Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q99612 (KLF6_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 146. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Krueppel-like factor 6
Alternative name(s):
B-cell-derived protein 1
Core promoter element-binding protein
GC-rich sites-binding factor GBF
Proto-oncogene BCD1
Suppressor of tumorigenicity 12 protein
Transcription factor Zf9
Gene names
Name:KLF6
Synonyms:BCD1, COPEB, CPBP, ST12
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length283 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Transcriptional activator By similarity. Binds a GC box motif. Could play a role in B-cell growth and development.

Subcellular location

Nucleus.

Tissue specificity

Highly expressed in placenta followed by spleen, thymus, prostate, testis, small intestine and colon. Weakly expressed in pancreas, lung, liver, heart and skeletal muscle. Also expressed in fetal brain, spleen and thymus.

Domain

The acidic N-terminal part may favor interaction with the basic domain of transcription factors.

Involvement in disease

Gastric cancer (GASC) [MIM:613659]: A malignant disease which starts in the stomach, can spread to the esophagus or the small intestine, and can extend through the stomach wall to nearby lymph nodes and organs. It also can metastasize to other parts of the body. The term gastric cancer or gastric carcinoma refers to adenocarcinoma of the stomach that accounts for most of all gastric malignant tumors. Two main histologic types are recognized, diffuse type and intestinal type carcinomas. Diffuse tumors are poorly differentiated infiltrating lesions, resulting in thickening of the stomach. In contrast, intestinal tumors are usually exophytic, often ulcerating, and associated with intestinal metaplasia of the stomach, most often observed in sporadic disease.
Note: The disease is caused by mutations affecting the gene represented in this entry. Ref.12

Prostate cancer (PC) [MIM:176807]: A malignancy originating in tissues of the prostate. Most prostate cancers are adenocarcinomas that develop in the acini of the prostatic ducts. Other rare histopathologic types of prostate cancer that occur in approximately 5% of patients include small cell carcinoma, mucinous carcinoma, prostatic ductal carcinoma, transitional cell carcinoma, squamous cell carcinoma, basal cell carcinoma, adenoid cystic carcinoma (basaloid), signet-ring cell carcinoma and neuroendocrine carcinoma.
Note: The disease is caused by mutations affecting the gene represented in this entry. Ref.11

Sequence similarities

Belongs to the krueppel C2H2-type zinc-finger protein family.

Contains 3 C2H2-type zinc fingers.

Sequence caution

The sequence AAC23699.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

The sequence BAA33050.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q99612-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q99612-2)

The sequence of this isoform differs from the canonical sequence as follows:
     227-283: EKPYRCSWEG...HLALHMKRHL → QCPRGPRRAA...QSIRSFWSSE
Note: No experimental confirmation available.
Isoform 3 (identifier: Q99612-3)

The sequence of this isoform differs from the canonical sequence as follows:
     227-283: EKPYRCSWEGCEWRFARSDELTRHFRKHTGAKPFKCSHCDRCFSRSDHLALHMKRHL → VFPGLTTWPCT

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 283283Krueppel-like factor 6
PRO_0000047171

Regions

Zinc finger200 – 22425C2H2-type 1
Zinc finger230 – 25425C2H2-type 2
Zinc finger260 – 28223C2H2-type 3

Natural variations

Alternative sequence227 – 28357EKPYR…MKRHL → QCPRGPRRAAAGGRHCIAPA LEGAGPGCTGCGQGRQILTS SDVFHQSIRSFWSSE in isoform 2.
VSP_015715
Alternative sequence227 – 28357EKPYR…MKRHL → VFPGLTTWPCT in isoform 3.
VSP_045808
Natural variant641W → R Found in prostate cancer samples; somatic mutation; does not up-regulates CDKN1A in a p53-independent manner and significantly reduces cell proliferation. Ref.11
VAR_065136
Natural variant1161S → P Found in prostate cancer samples; somatic mutation; does not up-regulates CDKN1A in a p53-independent manner and significantly reduces cell proliferation. Ref.11
VAR_065137
Natural variant1231A → D Found in prostate cancer samples; somatic mutation; does not up-regulates CDKN1A in a p53-independent manner and significantly reduces cell proliferation. Ref.11
VAR_065138
Natural variant1551S → R Found in gastric cancer samples; somatic mutation. Ref.12
VAR_065139
Natural variant1691L → P Found in prostate cancer samples; somatic mutation; does not up-regulates CDKN1A in a p53-independent manner and significantly reduces cell proliferation. Ref.11
VAR_065140
Natural variant1721P → T Found in gastric cancer samples; somatic mutation. Ref.12
VAR_065141
Natural variant1801S → L Found in gastric cancer samples; somatic mutation. Ref.12
VAR_065142
Natural variant1981R → K Found in gastric cancer samples; somatic mutation. Ref.12
VAR_065143

Experimental info

Sequence conflict2761A → G in AAC39929. Ref.3

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified May 30, 2000. Version 3.
Checksum: 84294A7E6D0A0231

FASTA28331,865
        10         20         30         40         50         60 
MDVLPMCSIF QELQIVHETG YFSALPSLEE YWQQTCLELE RYLQSEPCYV SASEIKFDSQ 

