SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q99666

- RGPD5_HUMAN

UniProt

Q99666 - RGPD5_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
RANBP2-like and GRIP domain-containing protein 5/6
Gene
RGPD5, RANBP2L1, RGP5, RGP7, RGPD7
RGPD6, RANBP2L2, RGP6
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5 - Experimental evidence at protein leveli

Functioni

GO - Biological processi

  1. protein targeting to Golgi Source: InterPro
Complete GO annotation...

Names & Taxonomyi

Organism-specific databases

Protein namesi
Recommended name:
RANBP2-like and GRIP domain-containing protein 5/6
Alternative name(s):
Ran-binding protein 2-like 1/2
Short name:
RanBP2-like 1/2
Short name:
RanBP2L1
Short name:
RanBP2L2
Sperm membrane protein BS-63
Gene namesi
Name:RGPD5
Synonyms:RANBP2L1, RGP5, RGP7, RGPD7
AND
Name:RGPD6
Synonyms:RANBP2L2, RGP6
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 2
HGNCiHGNC:32418. RGPD5.
HGNC:32419. RGPD6.

Subcellular locationi

Cytoplasm 1 Publication

GO - Cellular componenti

  1. cytoplasm Source: UniProtKB-SubCell

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA142671074.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 17651765RANBP2-like and GRIP domain-containing protein 5/6
PRO_0000204915Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei19 – 191Phosphothreonine1 Publication
Modified residuei21 – 211Phosphoserine1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ99666.
PaxDbiQ99666.
PRIDEiQ99666.

PTM databases

PhosphoSiteiQ99666.

Expressioni

Tissue specificityi

Expressed in testis.1 Publication

Gene expression databases

ArrayExpressiQ99666.
BgeeiQ99666.
CleanExiHS_RGPD5.
HS_RGPD8.
GenevestigatoriQ99666.

Organism-specific databases

HPAiHPA045704.

Interactioni

Protein-protein interaction databases

BioGridi123954. 8 interactions.
609938. 4 interactions.
IntActiQ99666. 5 interactions.
MINTiMINT-2817131.
STRINGi9606.ENSP00000016946.

Structurei

3D structure databases

ProteinModelPortaliQ99666.
SMRiQ99666. Positions 3-145, 649-674, 1051-1178, 1348-1464, 1663-1700.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati26 – 5934TPR 1
Add
BLAST
Repeati60 – 9334TPR 2
Add
BLAST
Repeati648 – 68134TPR 3
Add
BLAST
Domaini1036 – 1172137RanBD1 1
Add
BLAST
Domaini1333 – 1469137RanBD1 2
Add
BLAST
Domaini1702 – 175251GRIP
Add
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi1261 – 12666Poly-Ser

Sequence similaritiesi

Contains 1 GRIP domain.
Contains 2 RanBD1 domains.
Contains 3 TPR repeats.

Keywords - Domaini

Repeat, TPR repeat

Phylogenomic databases

eggNOGiCOG5171.
HOGENOMiHOG000089994.
HOVERGENiHBG108404.
InParanoidiQ53T03.
OMAiLSACEGQ.
PhylomeDBiQ99666.
TreeFamiTF314797.

