Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q99666

- RGPD5_HUMAN

UniProt

Q99666 - RGPD5_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

RANBP2-like and GRIP domain-containing protein 5/6

Gene

RGPD5

more
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at protein leveli

Functioni

GO - Biological processi

  1. protein targeting to Golgi Source: InterPro
Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
RANBP2-like and GRIP domain-containing protein 5/6
Alternative name(s):
Ran-binding protein 2-like 1/2
Short name:
RanBP2-like 1/2
Short name:
RanBP2L1
Short name:
RanBP2L2
Sperm membrane protein BS-63
Gene namesi
Name:RGPD5
Synonyms:RANBP2L1, RGP5, RGP7, RGPD7
AND
Name:RGPD6
Synonyms:RANBP2L2, RGP6
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 2

Organism-specific databases

HGNCiHGNC:32418. RGPD5.
HGNC:32419. RGPD6.

Subcellular locationi

Cytoplasm 1 Publication

GO - Cellular componenti

  1. cytoplasm Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA142671074.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 17651765RANBP2-like and GRIP domain-containing protein 5/6PRO_0000204915Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei19 – 191Phosphothreonine1 Publication
Modified residuei21 – 211Phosphoserine1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ99666.
PaxDbiQ99666.
PRIDEiQ99666.

PTM databases

PhosphoSiteiQ99666.

Expressioni

Tissue specificityi

Expressed in testis.1 Publication

Gene expression databases

BgeeiQ99666.
CleanExiHS_RGPD5.
HS_RGPD8.
ExpressionAtlasiQ99666. baseline and differential.
GenevestigatoriQ99666.

Organism-specific databases

HPAiHPA045704.

Interactioni

Protein-protein interaction databases

BioGridi123954. 22 interactions.
609938. 4 interactions.
IntActiQ99666. 5 interactions.
MINTiMINT-2817131.
STRINGi9606.ENSP00000016946.

Structurei

3D structure databases

ProteinModelPortaliQ99666.
SMRiQ99666. Positions 3-145, 159-187, 1051-1178, 1348-1464, 1663-1700.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati26 – 5934TPR 1Add
BLAST
Repeati60 – 9334TPR 2Add
BLAST
Repeati648 – 68134TPR 3Add
BLAST
Domaini1036 – 1172137RanBD1 1PROSITE-ProRule annotationAdd
BLAST
Domaini1333 – 1469137RanBD1 2PROSITE-ProRule annotationAdd
BLAST
Domaini1702 – 175251GRIPPROSITE-ProRule annotationAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi1261 – 12666Poly-Ser

Sequence similaritiesi

Contains 1 GRIP domain.PROSITE-ProRule annotation
Contains 2 RanBD1 domains.PROSITE-ProRule annotation
Contains 3 TPR repeats.PROSITE-ProRule annotation

Keywords - Domaini

Repeat, TPR repeat

Phylogenomic databases

eggNOGiCOG5171.
GeneTreeiENSGT00760000119119.
HOGENOMiHOG000089994.
HOVERGENiHBG108404.
InParanoidiQ99666.
OMAiLSACEGQ.
PhylomeDBiQ99666.
TreeFamiTF314797.

