Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q99666 (RGPD5_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 107. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (3) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
RANBP2-like and GRIP domain-containing protein 5/6
Alternative name(s):
Ran-binding protein 2-like 1/2
Short name=RanBP2-like 1/2
Short name=RanBP2L1
Short name=RanBP2L2
Sperm membrane protein BS-63
Gene names
Name:RGPD5
Synonyms:RANBP2L1, RGP5, RGP7, RGPD7
AND
Name:RGPD6
Synonyms:RANBP2L2, RGP6
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length1765 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Subcellular location

Cytoplasm Ref.5.

Tissue specificity

Expressed in testis. Ref.1

Miscellaneous

One of the 8 copies of RANBP2 clustered close to the chromosome 2 centromere.

Sequence similarities

Contains 1 GRIP domain.

Contains 2 RanBD1 domains.

Contains 3 TPR repeats.

Ontologies

Keywords
   Cellular componentCytoplasm
   Coding sequence diversityAlternative splicing
   DomainRepeat
TPR repeat
   PTMPhosphoprotein
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processprotein targeting to Golgi

Inferred from electronic annotation. Source: InterPro

   Cellular_componentcytoplasm

Inferred from electronic annotation. Source: UniProtKB-SubCell

Complete GO annotation...

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q99666-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q99666-2)

The sequence of this isoform differs from the canonical sequence as follows:
     868-904: VATTGPSVYYSQSPAYNSQYLLRPAANVTPTKGSSNT → EAAHRHFTIEKHGDSKWIIYRFTKQLCGTERARAKIS
     905-1765: Missing.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 17651765RANBP2-like and GRIP domain-containing protein 5/6
PRO_0000204915

Regions

Repeat26 – 5934TPR 1
Repeat60 – 9334TPR 2
Repeat648 – 68134TPR 3
Domain1036 – 1172137RanBD1 1
Domain1333 – 1469137RanBD1 2
Domain1702 – 175251GRIP
Compositional bias1261 – 12666Poly-Ser

Amino acid modifications

Modified residue191Phosphothreonine Ref.8
Modified residue211Phosphoserine Ref.8

Natural variations

Alternative sequence868 – 90437VATTG…GSSNT → EAAHRHFTIEKHGDSKWIIY RFTKQLCGTERARAKIS in isoform 2.
VSP_038968
Alternative sequence905 – 1765861Missing in isoform 2.
VSP_038969

Experimental info

Sequence conflict1741L → V in AAB41848. Ref.1
Sequence conflict2041N → H in AAB41848. Ref.1
Sequence conflict2141Y → H in AAB41848. Ref.1
Sequence conflict2291Q → R in AAB41848. Ref.1
Sequence conflict2571E → G in AAB41848. Ref.1
Sequence conflict2701K → E in AAB41848. Ref.1
Sequence conflict4511L → S in AAB41848. Ref.1
Sequence conflict7361P → S in AAB41848. Ref.1
Sequence conflict7841K → R in AAB41848. Ref.1
Sequence conflict8931A → G in AAB41848. Ref.1
Sequence conflict9051E → D in AAB41848. Ref.1
Sequence conflict9461F → L in AAB41848. Ref.1
Sequence conflict10741R → S in AAB41848. Ref.1
Sequence conflict11351D → H in AAB41848. Ref.1
Sequence conflict16121S → P in AAB41848. Ref.1
Sequence conflict16821L → P in AAB41848. Ref.1

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified May 5, 2009. Version 3.
Checksum: DC699DC82C67749D

FASTA1,765198,924
        10         20         30         40         50         60 
MRRSKADVER YVASVLGLTP SPRQKSMKGF YFAKLYYEAK EYDLAKKYIC TYINVQERDP 

        70         80         90        100        110        120 
KAHRFLGLLY ELEENTEKAV ECYRRSVELN PTQKDLVLKI AELLCKNDVT DGRAKYWVER 

       130        140        150        160        170        180 
AAKLFPGSPA IYKLKEQLLD CEGEDGWNKL FDLIQSELYV RPDDVHVNIR LVELYRSTKR 

       190        200        210        220        230        240 
LKDAVAHCHE AERNIALRSS LEWNSCVVQT LKEYLESLQC LESDKSDWQA TNTDLLLAYA 

       250        260        270        280        290        300 
NLMLLTLSTR DVQENRELLE SFDSALQSAK SSLGGNDELS ATFLEMKGHF YMYAGSLLLK 

       310        320        330        340        350        360 
MGQHGNNVQW RALSELAALC YLIAFQVPRP KIKLREGKAG QNLLEMMACD RLSQSGHMLL 

       370        380        390        400        410        420 
SLSRGKQDFL KEVVETFANK IGQSALYDAL FSSQSPKDTS FLGSDDIGKI DVQEPELEDL 

       430        440        450        460        470        480 
ARYDVGAIRA HNGSLQHLTW LGLQWNSLPA LPGIRKWLKQ LFHRLPHETS RLETNAPESI 