Family and domain databases

Gene3Di1.10.220.60. 1 hit.
1.25.40.10. 2 hits.
2.30.29.30. 2 hits.
InterProiIPR000237. GRIP.
IPR011993. PH_like_dom.
IPR000156. Ran_bind_dom.
IPR013026. TPR-contain_dom.
IPR011990. TPR-like_helical.
IPR001440. TPR_1.
IPR019734. TPR_repeat.
[Graphical view]
PfamiPF01465. GRIP. 1 hit.
PF00638. Ran_BP1. 2 hits.
PF00515. TPR_1. 1 hit.
[Graphical view]
SMARTiSM00755. Grip. 1 hit.
SM00160. RanBD. 2 hits.
[Graphical view]
PROSITEiPS50913. GRIP. 1 hit.
PS50196. RANBD1. 2 hits.
PS50005. TPR. 1 hit.
PS50293. TPR_REGION. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q99666-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MRRSKADVER YVASVLGLTP SPRQKSMKGF YFAKLYYEAK EYDLAKKYIC     50
TYINVQERDP KAHRFLGLLY ELEENTEKAV ECYRRSVELN PTQKDLVLKI 100
AELLCKNDVT DGRAKYWVER AAKLFPGSPA IYKLKEQLLD CEGEDGWNKL 150
FDLIQSELYV RPDDVHVNIR LVELYRSTKR LKDAVAHCHE AERNIALRSS 200
LEWNSCVVQT LKEYLESLQC LESDKSDWQA TNTDLLLAYA NLMLLTLSTR 250
DVQENRELLE SFDSALQSAK SSLGGNDELS ATFLEMKGHF YMYAGSLLLK 300
MGQHGNNVQW RALSELAALC YLIAFQVPRP KIKLREGKAG QNLLEMMACD 350
RLSQSGHMLL SLSRGKQDFL KEVVETFANK IGQSALYDAL FSSQSPKDTS 400
FLGSDDIGKI DVQEPELEDL ARYDVGAIRA HNGSLQHLTW LGLQWNSLPA 450
LPGIRKWLKQ LFHRLPHETS RLETNAPESI CILDLEVFLL GVVYTSHLQL 500
KEKCNSHHSS YQPLCLPFPV CKQLCTERQK SWWDAVCTLI HRKAVPGNLA 550
KLRLLVQHEI NTLRAQEKHG LQPALLVHWA KYLQKTGSGL NSFYGQLEYI 600
GRSVHYWKKV LPLLKIIKKN SIPEPIDPLF KHFHSVDIQA SEIVEYEEDA 650
HITFAMLDAV NGNIEDAVTA FESIKSVVSY WNLALIFHRK AEDIENDALS 700
PEEQEECRNY LTKTRDYLIK IIDDGDSNLS VVKKLPVPLE SVKQMLNSVM 750
QELEDYSEGG PLYKNGSLRN ADSEIKHSTP SPTKYSLSPS KSYKYSPETP 800
PRWTEDRNSL LNMICQQVEA IKKEMQELKL NSSKSASRHR WPTENYGPDS 850
VPDGYQGSQT FHGAPLTVAT TGPSVYYSQS PAYNSQYLLR PAANVTPTKG 900
SSNTEFKSTK EGFSIPVSAD GFKFGISEPG NQEKKREKPL ENDTGFQAQD 950
ISGRKKGRGV IFGQTSSTFT FADVAKSTSG EGFQFGKKDL NFKGFSGAGE 1000
KLFSSRYGKM ANKANTSGDF EKDDDAYKTE DSDDIHFEPV VQMPEKVELV 1050
TGEEGEKVLY SQGVKLFRFD AEVRQWKERG LGNLKILKNE VNGKLRMLMR 1100
REQVLKVCAN HWITTTMNLK PLSGSDRAWM WSASDFSDGD AKLERLAAKF 1150
KTPELAEEFK QKFEECQRLL LDIPLQTPHK LVDTGRAAKL IQRAEEMKSG 1200
LKDFKTFLTN DQTKVTEEEN KGSGTGAAGA SDTTIKPNAE NTGPTLEWDN 1250
YDLREDALDD SVSSSSVHAS PLASSPVRKN LFRFDESTTG SNFSFKSALS 1300
LSKSPAKLNQ SGTSVGTDEE SVVTQEEERD GQYFEPVVPL PDLVEVSSGE 1350
ENEQVVFSHR AEIYRYDKDV GQWKERGIGD IKILQNYDNK QVRIVMRRDQ 1400
VLKLCANHRI TPDMSLQNMK GTERVWVWTA CDFADGERKV EHLAVRFKLQ 1450
DVADSFKKIF DEAKTAQEKD SLITPHVSRS STPRESPCGK IAVAILEETT 1500
RERTDVIQGD DVADAASEVE VSSTSETTTK AVVSPPKFVF VSESVKRIFS 1550
SEKSKPFVFG NSSATGSLFG FSFNAPLKSN NSETSSVAQS GSESKVEPKK 1600
CELSKNSDIE QSSDSKVKNL SASFPTEESS INYTFKTPEK EPPLWHAEFT 1650
KEELVQKLRS TTKSADHLNG LLREIEATNA VLMEQIKLLK SEIRRLERNQ 1700
EREKSAANLE YLKNVLLQFI FLKPGSERER LLPVINTMLQ LSPEEKGKLA 1750
AVAQDEEENA SRSSG 1765
Length:1,765
Mass (Da):198,924
Last modified:May 5, 2009 - v3
Checksum:iDC699DC82C67749D
GO
Isoform 2 (identifier: Q99666-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     868-904: VATTGPSVYYSQSPAYNSQYLLRPAANVTPTKGSSNT → EAAHRHFTIEKHGDSKWIIYRFTKQLCGTERARAKIS
     905-1765: Missing.