Family and domain databases

Gene3Di1.10.220.60. 1 hit.
1.25.40.10. 2 hits.
2.30.29.30. 2 hits.
InterProiIPR000237. GRIP.
IPR011993. PH_like_dom.
IPR000156. Ran_bind_dom.
IPR013026. TPR-contain_dom.
IPR011990. TPR-like_helical_dom.
IPR001440. TPR_1.
IPR019734. TPR_repeat.
[Graphical view]
PfamiPF01465. GRIP. 1 hit.
PF00638. Ran_BP1. 2 hits.
PF00515. TPR_1. 1 hit.
[Graphical view]
SMARTiSM00755. Grip. 1 hit.
SM00160. RanBD. 2 hits.
[Graphical view]
PROSITEiPS50913. GRIP. 1 hit.
PS50196. RANBD1. 2 hits.
PS50005. TPR. 1 hit.
PS50293. TPR_REGION. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q99666-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MRRSKADVER YVASVLGLTP SPRQKSMKGF YFAKLYYEAK EYDLAKKYIC
60 70 80 90 100
TYINVQERDP KAHRFLGLLY ELEENTEKAV ECYRRSVELN PTQKDLVLKI
110 120 130 140 150
AELLCKNDVT DGRAKYWVER AAKLFPGSPA IYKLKEQLLD CEGEDGWNKL
160 170 180 190 200
FDLIQSELYV RPDDVHVNIR LVELYRSTKR LKDAVAHCHE AERNIALRSS
210 220 230 240 250
LEWNSCVVQT LKEYLESLQC LESDKSDWQA TNTDLLLAYA NLMLLTLSTR
260 270 280 290 300
DVQENRELLE SFDSALQSAK SSLGGNDELS ATFLEMKGHF YMYAGSLLLK
310 320 330 340 350
MGQHGNNVQW RALSELAALC YLIAFQVPRP KIKLREGKAG QNLLEMMACD
360 370 380 390 400
RLSQSGHMLL SLSRGKQDFL KEVVETFANK IGQSALYDAL FSSQSPKDTS
410 420 430 440 450
FLGSDDIGKI DVQEPELEDL ARYDVGAIRA HNGSLQHLTW LGLQWNSLPA
460 470 480 490 500
LPGIRKWLKQ LFHRLPHETS RLETNAPESI CILDLEVFLL GVVYTSHLQL
510 520 530 540 550
KEKCNSHHSS YQPLCLPFPV CKQLCTERQK SWWDAVCTLI HRKAVPGNLA
560 570 580 590 600
KLRLLVQHEI NTLRAQEKHG LQPALLVHWA KYLQKTGSGL NSFYGQLEYI
610 620 630 640 650
GRSVHYWKKV LPLLKIIKKN SIPEPIDPLF KHFHSVDIQA SEIVEYEEDA
660 670 680 690 700
HITFAMLDAV NGNIEDAVTA FESIKSVVSY WNLALIFHRK AEDIENDALS
710 720 730 740 750
PEEQEECRNY LTKTRDYLIK IIDDGDSNLS VVKKLPVPLE SVKQMLNSVM
760 770 780 790 800
QELEDYSEGG PLYKNGSLRN ADSEIKHSTP SPTKYSLSPS KSYKYSPETP
810 820 830 840 850
PRWTEDRNSL LNMICQQVEA IKKEMQELKL NSSKSASRHR WPTENYGPDS
860 870 880 890 900
VPDGYQGSQT FHGAPLTVAT TGPSVYYSQS PAYNSQYLLR PAANVTPTKG
910 920 930 940 950
SSNTEFKSTK EGFSIPVSAD GFKFGISEPG NQEKKREKPL ENDTGFQAQD
960 970 980 990 1000
ISGRKKGRGV IFGQTSSTFT FADVAKSTSG EGFQFGKKDL NFKGFSGAGE
1010 1020 1030 1040 1050
KLFSSRYGKM ANKANTSGDF EKDDDAYKTE DSDDIHFEPV VQMPEKVELV
1060 1070 1080 1090 1100
TGEEGEKVLY SQGVKLFRFD AEVRQWKERG LGNLKILKNE VNGKLRMLMR
1110 1120 1130 1140 1150
REQVLKVCAN HWITTTMNLK PLSGSDRAWM WSASDFSDGD AKLERLAAKF
1160 1170 1180 1190 1200
KTPELAEEFK QKFEECQRLL LDIPLQTPHK LVDTGRAAKL IQRAEEMKSG
1210 1220 1230 1240 1250
LKDFKTFLTN DQTKVTEEEN KGSGTGAAGA SDTTIKPNAE NTGPTLEWDN
1260 1270 1280 1290 1300
YDLREDALDD SVSSSSVHAS PLASSPVRKN LFRFDESTTG SNFSFKSALS
1310 1320 1330 1340 1350
LSKSPAKLNQ SGTSVGTDEE SVVTQEEERD GQYFEPVVPL PDLVEVSSGE
1360 1370 1380 1390 1400
ENEQVVFSHR AEIYRYDKDV GQWKERGIGD IKILQNYDNK QVRIVMRRDQ
1410 1420 1430 1440 1450
VLKLCANHRI TPDMSLQNMK GTERVWVWTA CDFADGERKV EHLAVRFKLQ
1460 1470 1480 1490 1500
DVADSFKKIF DEAKTAQEKD SLITPHVSRS STPRESPCGK IAVAILEETT
1510 1520 1530 1540 1550
RERTDVIQGD DVADAASEVE VSSTSETTTK AVVSPPKFVF VSESVKRIFS
1560 1570 1580 1590 1600
SEKSKPFVFG NSSATGSLFG FSFNAPLKSN NSETSSVAQS GSESKVEPKK
1610 1620 1630 1640 1650
CELSKNSDIE QSSDSKVKNL SASFPTEESS INYTFKTPEK EPPLWHAEFT
1660 1670 1680 1690 1700
KEELVQKLRS TTKSADHLNG LLREIEATNA VLMEQIKLLK SEIRRLERNQ
1710 1720 1730 1740 1750
EREKSAANLE YLKNVLLQFI FLKPGSERER LLPVINTMLQ LSPEEKGKLA
1760
AVAQDEEENA SRSSG
Length:1,765
Mass (Da):198,924
Last modified:May 5, 2009 - v3
Checksum:iDC699DC82C67749D
GO
Isoform 2 (identifier: Q99666-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     868-904: VATTGPSVYYSQSPAYNSQYLLRPAANVTPTKGSSNT → EAAHRHFTIEKHGDSKWIIYRFTKQLCGTERARAKIS
     905-1765: Missing.