       490        500        510        520        530        540 
CILDLEVFLL GVVYTSHLQL KEKCNSHHSS YQPLCLPFPV CKQLCTERQK SWWDAVCTLI 

       550        560        570        580        590        600 
HRKAVPGNLA KLRLLVQHEI NTLRAQEKHG LQPALLVHWA KYLQKTGSGL NSFYGQLEYI 

       610        620        630        640        650        660 
GRSVHYWKKV LPLLKIIKKN SIPEPIDPLF KHFHSVDIQA SEIVEYEEDA HITFAMLDAV 

       670        680        690        700        710        720 
NGNIEDAVTA FESIKSVVSY WNLALIFHRK AEDIENDALS PEEQEECRNY LTKTRDYLIK 

       730        740        750        760        770        780 
IIDDGDSNLS VVKKLPVPLE SVKQMLNSVM QELEDYSEGG PLYKNGSLRN ADSEIKHSTP 

       790        800        810        820        830        840 
SPTKYSLSPS KSYKYSPETP PRWTEDRNSL LNMICQQVEA IKKEMQELKL NSSKSASRHR 

       850        860        870        880        890        900 
WPTENYGPDS VPDGYQGSQT FHGAPLTVAT TGPSVYYSQS PAYNSQYLLR PAANVTPTKG 

       910        920        930        940        950        960 
SSNTEFKSTK EGFSIPVSAD GFKFGISEPG NQEKKREKPL ENDTGFQAQD ISGRKKGRGV 

       970        980        990       1000       1010       1020 
IFGQTSSTFT FADVAKSTSG EGFQFGKKDL NFKGFSGAGE KLFSSRYGKM ANKANTSGDF 

      1030       1040       1050       1060       1070       1080 
EKDDDAYKTE DSDDIHFEPV VQMPEKVELV TGEEGEKVLY SQGVKLFRFD AEVRQWKERG 

      1090       1100       1110       1120       1130       1140 
LGNLKILKNE VNGKLRMLMR REQVLKVCAN HWITTTMNLK PLSGSDRAWM WSASDFSDGD 

      1150       1160       1170       1180       1190       1200 
AKLERLAAKF KTPELAEEFK QKFEECQRLL LDIPLQTPHK LVDTGRAAKL IQRAEEMKSG 

      1210       1220       1230       1240       1250       1260 
LKDFKTFLTN DQTKVTEEEN KGSGTGAAGA SDTTIKPNAE NTGPTLEWDN YDLREDALDD 

      1270       1280       1290       1300       1310       1320 
SVSSSSVHAS PLASSPVRKN LFRFDESTTG SNFSFKSALS LSKSPAKLNQ SGTSVGTDEE 

      1330       1340       1350       1360       1370       1380 
SVVTQEEERD GQYFEPVVPL PDLVEVSSGE ENEQVVFSHR AEIYRYDKDV GQWKERGIGD 

      1390       1400       1410       1420       1430       1440 
IKILQNYDNK QVRIVMRRDQ VLKLCANHRI TPDMSLQNMK GTERVWVWTA CDFADGERKV 

      1450       1460       1470       1480       1490       1500 
EHLAVRFKLQ DVADSFKKIF DEAKTAQEKD SLITPHVSRS STPRESPCGK IAVAILEETT 

      1510       1520       1530       1540       1550       1560 
RERTDVIQGD DVADAASEVE VSSTSETTTK AVVSPPKFVF VSESVKRIFS SEKSKPFVFG 

      1570       1580       1590       1600       1610       1620 
NSSATGSLFG FSFNAPLKSN NSETSSVAQS GSESKVEPKK CELSKNSDIE QSSDSKVKNL 

      1630       1640       1650       1660       1670       1680 
SASFPTEESS INYTFKTPEK EPPLWHAEFT KEELVQKLRS TTKSADHLNG LLREIEATNA 

      1690       1700       1710       1720       1730       1740 
VLMEQIKLLK SEIRRLERNQ EREKSAANLE YLKNVLLQFI FLKPGSERER LLPVINTMLQ 

      1750       1760 
LSPEEKGKLA AVAQDEEENA SRSSG 

« Hide

Isoform 2 [UniParc].

Checksum: 32030C739F6E72EE
Show »