Show »
Length:904
Mass (Da):103,334
Checksum:i32030C739F6E72EE
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei868 – 90437VATTG…GSSNT → EAAHRHFTIEKHGDSKWIIY RFTKQLCGTERARAKIS in isoform 2.
VSP_038968Add
BLAST
Alternative sequencei905 – 1765861Missing in isoform 2.
VSP_038969Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti174 – 1741L → V in AAB41848. 1 Publication
Sequence conflicti204 – 2041N → H in AAB41848. 1 Publication
Sequence conflicti214 – 2141Y → H in AAB41848. 1 Publication
Sequence conflicti229 – 2291Q → R in AAB41848. 1 Publication
Sequence conflicti257 – 2571E → G in AAB41848. 1 Publication
Sequence conflicti270 – 2701K → E in AAB41848. 1 Publication
Sequence conflicti451 – 4511L → S in AAB41848. 1 Publication
Sequence conflicti736 – 7361P → S in AAB41848. 1 Publication
Sequence conflicti784 – 7841K → R in AAB41848. 1 Publication
Sequence conflicti893 – 8931A → G in AAB41848. 1 Publication
Sequence conflicti905 – 9051E → D in AAB41848. 1 Publication
Sequence conflicti946 – 9461F → L in AAB41848. 1 Publication
Sequence conflicti1074 – 10741R → S in AAB41848. 1 Publication
Sequence conflicti1135 – 11351D → H in AAB41848. 1 Publication
Sequence conflicti1612 – 16121S → P in AAB41848. 1 Publication
Sequence conflicti1682 – 16821L → P in AAB41848. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U64675 mRNA. Translation: AAB41848.2.
AL136868 mRNA. Translation: CAB66802.1.
AC013271 Genomic DNA. Translation: AAY14902.1.
AC123886 Genomic DNA. Translation: AAY14839.1.
AC108938 Genomic DNA. Translation: AAY24132.1.
AC109815 Genomic DNA. No translation available.
AB209082 mRNA. Translation: BAD92319.1.
CCDSiCCDS2082.1. [Q99666-1]
CCDS2083.1. [Q99666-2]
CCDS42729.1. [Q99666-2]
CCDS46388.1. [Q99666-1]
RefSeqiNP_001032955.1. NM_001037866.1. [Q99666-2]
NP_001116835.1. NM_001123363.3. [Q99666-1]
NP_005045.2. NM_005054.2. [Q99666-1]
NP_115636.1. NM_032260.2. [Q99666-2]
UniGeneiHs.469630.
Hs.535589.
Hs.645445.

Genome annotation databases

EnsembliENST00000016946; ENSP00000016946; ENSG00000015568. [Q99666-1]
ENST00000272454; ENSP00000272454; ENSG00000015568. [Q99666-2]
ENST00000329516; ENSP00000330842; ENSG00000183054. [Q99666-1]
ENST00000330331; ENSP00000330023; ENSG00000183054. [Q99666-2]
ENST00000393283; ENSP00000376962; ENSG00000015568. [Q99666-2]
GeneIDi729540.
84220.
KEGGihsa:729540.
hsa:84220.
UCSCiuc002tfc.3. human. [Q99666-2]
uc002tfe.1. human. [Q99666-1]

Polymorphism databases

DMDMi229463026.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U64675 mRNA. Translation: AAB41848.2 .
AL136868 mRNA. Translation: CAB66802.1 .
AC013271 Genomic DNA. Translation: AAY14902.1 .
AC123886 Genomic DNA. Translation: AAY14839.1 .
AC108938 Genomic DNA. Translation: AAY24132.1 .
AC109815 Genomic DNA. No translation available.
AB209082 mRNA. Translation: BAD92319.1 .
CCDSi CCDS2082.1. [Q99666-1 ]
CCDS2083.1. [Q99666-2 ]
CCDS42729.1. [Q99666-2 ]
CCDS46388.1. [Q99666-1 ]
RefSeqi NP_001032955.1. NM_001037866.1. [Q99666-2 ]
NP_001116835.1. NM_001123363.3. [Q99666-1 ]
NP_005045.2. NM_005054.2. [Q99666-1 ]
NP_115636.1. NM_032260.2. [Q99666-2 ]
UniGenei Hs.469630.
Hs.535589.
Hs.645445.