Show »
Length:904
Mass (Da):103,334
Checksum:i32030C739F6E72EE
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti174 – 1741L → V in AAB41848. (PubMed:10101573)Curated
Sequence conflicti204 – 2041N → H in AAB41848. (PubMed:10101573)Curated
Sequence conflicti214 – 2141Y → H in AAB41848. (PubMed:10101573)Curated
Sequence conflicti229 – 2291Q → R in AAB41848. (PubMed:10101573)Curated
Sequence conflicti257 – 2571E → G in AAB41848. (PubMed:10101573)Curated
Sequence conflicti270 – 2701K → E in AAB41848. (PubMed:10101573)Curated
Sequence conflicti451 – 4511L → S in AAB41848. (PubMed:10101573)Curated
Sequence conflicti736 – 7361P → S in AAB41848. (PubMed:10101573)Curated
Sequence conflicti784 – 7841K → R in AAB41848. (PubMed:10101573)Curated
Sequence conflicti893 – 8931A → G in AAB41848. (PubMed:10101573)Curated
Sequence conflicti905 – 9051E → D in AAB41848. (PubMed:10101573)Curated
Sequence conflicti946 – 9461F → L in AAB41848. (PubMed:10101573)Curated
Sequence conflicti1074 – 10741R → S in AAB41848. (PubMed:10101573)Curated
Sequence conflicti1135 – 11351D → H in AAB41848. (PubMed:10101573)Curated
Sequence conflicti1612 – 16121S → P in AAB41848. (PubMed:10101573)Curated
Sequence conflicti1682 – 16821L → P in AAB41848. (PubMed:10101573)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei868 – 90437VATTG…GSSNT → EAAHRHFTIEKHGDSKWIIY RFTKQLCGTERARAKIS in isoform 2. 1 PublicationVSP_038968Add
BLAST
Alternative sequencei905 – 1765861Missing in isoform 2. 1 PublicationVSP_038969Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U64675 mRNA. Translation: AAB41848.2.
AL136868 mRNA. Translation: CAB66802.1.
AC013271 Genomic DNA. Translation: AAY14902.1.
AC123886 Genomic DNA. Translation: AAY14839.1.
AC108938 Genomic DNA. Translation: AAY24132.1.
AC109815 Genomic DNA. No translation available.
AB209082 mRNA. Translation: BAD92319.1.
CCDSiCCDS2082.1. [Q99666-1]
CCDS2083.1. [Q99666-2]
CCDS42729.1. [Q99666-2]
CCDS46388.1. [Q99666-1]
RefSeqiNP_001032955.1. NM_001037866.1. [Q99666-2]
NP_001116835.1. NM_001123363.3. [Q99666-1]
NP_005045.2. NM_005054.2. [Q99666-1]
NP_115636.1. NM_032260.2. [Q99666-2]
UniGeneiHs.469630.
Hs.535589.
Hs.645445.

Genome annotation databases

EnsembliENST00000016946; ENSP00000016946; ENSG00000015568. [Q99666-1]
ENST00000272454; ENSP00000272454; ENSG00000015568. [Q99666-2]
ENST00000329516; ENSP00000330842; ENSG00000183054. [Q99666-1]
ENST00000330331; ENSP00000330023; ENSG00000183054. [Q99666-2]
ENST00000393283; ENSP00000376962; ENSG00000015568. [Q99666-2]
GeneIDi729540.
84220.
KEGGihsa:729540.
hsa:84220.
UCSCiuc002tfc.3. human. [Q99666-2]
uc002tfe.1. human. [Q99666-1]

Polymorphism databases

DMDMi229463026.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U64675 mRNA. Translation: AAB41848.2 .
AL136868 mRNA. Translation: CAB66802.1 .
AC013271 Genomic DNA. Translation: AAY14902.1 .
AC123886 Genomic DNA. Translation: AAY14839.1 .
AC108938 Genomic DNA. Translation: AAY24132.1 .
AC109815 Genomic DNA. No translation available.
AB209082 mRNA. Translation: BAD92319.1 .
CCDSi CCDS2082.1. [Q99666-1 ]
CCDS2083.1. [Q99666-2 ]
CCDS42729.1. [Q99666-2 ]
CCDS46388.1. [Q99666-1 ]
RefSeqi NP_001032955.1. NM_001037866.1. [Q99666-2 ]
NP_001116835.1. NM_001123363.3. [Q99666-1 ]
NP_005045.2. NM_005054.2. [Q99666-1 ]
NP_115636.1. NM_032260.2. [Q99666-2 ]
UniGenei Hs.469630.
Hs.535589.
Hs.645445.

