Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q99666

- RGPD5_HUMAN

UniProt

Q99666 - RGPD5_HUMAN

Protein

RANBP2-like and GRIP domain-containing protein 5/6

Gene

RGPD5

more
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 111 (01 Oct 2014)
      Sequence version 3 (05 May 2009)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    GO - Biological processi

    1. protein targeting to Golgi Source: InterPro

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    RANBP2-like and GRIP domain-containing protein 5/6
    Alternative name(s):
    Ran-binding protein 2-like 1/2
    Short name:
    RanBP2-like 1/2
    Short name:
    RanBP2L1
    Short name:
    RanBP2L2
    Sperm membrane protein BS-63
    Gene namesi
    Name:RGPD5
    Synonyms:RANBP2L1, RGP5, RGP7, RGPD7
    AND
    Name:RGPD6
    Synonyms:RANBP2L2, RGP6
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 2

    Organism-specific databases

    HGNCiHGNC:32418. RGPD5.
    HGNC:32419. RGPD6.

    Subcellular locationi

    Cytoplasm 1 Publication

    GO - Cellular componenti

    1. cytoplasm Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Cytoplasm

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA142671074.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 17651765RANBP2-like and GRIP domain-containing protein 5/6PRO_0000204915Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei19 – 191Phosphothreonine1 Publication
    Modified residuei21 – 211Phosphoserine1 Publication

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    MaxQBiQ99666.
    PaxDbiQ99666.
    PRIDEiQ99666.

    PTM databases

    PhosphoSiteiQ99666.

    Expressioni

    Tissue specificityi

    Expressed in testis.1 Publication

    Gene expression databases

    ArrayExpressiQ99666.
    BgeeiQ99666.
    CleanExiHS_RGPD5.
    HS_RGPD8.
    GenevestigatoriQ99666.

    Organism-specific databases

    HPAiHPA045704.

    Interactioni

    Protein-protein interaction databases

    BioGridi123954. 8 interactions.
    609938. 4 interactions.
    IntActiQ99666. 5 interactions.
    MINTiMINT-2817131.
    STRINGi9606.ENSP00000016946.

    Structurei

    3D structure databases

    ProteinModelPortaliQ99666.
    SMRiQ99666. Positions 3-145, 649-674, 1051-1178, 1348-1464, 1663-1700.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Repeati26 – 5934TPR 1Add
    BLAST
    Repeati60 – 9334TPR 2Add
    BLAST
    Repeati648 – 68134TPR 3Add
    BLAST
    Domaini1036 – 1172137RanBD1 1PROSITE-ProRule annotationAdd
    BLAST
    Domaini1333 – 1469137RanBD1 2PROSITE-ProRule annotationAdd
    BLAST
    Domaini1702 – 175251GRIPPROSITE-ProRule annotationAdd
    BLAST

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi1261 – 12666Poly-Ser

    Sequence similaritiesi

    Contains 1 GRIP domain.PROSITE-ProRule annotation
    Contains 2 RanBD1 domains.PROSITE-ProRule annotation
    Contains 3 TPR repeats.PROSITE-ProRule annotation

    Keywords - Domaini

    Repeat, TPR repeat

    Phylogenomic databases

    eggNOGiCOG5171.
    HOGENOMiHOG000089994.
    HOVERGENiHBG108404.
    InParanoidiQ53T03.
    OMAiLSACEGQ.
    PhylomeDBiQ99666.
    TreeFamiTF314797.

    Family and domain databases

    Gene3Di1.10.220.60. 1 hit.
    1.25.40.10. 2 hits.
    2.30.29.30. 2 hits.
    InterProiIPR000237. GRIP.
    IPR011993. PH_like_dom.
    IPR000156. Ran_bind_dom.
    IPR013026. TPR-contain_dom.
    IPR011990. TPR-like_helical.
    IPR001440. TPR_1.
    IPR019734. TPR_repeat.
    [Graphical view]
    PfamiPF01465. GRIP. 1 hit.
    PF00638. Ran_BP1. 2 hits.
    PF00515. TPR_1. 1 hit.
    [Graphical view]
    SMARTiSM00755. Grip. 1 hit.
    SM00160. RanBD. 2 hits.
    [Graphical view]
    PROSITEiPS50913. GRIP. 1 hit.
    PS50196. RANBD1. 2 hits.
    PS50005. TPR. 1 hit.
    PS50293. TPR_REGION. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q99666-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MRRSKADVER YVASVLGLTP SPRQKSMKGF YFAKLYYEAK EYDLAKKYIC     50
    TYINVQERDP KAHRFLGLLY ELEENTEKAV ECYRRSVELN PTQKDLVLKI 100
    AELLCKNDVT DGRAKYWVER AAKLFPGSPA IYKLKEQLLD CEGEDGWNKL 150
    FDLIQSELYV RPDDVHVNIR LVELYRSTKR LKDAVAHCHE AERNIALRSS 200
    LEWNSCVVQT LKEYLESLQC LESDKSDWQA TNTDLLLAYA NLMLLTLSTR 250
    DVQENRELLE SFDSALQSAK SSLGGNDELS ATFLEMKGHF YMYAGSLLLK 300
    MGQHGNNVQW RALSELAALC YLIAFQVPRP KIKLREGKAG QNLLEMMACD 350
    RLSQSGHMLL SLSRGKQDFL KEVVETFANK IGQSALYDAL FSSQSPKDTS 400
    FLGSDDIGKI DVQEPELEDL ARYDVGAIRA HNGSLQHLTW LGLQWNSLPA 450
    LPGIRKWLKQ LFHRLPHETS RLETNAPESI CILDLEVFLL GVVYTSHLQL 500
    KEKCNSHHSS YQPLCLPFPV CKQLCTERQK SWWDAVCTLI HRKAVPGNLA 550
    KLRLLVQHEI NTLRAQEKHG LQPALLVHWA KYLQKTGSGL NSFYGQLEYI 600
    GRSVHYWKKV LPLLKIIKKN SIPEPIDPLF KHFHSVDIQA SEIVEYEEDA 650
    HITFAMLDAV NGNIEDAVTA FESIKSVVSY WNLALIFHRK AEDIENDALS 700
    PEEQEECRNY LTKTRDYLIK IIDDGDSNLS VVKKLPVPLE SVKQMLNSVM 750
    QELEDYSEGG PLYKNGSLRN ADSEIKHSTP SPTKYSLSPS KSYKYSPETP 800
    PRWTEDRNSL LNMICQQVEA IKKEMQELKL NSSKSASRHR WPTENYGPDS 850
    VPDGYQGSQT FHGAPLTVAT TGPSVYYSQS PAYNSQYLLR PAANVTPTKG 900
    SSNTEFKSTK EGFSIPVSAD GFKFGISEPG NQEKKREKPL ENDTGFQAQD 950
    ISGRKKGRGV IFGQTSSTFT FADVAKSTSG EGFQFGKKDL NFKGFSGAGE 1000
    KLFSSRYGKM ANKANTSGDF EKDDDAYKTE DSDDIHFEPV VQMPEKVELV 1050
    TGEEGEKVLY SQGVKLFRFD AEVRQWKERG LGNLKILKNE VNGKLRMLMR 1100
    REQVLKVCAN HWITTTMNLK PLSGSDRAWM WSASDFSDGD AKLERLAAKF 1150
    KTPELAEEFK QKFEECQRLL LDIPLQTPHK LVDTGRAAKL IQRAEEMKSG 1200
    LKDFKTFLTN DQTKVTEEEN KGSGTGAAGA SDTTIKPNAE NTGPTLEWDN 1250
    YDLREDALDD SVSSSSVHAS PLASSPVRKN LFRFDESTTG SNFSFKSALS 1300
    LSKSPAKLNQ SGTSVGTDEE SVVTQEEERD GQYFEPVVPL PDLVEVSSGE 1350
    ENEQVVFSHR AEIYRYDKDV GQWKERGIGD IKILQNYDNK QVRIVMRRDQ 1400
    VLKLCANHRI TPDMSLQNMK GTERVWVWTA CDFADGERKV EHLAVRFKLQ 1450
    DVADSFKKIF DEAKTAQEKD SLITPHVSRS STPRESPCGK IAVAILEETT 1500
    RERTDVIQGD DVADAASEVE VSSTSETTTK AVVSPPKFVF VSESVKRIFS 1550
    SEKSKPFVFG NSSATGSLFG FSFNAPLKSN NSETSSVAQS GSESKVEPKK 1600
    CELSKNSDIE QSSDSKVKNL SASFPTEESS INYTFKTPEK EPPLWHAEFT 1650
    KEELVQKLRS TTKSADHLNG LLREIEATNA VLMEQIKLLK SEIRRLERNQ 1700
    EREKSAANLE YLKNVLLQFI FLKPGSERER LLPVINTMLQ LSPEEKGKLA 1750
    AVAQDEEENA SRSSG 1765
    Length:1,765
    Mass (Da):198,924
    Last modified:May 5, 2009 - v3
    Checksum:iDC699DC82C67749D
    GO
    Isoform 2 (identifier: Q99666-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         868-904: VATTGPSVYYSQSPAYNSQYLLRPAANVTPTKGSSNT → EAAHRHFTIEKHGDSKWIIYRFTKQLCGTERARAKIS
         905-1765: Missing.