FASTA904103,334

References

« Hide 'large scale' references
[1]"Molecular cloning and characterization of a novel testis-specific nucleoporin-related gene."
Wang L.F., Zhu H.D., Miao S.Y., Cao D.F., Wu Y.W., Zong S.D., Koide S.S.
Arch. Androl. 42:71-84(1999) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY.
Tissue: Testis.
[2]"Towards a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs."
Wiemann S., Weil B., Wellenreuther R., Gassenhuber J., Glassl S., Ansorge W., Boecher M., Bloecker H., Bauersachs S., Blum H., Lauber J., Duesterhoeft A., Beyer A., Koehrer K., Strack N., Mewes H.-W., Ottenwaelder B., Obermaier B. expand/collapse author list , Tampe J., Heubner D., Wambutt R., Korn B., Klein M., Poustka A.
Genome Res. 11:422-435(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
[3]"Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. expand/collapse author list , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[4]Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S., Ohara O., Nagase T., Kikuno R.F.
Submitted (MAR-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1009-1765 (ISOFORM 1).
Tissue: Brain.
[5]"Complex genomic rearrangements lead to novel primate gene function."
Ciccarelli F.D., von Mering C., Suyama M., Harrington E.D., Izaurralde E., Bork P.
Genome Res. 15:343-351(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: SUBCELLULAR LOCATION.
[6]"Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis."
Cantin G.T., Yi W., Lu B., Park S.K., Xu T., Lee J.-D., Yates J.R. III
J. Proteome Res. 7:1346-1351(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[7]"Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle."
Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M.
Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[8]"A quantitative atlas of mitotic phosphorylation."
Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P.
Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-19 AND SER-21, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
U64675 mRNA. Translation: AAB41848.2.
AL136868 mRNA. Translation: CAB66802.1.
AC013271 Genomic DNA. Translation: AAY14902.1.
AC123886 Genomic DNA. Translation: AAY14839.1.
AC108938 Genomic DNA. Translation: AAY24132.1.
AC109815 Genomic DNA. No translation available.
AB209082 mRNA. Translation: BAD92319.1.
RefSeqNP_001032955.1. NM_001037866.1.
NP_001116835.1. NM_001123363.3.
NP_005045.2. NM_005054.2.
NP_115636.1. NM_032260.2.
UniGeneHs.469630.
Hs.535589.
Hs.645445.

3D structure databases

ProteinModelPortalQ99666.
SMRQ99666. Positions 3-190, 650-675, 1051-1178, 1348-1464, 1663-1700.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid123954. 8 interactions.
609938. 4 interactions.
IntActQ99666. 5 interactions.
MINTMINT-2817131.
STRING9606.ENSP00000016946.

PTM databases

PhosphoSiteQ99666.

Polymorphism databases

DMDM229463026.

Proteomic databases

PaxDbQ99666.
PRIDEQ99666.

Protocols and materials databases

DNASU729540.
84220.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000016946; ENSP00000016946; ENSG00000015568. [Q99666-1]
ENST00000272454; ENSP00000272454; ENSG00000015568. [Q99666-2]
ENST00000329516; ENSP00000330842; ENSG00000183054. [Q99666-1]
ENST00000330331; ENSP00000330023; ENSG00000183054. [Q99666-2]
ENST00000393283; ENSP00000376962; ENSG00000015568. [Q99666-2]
GeneID729540.
84220.
KEGGhsa:729540.
hsa:84220.
UCSCuc002tfc.3. human. [Q99666-2]
uc002tfe.1. human. [Q99666-1]

Organism-specific databases

CTD729540.
84220.
GeneCardsGC02M111271.
GC02P110550.
HGNCHGNC:32418. RGPD5.
HGNC:32419. RGPD6.
HPAHPA045704.
MIM612708. gene.
612709. gene.
612710. gene.
neXtProtNX_Q99666.
PharmGKBPA142671074.
GenAtlasSearch...

Phylogenomic databases

eggNOGCOG5171.
HOGENOMHOG000089994.
HOVERGENHBG108404.
InParanoidQ53T03.
PhylomeDBQ99666.
TreeFamTF314797.

Gene expression databases

ArrayExpressQ99666.
BgeeQ99666.
CleanExHS_RGPD5.
HS_RGPD8.
GenevestigatorQ99666.

Family and domain databases

Gene3D1.10.220.60. 1 hit.
1.25.40.10. 2 hits.
2.30.29.30. 2 hits.
InterProIPR000237. GRIP.
IPR011993. PH_like_dom.
IPR000156. Ran_bind_dom.
IPR013026. TPR-contain_dom.
IPR011990. TPR-like_helical.
IPR001440. TPR_1.
IPR019734. TPR_repeat.
[Graphical view]
PfamPF01465. GRIP. 1 hit.
PF00638. Ran_BP1. 2 hits.
PF00515. TPR_1. 1 hit.
[Graphical view]
SMARTSM00755. Grip. 1 hit.
SM00160. RanBD. 2 hits.
[Graphical view]
PROSITEPS50913. GRIP. 1 hit.
PS50196. RANBD1. 2 hits.
PS50005. TPR. 1 hit.
PS50293. TPR_REGION. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSRGPD5. human.
GeneWikiRGPD5.
NextBio130592.
PROQ99666.
SOURCESearch...

Entry information

Entry nameRGPD5_HUMAN
AccessionPrimary (citable) accession number: Q99666
Secondary accession number(s): Q53QN2 expand/collapse secondary AC list , Q53T03, Q59GM7, Q9H0B2
Entry history
Integrated into UniProtKB/Swiss-Prot: December 6, 2005
Last sequence update: May 5, 2009
Last modified: April 16, 2014
This is version 107 of the entry and version 3 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human chromosome 2

Human chromosome 2: entries, gene names and cross-references to MIM