Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q99661

- KIF2C_HUMAN

UniProt

Q99661 - KIF2C_HUMAN

Protein

Kinesin-like protein KIF2C

Gene

KIF2C

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 149 (01 Oct 2014)
      Sequence version 2 (23 Jan 2002)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    In complex with KIF18B, constitutes the major microtubule plus-end depolymerizing activity in mitotic cells. Regulates the turnover of microtubules at the kinetochore and functions in chromosome segregation during mitosis.2 Publications

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Binding sitei264 – 2641ATPBy similarity

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Nucleotide bindingi348 – 3558ATP

    GO - Molecular functioni

    1. ATP binding Source: UniProtKB-KW
    2. centromeric DNA binding Source: ProtInc
    3. microtubule motor activity Source: ProtInc
    4. microtubule plus-end binding Source: UniProtKB
    5. protein binding Source: UniProtKB

    GO - Biological processi

    1. antigen processing and presentation of exogenous peptide antigen via MHC class II Source: Reactome
    2. blood coagulation Source: Reactome
    3. cell proliferation Source: ProtInc
    4. chromosome segregation Source: UniProtKB-KW
    5. establishment or maintenance of microtubule cytoskeleton polarity Source: HGNC
    6. metabolic process Source: GOC
    7. microtubule-based movement Source: Reactome
    8. microtubule depolymerization Source: UniProtKB
    9. mitotic cell cycle Source: Reactome
    10. mitotic nuclear division Source: ProtInc
    11. regulation of chromosome segregation Source: UniProtKB

    Keywords - Biological processi

    Cell cycle, Cell division, Chromosome partition, Mitosis

    Keywords - Ligandi

    ATP-binding, Nucleotide-binding

    Enzyme and pathway databases

    ReactomeiREACT_121399. MHC class II antigen presentation.
    REACT_150425. Resolution of Sister Chromatid Cohesion.
    REACT_150471. Separation of Sister Chromatids.
    REACT_25201. Kinesins.
    REACT_682. Mitotic Prometaphase.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Kinesin-like protein KIF2C
    Alternative name(s):
    Kinesin-like protein 6
    Mitotic centromere-associated kinesin
    Short name:
    MCAK
    Gene namesi
    Name:KIF2C
    Synonyms:KNSL6
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 1

    Organism-specific databases

    HGNCiHGNC:6393. KIF2C.

    Subcellular locationi

    Cytoplasmcytoskeleton By similarity. Nucleus By similarity. Chromosomecentromere. Chromosomecentromerekinetochore
    Note: Associates with the microtubule network at the growing distal tip (the plus-end) of microtubules, probably through interaction with MTUS2/TIP150 and MAPRE1 By similarity. Association with microtubule plus ends is also mediated by interaction with KIF18B. Centromeric localization requires the presence of BUB1 and SGOL2.By similarity

    GO - Cellular componenti

    1. chromosome, centromeric region Source: UniProtKB
    2. condensed chromosome kinetochore Source: UniProtKB-SubCell
    3. cytosol Source: Reactome
    4. kinesin complex Source: ProtInc
    5. membrane Source: UniProtKB
    6. microtubule cytoskeleton Source: LIFEdb
    7. microtubule plus-end Source: UniProtKB
    8. nucleus Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Centromere, Chromosome, Cytoplasm, Cytoskeleton, Kinetochore, Microtubule, Nucleus

    Pathology & Biotechi

    Mutagenesis

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Mutagenesisi95 – 951S → E: Alters interaction with MAPRE1 and association with microtubule growing ends; when associated with E-109 and E-111. 1 Publication
    Mutagenesisi100 – 1012IP → NN: Loss of interaction with MAPRE1 and association with microtubule growing ends.
    Mutagenesisi109 – 1091S → E: Alters interaction with MAPRE1 and association with microtubule growing ends; when associated with E-95 and E-111. 1 Publication
    Mutagenesisi111 – 1111S → E: Alters interaction with MAPRE1 and association with microtubule growing ends; when associated with E-95 and E-109. 1 Publication

    Organism-specific databases

    PharmGKBiPA30182.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Initiator methioninei1 – 11Removed1 Publication
    Chaini2 – 725724Kinesin-like protein KIF2CPRO_0000125418Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei2 – 21N-acetylalanine1 Publication
    Modified residuei22 – 221Phosphoserine1 Publication
    Modified residuei95 – 951Phosphoserine; by AURKB1 Publication
    Modified residuei109 – 1091PhosphoserineBy similarity
    Modified residuei111 – 1111PhosphoserineBy similarity
    Modified residuei115 – 1151PhosphoserineBy similarity
    Modified residuei166 – 1661Phosphoserine1 Publication
    Modified residuei192 – 1921PhosphoserineBy similarity
    Modified residuei621 – 6211Phosphoserine1 Publication
    Modified residuei633 – 6331Phosphoserine1 Publication