3D structure databases

ProteinModelPortali Q99666.
SMRi Q99666. Positions 3-145, 649-674, 1051-1178, 1348-1464, 1663-1700.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 123954. 8 interactions.
609938. 4 interactions.
IntActi Q99666. 5 interactions.
MINTi MINT-2817131.
STRINGi 9606.ENSP00000016946.

PTM databases

PhosphoSitei Q99666.

Polymorphism databases

DMDMi 229463026.

Proteomic databases

MaxQBi Q99666.
PaxDbi Q99666.
PRIDEi Q99666.

Protocols and materials databases

DNASUi 729540.
84220.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000016946 ; ENSP00000016946 ; ENSG00000015568 . [Q99666-1 ]
ENST00000272454 ; ENSP00000272454 ; ENSG00000015568 . [Q99666-2 ]
ENST00000329516 ; ENSP00000330842 ; ENSG00000183054 . [Q99666-1 ]
ENST00000330331 ; ENSP00000330023 ; ENSG00000183054 . [Q99666-2 ]
ENST00000393283 ; ENSP00000376962 ; ENSG00000015568 . [Q99666-2 ]
GeneIDi 729540.
84220.
KEGGi hsa:729540.
hsa:84220.
UCSCi uc002tfc.3. human. [Q99666-2 ]
uc002tfe.1. human. [Q99666-1 ]

Organism-specific databases

CTDi 729540.
84220.
GeneCardsi GC02M111271.
GC02P110550.
HGNCi HGNC:32418. RGPD5.
HGNC:32419. RGPD6.
HPAi HPA045704.
MIMi 612708. gene.
612709. gene.
612710. gene.
neXtProti NX_Q99666.
PharmGKBi PA142671074.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG5171.
HOGENOMi HOG000089994.
HOVERGENi HBG108404.
InParanoidi Q53T03.
OMAi LSACEGQ.
PhylomeDBi Q99666.
TreeFami TF314797.

Miscellaneous databases

ChiTaRSi RGPD5. human.
GeneWikii RGPD5.
NextBioi 130592.
PROi Q99666.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q99666.
Bgeei Q99666.
CleanExi HS_RGPD5.
HS_RGPD8.
Genevestigatori Q99666.

Family and domain databases

Gene3Di 1.10.220.60. 1 hit.
1.25.40.10. 2 hits.
2.30.29.30. 2 hits.
InterProi IPR000237. GRIP.
IPR011993. PH_like_dom.
IPR000156. Ran_bind_dom.
IPR013026. TPR-contain_dom.
IPR011990. TPR-like_helical.
IPR001440. TPR_1.
IPR019734. TPR_repeat.
[Graphical view ]
Pfami PF01465. GRIP. 1 hit.
PF00638. Ran_BP1. 2 hits.
PF00515. TPR_1. 1 hit.
[Graphical view ]
SMARTi SM00755. Grip. 1 hit.
SM00160. RanBD. 2 hits.
[Graphical view ]
PROSITEi PS50913. GRIP. 1 hit.
PS50196. RANBD1. 2 hits.
PS50005. TPR. 1 hit.
PS50293. TPR_REGION. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

  1. "Molecular cloning and characterization of a novel testis-specific nucleoporin-related gene."
    Wang L.F., Zhu H.D., Miao S.Y., Cao D.F., Wu Y.W., Zong S.D., Koide S.S.
    Arch. Androl. 42:71-84(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY.
    Tissue: Testis.
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
  3. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
    Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
    , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
    Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S., Ohara O., Nagase T., Kikuno R.F.
    Submitted (MAR-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1009-1765 (ISOFORM 1).
    Tissue: Brain.
  5. "Complex genomic rearrangements lead to novel primate gene function."
    Ciccarelli F.D., von Mering C., Suyama M., Harrington E.D., Izaurralde E., Bork P.
    Genome Res. 15:343-351(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUBCELLULAR LOCATION.
  6. "Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis."
    Cantin G.T., Yi W., Lu B., Park S.K., Xu T., Lee J.-D., Yates J.R. III
    J. Proteome Res. 7:1346-1351(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  7. "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle."
    Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M.
    Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  8. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-19 AND SER-21, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.

Entry informationi

Entry nameiRGPD5_HUMAN
AccessioniPrimary (citable) accession number: Q99666
Secondary accession number(s): Q53QN2
, Q53T03, Q59GM7, Q9H0B2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 6, 2005
Last sequence update: May 5, 2009
Last modified: July 9, 2014
This is version 110 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Miscellaneous

One of the 8 copies of RANBP2 clustered close to the chromosome 2 centromere.

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi