Q99661 (KIF2C_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 120.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Kinesin-like protein KIF2C Alternative name(s): Kinesin-like protein 6 Mitotic centromere-associated kinesin Short name=MCAK | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 725 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Promotes ATP-dependent removal of tubulin dimers from microtubules. Regulates the turnover of microtubules at the kinetochore and functions in chromosome segregation during mitosis. Ref.18 |
| Subunit structure | Interacts with CENPH. Interacts with MTUS2/TIP150; the interaction is direct. Interacts with MAPRE1; the interaction is direct, regulated by phosphorylation and is probably required for targeting to growing microtubule plus ends. Ref.9 Ref.16 Ref.17 |
| Subcellular location | Cytoplasm › cytoskeleton By similarity. Nucleus By similarity. Chromosome › centromere. Chromosome › centromere › kinetochore. Note: Associates with the microtubule network at the growing distal tip (the plus-end) of microtubules, probably through interaction with MTUS2/TIP150 and MAPRE1 By similarity. Centromeric localization requires the presence of BUB1 and SGOL2. Ref.10 Ref.12 Ref.16 |
| Tissue specificity | Expressed at high levels in thymus and testis, at low levels in small intestine, the mucosal lining of colon, and placenta, and at very low levels in spleen and ovary; expression is not detected in prostate, peripheral blood Leukocytes, heart, brain, lung, liver, skeletal muscle, kidney or pancreas. Isoform 2 is testis-specific. Ref.1 Ref.2 |
| Developmental stage | |
| Domain | The microtubule tip localization signal (MtLS) motif; mediates interaction with MAPRE1 and targeting to the growing microtubule plus ends. Ref.16 |
| Post-translational modification | Phosphorylated upon DNA damage, probably by ATM or ATR. Phosphorylation by AURKB, regulates association with centromeres and kinetochores and the microtubule depolymerization activity. Ref.10 Ref.11 Ref.13 Ref.14 Ref.15 |
| Sequence similarities | Belongs to the kinesin-like protein family. MCAK/KIF2 subfamily. Contains 1 kinesin-motor domain. |
Ontologies
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q99661-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q99661-2) Also known as: tsMCAK; The sequence of this isoform differs from the canonical sequence as follows: 1-55: MAMDSSLQARLFPGLAIKIQRSNGLIHSANVRTVNLEKSCVSVEWAEGGATKGKE → M |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 725 | 725 | Kinesin-like protein KIF2C | PRO_0000125418 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 255 – 518 | 264 | Kinesin-motor | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Nucleotide binding | 348 – 355 | 8 | ATP | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 1 – 254 | 254 | Globular Potential | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 207 – 238 | 32 | Negative regulator of microtubule-binding By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Coiled coil | 618 – 658 | 41 | Potential | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Motif | 98 – 101 | 4 | Microtubule tip localization signal | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Motif | 415 – 418 | 4 | Nuclear localization signal Potential | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sites | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 264 | 1 | ATP By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 95 | 1 | Phosphoserine; by AURKB Ref.10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 106 | 1 | Phosphoserine Ref.15 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 109 | 1 | Phosphoserine By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 111 | 1 | Phosphoserine By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 115 | 1 | Phosphoserine Ref.14 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 166 | 1 | Phosphoserine Ref.15 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 179 | 1 | Phosphoserine Ref.14 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 192 | 1 | Phosphoserine By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 628 | 1 | Phosphoserine Ref.11 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 629 | 1 | Phosphoserine Ref.11 Ref.13 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 632 | 1 | Phosphoserine Ref.11 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 633 | 1 | Phosphoserine Ref.11 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 55 | 55 | MAMDS…TKGKE → M in isoform 2. | VSP_002866 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 449 | 1 | I → L. Ref.1 Ref.2 Ref.5 Corresponds to variant rs4342887 [ dbSNP | Ensembl ]. | VAR_049683 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 95 | 1 | S → E: Alters interaction with MAPRE1 and association with microtubule growing ends; when associated with E-109 and E-111. Ref.16 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 100 – 101 | 2 | IP → NN: Loss of interaction with MAPRE1 and association with microtubule growing ends. | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 109 | 1 | S → E: Alters interaction with MAPRE1 and association with microtubule growing ends; when associated with E-95 and E-111. Ref.16 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 111 | 1 | S → E: Alters interaction with MAPRE1 and association with microtubule growing ends; when associated with E-95 and E-109. Ref.16 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 698 | 1 | R → P in AAH08764. Ref.8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 230 – 242 | 13 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 258 – 265 | 8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 270 – 274 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 285 – 296 | 12 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 302 – 310 | 9 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 312 – 315 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 321 – 327 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 330 – 337 | 8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 341 – 348 | 8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 354 – 358 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 373 – 385 | 13 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 388 – 391 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 392 – 394 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 396 – 405 | 10 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 408 – 411 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 412 – 416 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 420 – 423 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 429 – 432 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 437 – 441 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 442 – 455 | 14 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 467 – 469 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 470 – 492 | 23 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 514 – 531 | 18 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 539 – 541 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 543 – 547 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 549 – 552 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 557 – 565 | 9 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 569 – 571 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 572 – 585 | 14 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cloning and expression of human mitotic centromere-associated kinesin gene." Kim I.-G., Jun D.Y., Sohn U., Kim Y.H. Biochim. Biophys. Acta 1359:181-186(1997) [PubMed: 9434124] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT LEU-449, TISSUE SPECIFICITY. Tissue: T-cell. |
| [2] | "Expression of a novel HsMCAK mRNA splice variant, tsMCAK gene, in human testis." Cheng L.J., Zhou Z.M., Li J.M., Zhu H., Zhu H., Zhou Y.D., Wang L.R., Lin M., Sha J.H. Life Sci. 71:2741-2757(2002) [PubMed: 12383881] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), VARIANT LEU-449, TISSUE SPECIFICITY, DEVELOPMENTAL STAGE. Tissue: Testis. |
| [3] | "Cloning of human full-length CDSs in BD Creator(TM) system donor vector." Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A. Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [4] | "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)." Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. Submitted (MAY-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [5] | "MCAK/KIF2c V1." Katagiri T., Shimo A. Submitted (JUN-2006) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT LEU-449. |
| [6] | "The DNA sequence and biological annotation of human chromosome 1." Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. Bentley D.R.Nature 441:315-321(2006) [PubMed: 16710414] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [8] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Kidney and Uterus. |
| [9] | "Human CENP-H multimers colocalize with CENP-A and CENP-C at active centromere-kinetochore complexes." Sugata N., Li S., Earnshaw W.C., Yen T.J., Yoda K., Masumoto H., Munekata E., Warburton P.E., Todokoro K. Hum. Mol. Genet. 9:2919-2926(2000) [PubMed: 11092768] [Abstract] Cited for: INTERACTION WITH CENPH. |
| [10] | "Aurora B regulates MCAK at the mitotic centromere." Andrews P.D., Ovechkina Y., Morrice N., Wagenbach M., Duncan K., Wordeman L., Swedlow J.R. Dev. Cell 6:253-268(2004) [PubMed: 14960279] [Abstract] Cited for: PHOSPHORYLATION AT SER-95 BY AURKB, SUBCELLULAR LOCATION. |
| [11] | "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M. Cell 127:635-648(2006) [PubMed: 17081983] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-628; SER-629; SER-632 AND SER-633, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [12] | "Tripin/hSgo2 recruits MCAK to the inner centromere to correct defective kinetochore attachments." Huang H., Feng J., Famulski J., Rattner J.B., Liu S.T., Kao G.D., Muschel R., Chan G.K., Yen T.J. J. Cell Biol. 177:413-424(2007) [PubMed: 17485487] [Abstract] Cited for: SUBCELLULAR LOCATION. |
| [13] | "ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage." Matsuoka S., Ballif B.A., Smogorzewska A., McDonald E.R. III, Hurov K.E., Luo J., Bakalarski C.E., Zhao Z., Solimini N., Lerenthal Y., Shiloh Y., Gygi S.P., Elledge S.J. Science 316:1160-1166(2007) [PubMed: 17525332] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-629, MASS SPECTROMETRY. Tissue: Embryonic kidney. |
| [14] | "Evaluation of the low-specificity protease elastase for large-scale phosphoproteome analysis." Wang B., Malik R., Nigg E.A., Korner R. Anal. Chem. 80:9526-9533(2008) [PubMed: 19007248] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-115 AND SER-179, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [15] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed: 18669648] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-106 AND SER-166, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [16] | "An EB1-binding motif acts as a microtubule tip localization signal." Honnappa S., Gouveia S.M., Weisbrich A., Damberger F.F., Bhavesh N.S., Jawhari H., Grigoriev I., van Rijssel F.J., Buey R.M., Lawera A., Jelesarov I., Winkler F.K., Wuthrich K., Akhmanova A., Steinmetz M.O. Cell 138:366-376(2009) [PubMed: 19632184] [Abstract] Cited for: INTERACTION WITH MAPRE1, SUBCELLULAR LOCATION, DOMAIN MICROTUBULE TIP LOCALIZATION SIGNAL, MUTAGENESIS OF SER-95; 100-ILE-PRO-101; SER-109 AND SER-111. |
| [17] | "TIP150 interacts with and targets MCAK at the microtubule plus ends." Jiang K., Wang J., Liu J., Ward T., Wordeman L., Davidson A., Wang F., Yao X. EMBO Rep. 10:857-865(2009) [PubMed: 19543227] [Abstract] Cited for: INTERACTION WITH MTUS2 AND MAPRE1. |
| [18] | "Genome stability is ensured by temporal control of kinetochore-microtubule dynamics." Bakhoum S.F., Thompson S.L., Manning A.L., Compton D.A. Nat. Cell Biol. 11:27-35(2009) [PubMed: 19060894] [Abstract] Cited for: FUNCTION. |
| [19] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed: 21269460] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [20] | "Crystal structure of the KIF2C motor domain." Structural genomics consortium (SGC) Submitted (FEB-2009) to the PDB data bank Cited for: X-RAY CRYSTALLOGRAPHY (2.15 ANGSTROMS) OF 225-593 IN COMPLEX WITH ADP. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | U63743 mRNA. Translation: AAC27660.1. AY026505 mRNA. Translation: AAK20168.1. BT006759 mRNA. Translation: AAP35405.1. CR450302 mRNA. Translation: CAG29298.1. AB264115 mRNA. Translation: BAG50306.1. AL592166 Genomic DNA. Translation: CAI12997.1. AL592166 Genomic DNA. Translation: CAI12999.1. CH471059 Genomic DNA. Translation: EAX07025.1. BC008764 mRNA. Translation: AAH08764.1. BC014924 mRNA. Translation: AAH14924.1. | ||||||||||||
| IPI | IPI00216113. IPI00290435. | ||||||||||||
| RefSeq | NP_006836.2. NM_006845.3. | ||||||||||||
| UniGene | Hs.720061. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | Q99661. | ||||||||||||
| SMR | Q99661. Positions 196-589. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| IntAct | Q99661. 4 interactions. | ||||||||||||
| MINT | MINT-4725759. | ||||||||||||
| STRING | Q99661. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | Q99661. | ||||||||||||
Polymorphism databases | |||||||||||||
| DMDM | 20141607. | ||||||||||||
Proteomic databases | |||||||||||||
| PRIDE | Q99661. | ||||||||||||
Protocols and materials databases | |||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000372224; ENSP00000361298; ENSG00000142945. | ||||||||||||
| GeneID | 11004. | ||||||||||||
| KEGG | hsa:11004. | ||||||||||||
| UCSC | uc001cmg.2. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 11004. | ||||||||||||
| GeneCards | GC01P045208. | ||||||||||||
| H-InvDB | HIX0028504. | ||||||||||||
| HGNC | HGNC:6393. KIF2C. | ||||||||||||
| HPA | HPA006432. | ||||||||||||
| MIM | 604538. gene. | ||||||||||||
| neXtProt | NX_Q99661. | ||||||||||||
| PharmGKB | PA30182. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | prNOG10951. | ||||||||||||
| GeneTree | ENSGT00600000084047. | ||||||||||||
| HOGENOM | HBG746568. | ||||||||||||
| HOVERGEN | HBG003875. | ||||||||||||
| InParanoid | Q99661. | ||||||||||||
| OMA | IQRSNGL. | ||||||||||||
| OrthoDB | EOG43JC44. | ||||||||||||
| PhylomeDB | Q99661. | ||||||||||||
Enzyme and pathway databases | |||||||||||||
| Pathway_Interaction_DB | aurora_b_pathway. Aurora B signaling. | ||||||||||||
| Reactome | REACT_152. Cell Cycle, Mitotic. REACT_383. DNA Replication. REACT_604. Hemostasis. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | Q99661. | ||||||||||||
| Bgee | Q99661. | ||||||||||||
| CleanEx | HS_KIF2C. | ||||||||||||
| Genevestigator | Q99661. | ||||||||||||
| GermOnline | ENSG00000142945. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| InterPro | IPR019821. Kinesin_motor_CS. IPR001752. Kinesin_motor_dom. [Graphical view] | ||||||||||||
| Gene3D | G3DSA:3.40.850.10. kinesin_motor. 1 hit. | ||||||||||||
| KO | K10393. | ||||||||||||
| Pfam | PF00225. Kinesin. 1 hit. [Graphical view] | ||||||||||||
| PRINTS | PR00380. KINESINHEAVY. | ||||||||||||
| SMART | SM00129. KISc. 1 hit. [Graphical view] | ||||||||||||
| PROSITE | PS00411. KINESIN_MOTOR_DOMAIN1. 1 hit. PS50067. KINESIN_MOTOR_DOMAIN2. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| NextBio | 41799. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | KIF2C_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q99661 Secondary accession number(s): B3ITR9 Q9BWV8 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 1 Human chromosome 1: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with