    Post-translational modificationi

    Phosphorylation by AURKB, regulates association with centromeres and kinetochores and the microtubule depolymerization activity.3 Publications
    Ubiquitinated.1 Publication

    Keywords - PTMi

    Acetylation, Phosphoprotein, Ubl conjugation

    Proteomic databases

    MaxQBiQ99661.
    PaxDbiQ99661.
    PRIDEiQ99661.

    PTM databases

    PhosphoSiteiQ99661.

    Expressioni

    Tissue specificityi

    Expressed at high levels in thymus and testis, at low levels in small intestine, the mucosal lining of colon, and placenta, and at very low levels in spleen and ovary; expression is not detected in prostate, peripheral blood Leukocytes, heart, brain, lung, liver, skeletal muscle, kidney or pancreas. Isoform 2 is testis-specific.2 Publications

    Developmental stagei

    Isoform 2 is expressed in fetal testis.1 Publication

    Gene expression databases

    ArrayExpressiQ99661.
    BgeeiQ99661.
    CleanExiHS_KIF2C.
    GenevestigatoriQ99661.

    Organism-specific databases

    HPAiHPA006432.

    Interactioni

    Subunit structurei

    Interacts with CENPH. Interacts with MTUS2/TIP150; the interaction is direct. Interacts with MAPRE1; the interaction is direct, regulated by phosphorylation and is probably required for targeting to growing microtubule plus ends. Interacts with KIF18B at microtubule tips; this interaction increases the affinity of both partners for microtubule plus ends and is required for robust microtubule depolymerization. Phosphorylation by AURKA or AURKB strongly reduces KIF18B-binding.5 Publications

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    MAPRE1Q156915EBI-1642317,EBI-1004115
    MTUS2Q5JR594EBI-1642317,EBI-742948

    Protein-protein interaction databases

    BioGridi116195. 15 interactions.
    IntActiQ99661. 12 interactions.
    MINTiMINT-4725759.
    STRINGi9606.ENSP00000361298.

    Structurei

    Secondary structure

    1
    725
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Helixi230 – 24213
    Beta strandi258 – 2658
    Helixi270 – 2745
    Beta strandi285 – 29612
    Beta strandi302 – 3109
    Beta strandi312 – 3154
    Helixi321 – 3277
    Helixi330 – 3378
    Beta strandi341 – 3488
    Helixi354 – 3585
    Helixi373 – 38513
    Helixi388 – 3914
    Turni392 – 3943
    Beta strandi396 – 40510
    Beta strandi408 – 4114
    Turni412 – 4165
    Beta strandi420 – 4234
    Beta strandi429 – 4324
    Beta strandi437 – 4415
    Helixi442 – 45514
    Helixi467 – 4693
    Beta strandi470 – 49223
    Helixi514 – 53118
    Helixi539 – 5413
    Helixi543 – 5475
    Helixi549 – 5524
    Beta strandi557 – 5659
    Helixi569 – 5713
    Helixi572 – 58514

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    2HEHX-ray2.15A225-593[»]
    ProteinModelPortaliQ99661.
    SMRiQ99661. Positions 192-587.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiQ99661.

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini258 – 588331Kinesin motorPROSITE-ProRule annotationAdd
    BLAST

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni2 – 254253GlobularSequence AnalysisAdd
    BLAST
    Regioni207 – 23832Negative regulator of microtubule-bindingBy similarityAdd
    BLAST

    Coiled coil

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Coiled coili618 – 65841Sequence AnalysisAdd
    BLAST

    Motif

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Motifi98 – 1014Microtubule tip localization signal
    Motifi415 – 4184Nuclear localization signalSequence Analysis

    Domaini

    The microtubule tip localization signal (MtLS) motif; mediates interaction with MAPRE1 and targeting to the growing microtubule plus ends.1 Publication

    Sequence similaritiesi

    Belongs to the TRAFAC class myosin-kinesin ATPase superfamily. Kinesin family. MCAK/KIF2 subfamily.PROSITE-ProRule annotation
    Contains 1 kinesin motor domain.PROSITE-ProRule annotation

    Keywords - Domaini

    Coiled coil

    Phylogenomic databases

    eggNOGiCOG5059.
    HOVERGENiHBG003875.
    InParanoidiQ99661.
    KOiK10393.
    OMAiDETASNE.
    PhylomeDBiQ99661.
    TreeFamiTF105222.