    Show »
    Length:904
    Mass (Da):103,334
    Checksum:i32030C739F6E72EE
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti174 – 1741L → V in AAB41848. (PubMed:10101573)Curated
    Sequence conflicti204 – 2041N → H in AAB41848. (PubMed:10101573)Curated
    Sequence conflicti214 – 2141Y → H in AAB41848. (PubMed:10101573)Curated
    Sequence conflicti229 – 2291Q → R in AAB41848. (PubMed:10101573)Curated
    Sequence conflicti257 – 2571E → G in AAB41848. (PubMed:10101573)Curated
    Sequence conflicti270 – 2701K → E in AAB41848. (PubMed:10101573)Curated
    Sequence conflicti451 – 4511L → S in AAB41848. (PubMed:10101573)Curated
    Sequence conflicti736 – 7361P → S in AAB41848. (PubMed:10101573)Curated
    Sequence conflicti784 – 7841K → R in AAB41848. (PubMed:10101573)Curated
    Sequence conflicti893 – 8931A → G in AAB41848. (PubMed:10101573)Curated
    Sequence conflicti905 – 9051E → D in AAB41848. (PubMed:10101573)Curated
    Sequence conflicti946 – 9461F → L in AAB41848. (PubMed:10101573)Curated
    Sequence conflicti1074 – 10741R → S in AAB41848. (PubMed:10101573)Curated
    Sequence conflicti1135 – 11351D → H in AAB41848. (PubMed:10101573)Curated
    Sequence conflicti1612 – 16121S → P in AAB41848. (PubMed:10101573)Curated
    Sequence conflicti1682 – 16821L → P in AAB41848. (PubMed:10101573)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei868 – 90437VATTG…GSSNT → EAAHRHFTIEKHGDSKWIIY RFTKQLCGTERARAKIS in isoform 2. 1 PublicationVSP_038968Add
    BLAST
    Alternative sequencei905 – 1765861Missing in isoform 2. 1 PublicationVSP_038969Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U64675 mRNA. Translation: AAB41848.2.
    AL136868 mRNA. Translation: CAB66802.1.
    AC013271 Genomic DNA. Translation: AAY14902.1.
    AC123886 Genomic DNA. Translation: AAY14839.1.
    AC108938 Genomic DNA. Translation: AAY24132.1.
    AC109815 Genomic DNA. No translation available.
    AB209082 mRNA. Translation: BAD92319.1.
    CCDSiCCDS2082.1. [Q99666-1]
    CCDS2083.1. [Q99666-2]
    CCDS42729.1. [Q99666-2]
    CCDS46388.1. [Q99666-1]
    RefSeqiNP_001032955.1. NM_001037866.1. [Q99666-2]
    NP_001116835.1. NM_001123363.3. [Q99666-1]
    NP_005045.2. NM_005054.2. [Q99666-1]
    NP_115636.1. NM_032260.2. [Q99666-2]
    UniGeneiHs.469630.
    Hs.535589.
    Hs.645445.

    Genome annotation databases

    EnsembliENST00000016946; ENSP00000016946; ENSG00000015568. [Q99666-1]
    ENST00000272454; ENSP00000272454; ENSG00000015568. [Q99666-2]
    ENST00000329516; ENSP00000330842; ENSG00000183054. [Q99666-1]
    ENST00000330331; ENSP00000330023; ENSG00000183054. [Q99666-2]
    ENST00000393283; ENSP00000376962; ENSG00000015568. [Q99666-2]
    GeneIDi729540.
    84220.
    KEGGihsa:729540.
    hsa:84220.
    UCSCiuc002tfc.3. human. [Q99666-2]
    uc002tfe.1. human. [Q99666-1]

    Polymorphism databases

    DMDMi229463026.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U64675 mRNA. Translation: AAB41848.2 .
    AL136868 mRNA. Translation: CAB66802.1 .
    AC013271 Genomic DNA. Translation: AAY14902.1 .
    AC123886 Genomic DNA. Translation: AAY14839.1 .
    AC108938 Genomic DNA. Translation: AAY24132.1 .
    AC109815 Genomic DNA. No translation available.
    AB209082 mRNA. Translation: BAD92319.1 .
    CCDSi CCDS2082.1. [Q99666-1 ]
    CCDS2083.1. [Q99666-2 ]
    CCDS42729.1. [Q99666-2 ]
    CCDS46388.1. [Q99666-1 ]
    RefSeqi NP_001032955.1. NM_001037866.1. [Q99666-2 ]
    NP_001116835.1. NM_001123363.3. [Q99666-1 ]
    NP_005045.2. NM_005054.2. [Q99666-1 ]
    NP_115636.1. NM_032260.2. [Q99666-2 ]
    UniGenei Hs.469630.
    Hs.535589.
    Hs.645445.

    3D structure databases

    ProteinModelPortali Q99666.
    SMRi Q99666. Positions 3-145, 649-674, 1051-1178, 1348-1464, 1663-1700.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 123954. 8 interactions.
    609938. 4 interactions.
    IntActi Q99666. 5 interactions.
    MINTi MINT-2817131.
    STRINGi 9606.ENSP00000016946.

    PTM databases

    PhosphoSitei Q99666.

    Polymorphism databases

    DMDMi 229463026.

    Proteomic databases

    MaxQBi Q99666.
    PaxDbi Q99666.
    PRIDEi Q99666.

    Protocols and materials databases

    DNASUi 729540.
    84220.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000016946 ; ENSP00000016946 ; ENSG00000015568 . [Q99666-1 ]
    ENST00000272454 ; ENSP00000272454 ; ENSG00000015568 . [Q99666-2 ]
    ENST00000329516 ; ENSP00000330842 ; ENSG00000183054 . [Q99666-1 ]
    ENST00000330331 ; ENSP00000330023 ; ENSG00000183054 . [Q99666-2 ]
    ENST00000393283 ; ENSP00000376962 ; ENSG00000015568 . [Q99666-2 ]
    GeneIDi 729540.
    84220.
    KEGGi hsa:729540.
    hsa:84220.
    UCSCi uc002tfc.3. human. [Q99666-2 ]
    uc002tfe.1. human. [Q99666-1 ]

    Organism-specific databases

    CTDi 729540.
    84220.
    GeneCardsi GC02M111271.
    GC02P110550.
    HGNCi HGNC:32418. RGPD5.
    HGNC:32419. RGPD6.
    HPAi HPA045704.
    MIMi 612708. gene.
    612709. gene.
    612710. gene.
    neXtProti NX_Q99666.
    PharmGKBi PA142671074.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG5171.
    HOGENOMi HOG000089994.
    HOVERGENi HBG108404.
    InParanoidi Q53T03.
    OMAi LSACEGQ.
    PhylomeDBi Q99666.
    TreeFami TF314797.

    Miscellaneous databases

    ChiTaRSi RGPD5. human.
    GeneWikii RGPD5.
    NextBioi 130592.
    PROi Q99666.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q99666.
    Bgeei Q99666.
    CleanExi HS_RGPD5.
    HS_RGPD8.
    Genevestigatori Q99666.

    Family and domain databases

    Gene3Di 1.10.220.60. 1 hit.
    1.25.40.10. 2 hits.
    2.30.29.30. 2 hits.
    InterProi IPR000237. GRIP.
    IPR011993. PH_like_dom.
    IPR000156. Ran_bind_dom.
    IPR013026. TPR-contain_dom.
    IPR011990. TPR-like_helical.
    IPR001440. TPR_1.
    IPR019734. TPR_repeat.
    [Graphical view ]
    Pfami PF01465. GRIP. 1 hit.
    PF00638. Ran_BP1. 2 hits.
    PF00515. TPR_1. 1 hit.
    [Graphical view ]
    SMARTi SM00755. Grip. 1 hit.
    SM00160. RanBD. 2 hits.
    [Graphical view ]
    PROSITEi PS50913. GRIP. 1 hit.
    PS50196. RANBD1. 2 hits.
    PS50005. TPR. 1 hit.
    PS50293. TPR_REGION. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Molecular cloning and characterization of a novel testis-specific nucleoporin-related gene."
      Wang L.F., Zhu H.D., Miao S.Y., Cao D.F., Wu Y.W., Zong S.D., Koide S.S.
      Arch. Androl. 42:71-84(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY.
      Tissue: Testis.
    2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    3. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
      Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
      , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
      Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S., Ohara O., Nagase T., Kikuno R.F.
      Submitted (MAR-2005) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1009-1765 (ISOFORM 1).
      Tissue: Brain.
    5. "Complex genomic rearrangements lead to novel primate gene function."
      Ciccarelli F.D., von Mering C., Suyama M., Harrington E.D., Izaurralde E., Bork P.
      Genome Res. 15:343-351(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: SUBCELLULAR LOCATION.
    6. "Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis."
      Cantin G.T., Yi W., Lu B., Park S.K., Xu T., Lee J.-D., Yates J.R. III
      J. Proteome Res. 7:1346-1351(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    7. "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle."
      Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M.
      Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    8. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-19 AND SER-21, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.

    Entry informationi

    Entry nameiRGPD5_HUMAN
    AccessioniPrimary (citable) accession number: Q99666
    Secondary accession number(s): Q53QN2
    , Q53T03, Q59GM7, Q9H0B2
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: December 6, 2005
    Last sequence update: May 5, 2009
    Last modified: October 1, 2014
    This is version 111 of the entry and version 3 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Miscellaneous

    One of the 8 copies of RANBP2 clustered close to the chromosome 2 centromere.

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 2
      Human chromosome 2: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3