3D structure databases

ProteinModelPortali Q99666.
SMRi Q99666. Positions 3-145, 159-187, 1051-1178, 1348-1464, 1663-1700.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 123954. 22 interactions.
609938. 4 interactions.
IntActi Q99666. 5 interactions.
MINTi MINT-2817131.
STRINGi 9606.ENSP00000016946.

PTM databases

PhosphoSitei Q99666.

Polymorphism databases

DMDMi 229463026.

Proteomic databases

MaxQBi Q99666.
PaxDbi Q99666.
PRIDEi Q99666.

Protocols and materials databases

DNASUi 729540.
84220.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000016946 ; ENSP00000016946 ; ENSG00000015568 . [Q99666-1 ]
ENST00000272454 ; ENSP00000272454 ; ENSG00000015568 . [Q99666-2 ]
ENST00000329516 ; ENSP00000330842 ; ENSG00000183054 . [Q99666-1 ]
ENST00000330331 ; ENSP00000330023 ; ENSG00000183054 . [Q99666-2 ]
ENST00000393283 ; ENSP00000376962 ; ENSG00000015568 . [Q99666-2 ]
GeneIDi 729540.
84220.
KEGGi hsa:729540.
hsa:84220.
UCSCi uc002tfc.3. human. [Q99666-2 ]
uc002tfe.1. human. [Q99666-1 ]

Organism-specific databases

CTDi 729540.
84220.
GeneCardsi GC02M111271.
GC02P110550.
HGNCi HGNC:32418. RGPD5.
HGNC:32419. RGPD6.
HPAi HPA045704.
MIMi 612708. gene.
612709. gene.
612710. gene.
neXtProti NX_Q99666.
PharmGKBi PA142671074.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG5171.
GeneTreei ENSGT00760000119119.
HOGENOMi HOG000089994.
HOVERGENi HBG108404.
InParanoidi Q99666.
OMAi LSACEGQ.
PhylomeDBi Q99666.
TreeFami TF314797.

Miscellaneous databases

ChiTaRSi RGPD5. human.
RGPD6. human.
GeneWikii RGPD5.
NextBioi 130592.
PROi Q99666.
SOURCEi Search...

Gene expression databases

Bgeei Q99666.
CleanExi HS_RGPD5.
HS_RGPD8.
ExpressionAtlasi Q99666. baseline and differential.
Genevestigatori Q99666.

Family and domain databases

Gene3Di 1.10.220.60. 1 hit.
1.25.40.10. 2 hits.
2.30.29.30. 2 hits.
InterProi IPR000237. GRIP.
IPR011993. PH_like_dom.
IPR000156. Ran_bind_dom.
IPR013026. TPR-contain_dom.
IPR011990. TPR-like_helical_dom.
IPR001440. TPR_1.
IPR019734. TPR_repeat.
[Graphical view ]
Pfami PF01465. GRIP. 1 hit.
PF00638. Ran_BP1. 2 hits.
PF00515. TPR_1. 1 hit.
[Graphical view ]
SMARTi SM00755. Grip. 1 hit.
SM00160. RanBD. 2 hits.
[Graphical view ]
PROSITEi PS50913. GRIP. 1 hit.
PS50196. RANBD1. 2 hits.
PS50005. TPR. 1 hit.
PS50293. TPR_REGION. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Molecular cloning and characterization of a novel testis-specific nucleoporin-related gene."
    Wang L.F., Zhu H.D., Miao S.Y., Cao D.F., Wu Y.W., Zong S.D., Koide S.S.
    Arch. Androl. 42:71-84(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY.
    Tissue: Testis.
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
  3. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
    Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
    , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
    Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S., Ohara O., Nagase T., Kikuno R.F.
    Submitted (MAR-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1009-1765 (ISOFORM 1).
    Tissue: Brain.
  5. "Complex genomic rearrangements lead to novel primate gene function."
    Ciccarelli F.D., von Mering C., Suyama M., Harrington E.D., Izaurralde E., Bork P.
    Genome Res. 15:343-351(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUBCELLULAR LOCATION.
  6. "Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis."
    Cantin G.T., Yi W., Lu B., Park S.K., Xu T., Lee J.-D., Yates J.R. III
    J. Proteome Res. 7:1346-1351(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  7. "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle."
    Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M.
    Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  8. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-19 AND SER-21, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.

Entry informationi

Entry nameiRGPD5_HUMAN
AccessioniPrimary (citable) accession number: Q99666
Secondary accession number(s): Q53QN2
, Q53T03, Q59GM7, Q9H0B2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 6, 2005
Last sequence update: May 5, 2009
Last modified: November 26, 2014
This is version 113 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Miscellaneous

One of the 8 copies of RANBP2 clustered close to the chromosome 2 centromere.

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3