    Family and domain databases

    Gene3Di3.40.850.10. 1 hit.
    InterProiIPR027640. Kinesin-like_fam.
    IPR019821. Kinesin_motor_CS.
    IPR001752. Kinesin_motor_dom.
    IPR027417. P-loop_NTPase.
    [Graphical view]
    PANTHERiPTHR24115. PTHR24115. 1 hit.
    PfamiPF00225. Kinesin. 1 hit.
    [Graphical view]
    PRINTSiPR00380. KINESINHEAVY.
    SMARTiSM00129. KISc. 1 hit.
    [Graphical view]
    SUPFAMiSSF52540. SSF52540. 1 hit.
    PROSITEiPS00411. KINESIN_MOTOR_1. 1 hit.
    PS50067. KINESIN_MOTOR_2. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q99661-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MAMDSSLQAR LFPGLAIKIQ RSNGLIHSAN VRTVNLEKSC VSVEWAEGGA    50
    TKGKEIDFDD VAAINPELLQ LLPLHPKDNL PLQENVTIQK QKRRSVNSKI 100
    PAPKESLRSR STRMSTVSEL RITAQENDME VELPAAANSR KQFSVPPAPT 150
    RPSCPAVAEI PLRMVSEEME EQVHSIRGSS SANPVNSVRR KSCLVKEVEK 200
    MKNKREEKKA QNSEMRMKRA QEYDSSFPNW EFARMIKEFR ATLECHPLTM 250
    TDPIEEHRIC VCVRKRPLNK QELAKKEIDV ISIPSKCLLL VHEPKLKVDL 300
    TKYLENQAFC FDFAFDETAS NEVVYRFTAR PLVQTIFEGG KATCFAYGQT 350
    GSGKTHTMGG DLSGKAQNAS KGIYAMASRD VFLLKNQPCY RKLGLEVYVT 400
    FFEIYNGKLF DLLNKKAKLR VLEDGKQQVQ VVGLQEHLVN SADDVIKMID 450
    MGSACRTSGQ TFANSNSSRS HACFQIILRA KGRMHGKFSL VDLAGNERGA 500
    DTSSADRQTR MEGAEINKSL LALKECIRAL GQNKAHTPFR ESKLTQVLRD 550
    SFIGENSRTC MIATISPGIS SCEYTLNTLR YADRVKELSP HSGPSGEQLI 600
    QMETEEMEAC SNGALIPGNL SKEEEELSSQ MSSFNEAMTQ IRELEEKAME 650
    ELKEIIQQGP DWLELSEMTE QPDYDLETFV NKAESALAQQ AKHFSALRDV 700
    IKALRLAMQL EEQASRQISS KKRPQ 725
    Length:725
    Mass (Da):81,313
    Last modified:January 23, 2002 - v2
    Checksum:i5BDECC133AB4B55C
    GO
    Isoform 2 (identifier: Q99661-2) [UniParc]FASTAAdd to Basket

    Also known as: tsMCAK

    The sequence of this isoform differs from the canonical sequence as follows:
         1-55: MAMDSSLQARLFPGLAIKIQRSNGLIHSANVRTVNLEKSCVSVEWAEGGATKGKE → M

    Show »
    Length:671
    Mass (Da):75,561
    Checksum:i6A493B16911472C8
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti698 – 6981R → P in AAH08764. (PubMed:15489334)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti449 – 4491I → L.3 Publications
    Corresponds to variant rs4342887 [ dbSNP | Ensembl ].
    VAR_049683

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 5555MAMDS…TKGKE → M in isoform 2. 1 PublicationVSP_002866Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U63743 mRNA. Translation: AAC27660.1.
    AY026505 mRNA. Translation: AAK20168.1.
    BT006759 mRNA. Translation: AAP35405.1.
    CR450302 mRNA. Translation: CAG29298.1.
    AB264115 mRNA. Translation: BAG50306.1.
    AL592166 Genomic DNA. Translation: CAI12997.1.
    AL592166 Genomic DNA. Translation: CAI12999.1.
    CH471059 Genomic DNA. Translation: EAX07025.1.
    BC008764 mRNA. Translation: AAH08764.1.
    BC014924 mRNA. Translation: AAH14924.1.
    CCDSiCCDS512.1. [Q99661-1]
    RefSeqiNP_006836.2. NM_006845.3. [Q99661-1]
    XP_005270453.1. XM_005270396.1. [Q99661-2]
    UniGeneiHs.720061.

