| Taxonomic identifier | 9606 [NCBI] | |||||||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 1765 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Subcellular location | |
| Tissue specificity | Expressed in testis. Ref.1 |
| Miscellaneous | One of the 8 copies of RANBP2 clustered close to the chromosome 2 centromere. |
| Sequence similarities | Contains 1 GRIP domain. Contains 2 RanBD1 domains. Contains 3 TPR repeats. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cytoplasm |
| Coding sequence diversity | Alternative splicing |
| Domain | Repeat TPR repeat |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | protein targeting to Golgi Inferred from electronic annotation. Source: InterPro |
| Cellular_component | cytoplasm Inferred from electronic annotation. Source: UniProtKB-SubCell |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q99666-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q99666-2) The sequence of this isoform differs from the canonical sequence as follows: 868-904: VATTGPSVYYSQSPAYNSQYLLRPAANVTPTKGSSNT → EAAHRHFTIEKHGDSKWIIYRFTKQLCGTERARAKIS 905-1765: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1765 | 1765 | RANBP2-like and GRIP domain-containing protein 5/6 | PRO_0000204915 | |||||
Regions | |||||||||
| Repeat | 26 – 59 | 34 | TPR 1 | ||||||
| Repeat | 60 – 93 | 34 | TPR 2 | ||||||
| Repeat | 648 – 681 | 34 | TPR 3 | ||||||
| Domain | 1036 – 1172 | 137 | RanBD1 1 | ||||||
| Domain | 1333 – 1469 | 137 | RanBD1 2 | ||||||
| Domain | 1702 – 1752 | 51 | GRIP | ||||||
| Compositional bias | 1261 – 1266 | 6 | Poly-Ser | ||||||
Amino acid modifications | |||||||||
| Modified residue | 19 | 1 | Phosphothreonine Ref.8 | ||||||
| Modified residue | 21 | 1 | Phosphoserine Ref.8 | ||||||
Natural variations | |||||||||
| Alternative sequence | 868 – 904 | 37 | VATTG…GSSNT → EAAHRHFTIEKHGDSKWIIY RFTKQLCGTERARAKIS in isoform 2. | VSP_038968 | |||||
| Alternative sequence | 905 – 1765 | 861 | Missing in isoform 2. | VSP_038969 | |||||
Experimental info | |||||||||
| Sequence conflict | 174 | 1 | L → V in AAB41848. Ref.1 | ||||||
| Sequence conflict | 204 | 1 | N → H in AAB41848. Ref.1 | ||||||
| Sequence conflict | 214 | 1 | Y → H in AAB41848. Ref.1 | ||||||
| Sequence conflict | 229 | 1 | Q → R in AAB41848. Ref.1 | ||||||
| Sequence conflict | 257 | 1 | E → G in AAB41848. Ref.1 | ||||||
| Sequence conflict | 270 | 1 | K → E in AAB41848. Ref.1 | ||||||
| Sequence conflict | 451 | 1 | L → S in AAB41848. Ref.1 | ||||||
| Sequence conflict | 736 | 1 | P → S in AAB41848. Ref.1 | ||||||
| Sequence conflict | 784 | 1 | K → R in AAB41848. Ref.1 | ||||||
| Sequence conflict | 893 | 1 | A → G in AAB41848. Ref.1 | ||||||
| Sequence conflict | 905 | 1 | E → D in AAB41848. Ref.1 | ||||||
| Sequence conflict | 946 | 1 | F → L in AAB41848. Ref.1 | ||||||
| Sequence conflict | 1074 | 1 | R → S in AAB41848. Ref.1 | ||||||
| Sequence conflict | 1135 | 1 | D → H in AAB41848. Ref.1 | ||||||
| Sequence conflict | 1612 | 1 | S → P in AAB41848. Ref.1 | ||||||
| Sequence conflict | 1682 | 1 | L → P in AAB41848. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Molecular cloning and characterization of a novel testis-specific nucleoporin-related gene." Wang L.F., Zhu H.D., Miao S.Y., Cao D.F., Wu Y.W., Zong S.D., Koide S.S. Arch. Androl. 42:71-84(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY. Tissue: Testis. |
| [2] | "Towards a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs." Wiemann S., Weil B., Wellenreuther R., Gassenhuber J., Glassl S., Ansorge W., Boecher M., Bloecker H., Bauersachs S., Blum H., Lauber J., Duesterhoeft A., Beyer A., Koehrer K., Strack N., Mewes H.-W., Ottenwaelder B., Obermaier B. Poustka A.Genome Res. 11:422-435(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). |
| [3] | "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. Wilson R.K.Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S., Ohara O., Nagase T., Kikuno R.F. Submitted (MAR-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1009-1765 (ISOFORM 1). Tissue: Brain. |
| [5] | "Complex genomic rearrangements lead to novel primate gene function." Ciccarelli F.D., von Mering C., Suyama M., Harrington E.D., Izaurralde E., Bork P. Genome Res. 15:343-351(2005) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION. |
| [6] | "Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis." Cantin G.T., Yi W., Lu B., Park S.K., Xu T., Lee J.-D., Yates J.R. III J. Proteome Res. 7:1346-1351(2008) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Cervix carcinoma. |
| [7] | "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle." Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M. Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Cervix carcinoma. |
| [8] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-19 AND SER-21, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | U64675 mRNA. Translation: AAB41848.2. AL136868 mRNA. Translation: CAB66802.1. AC013271 Genomic DNA. Translation: AAY14902.1. AC123886 Genomic DNA. Translation: AAY14839.1. AC108938 Genomic DNA. Translation: AAY24132.1. AC109815 Genomic DNA. No translation available. AB209082 mRNA. Translation: BAD92319.1. |
| IPI | IPI00100787. IPI00293568. |
| RefSeq | NP_001032955.1. NM_001037866.1. NP_001116835.1. NM_001123363.3. NP_005045.2. NM_005054.2. NP_115636.1. NM_032260.2. |
| UniGene | Hs.469630. Hs.645445. |
3D structure databases | |
| ProteinModelPortal | Q99666. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q99666. 5 interactions. |
| STRING | 9606.ENSP00000016946. |
PTM databases | |
| PhosphoSite | Q99666. |
Proteomic databases | |
| PaxDb | Q99666. |
| PRIDE | Q99666. |
Protocols and materials databases | |
| DNASU | 729540. 84220. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000016946; ENSP00000016946; ENSG00000015568. ENST00000272454; ENSP00000272454; ENSG00000015568. ENST00000329516; ENSP00000330842; ENSG00000183054. ENST00000330331; ENSP00000330023; ENSG00000183054. ENST00000393283; ENSP00000376962; ENSG00000015568. |
| GeneID | 729540. 84220. |
| KEGG | hsa:729540. hsa:84220. |
| UCSC | uc002tfc.3. human. uc002tfe.1. human. |
Organism-specific databases | |
| CTD | 729540. 84220. |
| GeneCards | GC02M111271. GC02P110550. |
| HGNC | HGNC:32418. RGPD5. HGNC:32419. RGPD6. |
| MIM | 612708. gene. 612709. gene. 612710. gene. |
| neXtProt | NX_Q99666. |
| PharmGKB | PA142671074. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG5171. |
| HOGENOM | HOG000089994. |
| HOVERGEN | HBG108404. |
| InParanoid | Q53T03. |
| OrthoDB | EOG4J3WG2. |
| PhylomeDB | Q99666. |
Gene expression databases | |
| ArrayExpress | Q99666. |
| Bgee | Q99666. |
| CleanEx | HS_RGPD5. HS_RGPD8. |
| Genevestigator | Q99666. |
| GermOnline | ENSG00000015568. Homo sapiens. ENSG00000183054. Homo sapiens. |
Family and domain databases | |
| Gene3D | 1.10.220.60. 1 hit. 1.25.40.10. 2 hits. 2.30.29.30. 2 hits. |
| InterPro | IPR000237. GRIP. IPR011993. PH_like_dom. IPR000156. Ran_bind_dom. IPR001440. TPR-1. IPR013026. TPR-contain_dom. IPR011990. TPR-like_helical. IPR019734. TPR_repeat. [Graphical view] |
| Pfam | PF01465. GRIP. 1 hit. PF00638. Ran_BP1. 2 hits. PF00515. TPR_1. 1 hit. [Graphical view] |
| SMART | SM00755. Grip. 1 hit. SM00160. RanBD. 2 hits. [Graphical view] |
| PROSITE | PS50913. GRIP. 1 hit. PS50196. RANBD1. 2 hits. PS50005. TPR. 1 hit. PS50293. TPR_REGION. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | RGPD5. human. |
| NextBio | 130592. |
| SOURCE | Search... |
Entry information
| Entry name | RGPD5_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q99666 Secondary accession number(s): Q53QN2 Q9H0B2 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 2 Human chromosome 2: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