    Genome annotation databases

    EnsembliENST00000372217; ENSP00000361291; ENSG00000142945. [Q99661-2]
    ENST00000372224; ENSP00000361298; ENSG00000142945. [Q99661-1]
    GeneIDi11004.
    KEGGihsa:11004.
    UCSCiuc001cmg.4. human. [Q99661-1]
    uc001cmh.4. human. [Q99661-2]

    Polymorphism databases

    DMDMi20141607.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U63743 mRNA. Translation: AAC27660.1 .
    AY026505 mRNA. Translation: AAK20168.1 .
    BT006759 mRNA. Translation: AAP35405.1 .
    CR450302 mRNA. Translation: CAG29298.1 .
    AB264115 mRNA. Translation: BAG50306.1 .
    AL592166 Genomic DNA. Translation: CAI12997.1 .
    AL592166 Genomic DNA. Translation: CAI12999.1 .
    CH471059 Genomic DNA. Translation: EAX07025.1 .
    BC008764 mRNA. Translation: AAH08764.1 .
    BC014924 mRNA. Translation: AAH14924.1 .
    CCDSi CCDS512.1. [Q99661-1 ]
    RefSeqi NP_006836.2. NM_006845.3. [Q99661-1 ]
    XP_005270453.1. XM_005270396.1. [Q99661-2 ]
    UniGenei Hs.720061.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    2HEH X-ray 2.15 A 225-593 [» ]
    ProteinModelPortali Q99661.
    SMRi Q99661. Positions 192-587.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 116195. 15 interactions.
    IntActi Q99661. 12 interactions.
    MINTi MINT-4725759.
    STRINGi 9606.ENSP00000361298.

    Chemistry

    BindingDBi Q99661.
    ChEMBLi CHEMBL5967.

    PTM databases

    PhosphoSitei Q99661.

    Polymorphism databases

    DMDMi 20141607.

    Proteomic databases

    MaxQBi Q99661.
    PaxDbi Q99661.
    PRIDEi Q99661.

    Protocols and materials databases

    DNASUi 11004.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000372217 ; ENSP00000361291 ; ENSG00000142945 . [Q99661-2 ]
    ENST00000372224 ; ENSP00000361298 ; ENSG00000142945 . [Q99661-1 ]
    GeneIDi 11004.
    KEGGi hsa:11004.
    UCSCi uc001cmg.4. human. [Q99661-1 ]
    uc001cmh.4. human. [Q99661-2 ]

    Organism-specific databases

    CTDi 11004.
    GeneCardsi GC01P045208.
    HGNCi HGNC:6393. KIF2C.
    HPAi HPA006432.
    MIMi 604538. gene.
    neXtProti NX_Q99661.
    PharmGKBi PA30182.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG5059.
    HOVERGENi HBG003875.
    InParanoidi Q99661.
    KOi K10393.
    OMAi DETASNE.
    PhylomeDBi Q99661.
    TreeFami TF105222.

    Enzyme and pathway databases

    Reactomei REACT_121399. MHC class II antigen presentation.
    REACT_150425. Resolution of Sister Chromatid Cohesion.
    REACT_150471. Separation of Sister Chromatids.
    REACT_25201. Kinesins.
    REACT_682. Mitotic Prometaphase.

    Miscellaneous databases

    EvolutionaryTracei Q99661.
    GeneWikii KIF2C.
    GenomeRNAii 11004.
    NextBioi 41799.
    PROi Q99661.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q99661.
    Bgeei Q99661.
    CleanExi HS_KIF2C.
    Genevestigatori Q99661.

    Family and domain databases

    Gene3Di 3.40.850.10. 1 hit.
    InterProi IPR027640. Kinesin-like_fam.
    IPR019821. Kinesin_motor_CS.
    IPR001752. Kinesin_motor_dom.
    IPR027417. P-loop_NTPase.
    [Graphical view ]
    PANTHERi PTHR24115. PTHR24115. 1 hit.
    Pfami PF00225. Kinesin. 1 hit.
    [Graphical view ]
    PRINTSi PR00380. KINESINHEAVY.
    SMARTi SM00129. KISc. 1 hit.
    [Graphical view ]
    SUPFAMi SSF52540. SSF52540. 1 hit.
    PROSITEi PS00411. KINESIN_MOTOR_1. 1 hit.
    PS50067. KINESIN_MOTOR_2. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Cloning and expression of human mitotic centromere-associated kinesin gene."
      Kim I.-G., Jun D.Y., Sohn U., Kim Y.H.
      Biochim. Biophys. Acta 1359:181-186(1997) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT LEU-449, TISSUE SPECIFICITY.
      Tissue: T-cell.
    2. "Expression of a novel HsMCAK mRNA splice variant, tsMCAK gene, in human testis."
      Cheng L.J., Zhou Z.M., Li J.M., Zhu H., Zhu H., Zhou Y.D., Wang L.R., Lin M., Sha J.H.
      Life Sci. 71:2741-2757(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), VARIANT LEU-449, TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.
      Tissue: Testis.
    3. "Cloning of human full-length CDSs in BD Creator(TM) system donor vector."
      Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A.
      Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    4. "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)."
      Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
      Submitted (MAY-2004) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    5. "MCAK/KIF2c V1."
      Katagiri T., Shimo A.
      Submitted (JUN-2006) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT LEU-449.
    6. "The DNA sequence and biological annotation of human chromosome 1."
      Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
      , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
      Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    8. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Kidney and Uterus.
    9. "Human CENP-H multimers colocalize with CENP-A and CENP-C at active centromere-kinetochore complexes."
      Sugata N., Li S., Earnshaw W.C., Yen T.J., Yoda K., Masumoto H., Munekata E., Warburton P.E., Todokoro K.
      Hum. Mol. Genet. 9:2919-2926(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH CENPH.
    10. Cited for: PHOSPHORYLATION AT SER-95 BY AURKB, SUBCELLULAR LOCATION.
    11. "Tripin/hSgo2 recruits MCAK to the inner centromere to correct defective kinetochore attachments."
      Huang H., Feng J., Famulski J., Rattner J.B., Liu S.T., Kao G.D., Muschel R., Chan G.K., Yen T.J.
      J. Cell Biol. 177:413-424(2007) [PubMed] [Europe PMC] [Abstract]
      Cited for: SUBCELLULAR LOCATION.
    12. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Embryonic kidney.
    13. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-166, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    14. Cited for: INTERACTION WITH MAPRE1, SUBCELLULAR LOCATION, DOMAIN MICROTUBULE TIP LOCALIZATION SIGNAL, MUTAGENESIS OF SER-95; 100-ILE-PRO-101; SER-109 AND SER-111.
    15. "TIP150 interacts with and targets MCAK at the microtubule plus ends."
      Jiang K., Wang J., Liu J., Ward T., Wordeman L., Davidson A., Wang F., Yao X.
      EMBO Rep. 10:857-865(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH MTUS2 AND MAPRE1.
    16. "Genome stability is ensured by temporal control of kinetochore-microtubule dynamics."
      Bakhoum S.F., Thompson S.L., Manning A.L., Compton D.A.
      Nat. Cell Biol. 11:27-35(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION.
    17. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
      Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
      Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Leukemic T-cell.
    18. "Development and validation of a method for profiling post-translational modification activities using protein microarrays."
      Del Rincon S.V., Rogers J., Widschwendter M., Sun D., Sieburg H.B., Spruck C.
      PLoS ONE 5:E11332-E11332(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: UBIQUITINATION.
    19. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
      Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
      Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-22; SER-621 AND SER-633, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    20. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    21. "A complex of Kif18b and MCAK promotes microtubule depolymerization and is negatively regulated by Aurora kinases."
      Tanenbaum M.E., Macurek L., van der Vaart B., Galli M., Akhmanova A., Medema R.H.
      Curr. Biol. 21:1356-1365(2011) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, INTERACTION WITH KIF18B.
    22. Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS], CLEAVAGE OF INITIATOR METHIONINE [LARGE SCALE ANALYSIS].
    23. "Crystal structure of the KIF2C motor domain."
      Structural genomics consortium (SGC)
      Submitted (FEB-2009) to the PDB data bank
      Cited for: X-RAY CRYSTALLOGRAPHY (2.15 ANGSTROMS) OF 225-593 IN COMPLEX WITH ADP.

    Entry informationi

    Entry nameiKIF2C_HUMAN
    AccessioniPrimary (citable) accession number: Q99661
    Secondary accession number(s): B3ITR9
    , Q5JR88, Q6ICU1, Q96C18, Q96HB8, Q9BWV8
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: January 11, 2001
    Last sequence update: January 23, 2002
    Last modified: October 1, 2014
    This is version 149 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. Human chromosome 1
      Human chromosome 1: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    6. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3