        70         80         90        100        110        120 
EDLWTKIILA REKKEESELK ISSSPPEDTL ISPSFCYNLE TNSLNSDVSS ESSDSSEELS 

       130        140        150        160        170        180 
PTAKFTSDPI GEVLVSSGKL SSSVTSTPPS SPELSREPSQ LWGCVPGELP SPGKVRSGTS 

       190        200        210        220        230        240 
GKPGDKGNGD ASPDGRRRVH RCHFNGCRKV YTKSSHLKAH QRTHTGEKPY RCSWEGCEWR 

       250        260        270        280 
FARSDELTRH FRKHTGAKPF KCSHCDRCFS RSDHLALHMK RHL 

« Hide

Isoform 2 [UniParc].

Checksum: 99ECF169C9933D03
Show »

FASTA28130,615
Isoform 3 [UniParc].

Checksum: C83EEA8CC9654022
Show »

FASTA23726,110

References

« Hide 'large scale' references
[1]"Identification of Bcd, a novel proto-oncogene expressed in B-cells."
El Rouby S., Newcomb E.W.
Oncogene 13:2623-2630(1996) [PubMed] [Europe PMC] [Abstract]
Cited for: PRELIMINARY NUCLEOTIDE SEQUENCE (ISOFORM 1).
[2]"A novel human zinc finger protein that interacts with the core promoter element of a TATA box-less gene."
Koritschoner N.P., Bocco J.L., Panzetta-Dutari G.M., Dumur C.I., Flury A., Patrito L.C.
J. Biol. Chem. 272:9573-9580(1997) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
Tissue: Placenta.
[3]"Zf9, a Kruppel-like transcription factor up-regulated in vivo during early hepatic fibrosis."
Ratziu V., Lalazar A., Wong L., Dang Q., Collins C., Shaulian E., Jensen S., Friedman S.L.
Proc. Natl. Acad. Sci. U.S.A. 95:9500-9505(1998) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
Tissue: Hepatic stellate cell.
[4]"Isolation and initial characterization of GBF, a novel DNA-binding zinc finger protein that binds to the GC-rich binding sites of the HIV-1 promoter."
Suzuki T., Yamamoto T., Kurabayashi M., Nagai R., Yazaki Y., Horikoshi M.
J. Biochem. 124:389-395(1998) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), CHARACTERIZATION.
Tissue: Leukocyte.
[5]"Genomic organization of the human COPEB/CPBP locus."
Koritschoner N.P.
Submitted (JUN-2000) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
[6]"Cloning of human full-length CDSs in BD Creator(TM) system donor vector."
Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A.
Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
[7]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
Tissue: Brain.
[8]"The DNA sequence and comparative analysis of human chromosome 10."
Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J. expand/collapse author list , Bird C.P., Ainscough R., Almeida J.P., Ashwell R.I.S., Ambrose K.D., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Bates K., Beasley H., Bray-Allen S., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Cahill P., Camire D., Carter N.P., Chapman J.C., Clark S.Y., Clarke G., Clee C.M., Clegg S., Corby N., Coulson A., Dhami P., Dutta I., Dunn M., Faulkner L., Frankish A., Frankland J.A., Garner P., Garnett J., Gribble S., Griffiths C., Grocock R., Gustafson E., Hammond S., Harley J.L., Hart E., Heath P.D., Ho T.P., Hopkins B., Horne J., Howden P.J., Huckle E., Hynds C., Johnson C., Johnson D., Kana A., Kay M., Kimberley A.M., Kershaw J.K., Kokkinaki M., Laird G.K., Lawlor S., Lee H.M., Leongamornlert D.A., Laird G., Lloyd C., Lloyd D.M., Loveland J., Lovell J., McLaren S., McLay K.E., McMurray A., Mashreghi-Mohammadi M., Matthews L., Milne S., Nickerson T., Nguyen M., Overton-Larty E., Palmer S.A., Pearce A.V., Peck A.I., Pelan S., Phillimore B., Porter K., Rice C.M., Rogosin A., Ross M.T., Sarafidou T., Sehra H.K., Shownkeen R., Skuce C.D., Smith M., Standring L., Sycamore N., Tester J., Thorpe A., Torcasso W., Tracey A., Tromans A., Tsolas J., Wall M., Walsh J., Wang H., Weinstock K., West A.P., Willey D.L., Whitehead S.L., Wilming L., Wray P.W., Young L., Chen Y., Lovering R.C., Moschonas N.K., Siebert R., Fechtel K., Bentley D., Durbin R.M., Hubbard T., Doucette-Stamm L., Beck S., Smith D.R., Rogers J.
Nature 429:375-381(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[9]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[10]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Lung.
[11]"KLF6, a candidate tumor suppressor gene mutated in prostate cancer."
Narla G., Heath K.E., Reeves H.L., Li D., Giono L.E., Kimmelman A.C., Glucksman M.J., Narla J., Eng F.J., Chan A.M., Ferrari A.C., Martignetti J.A., Friedman S.L.
Science 294:2563-2566(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: INVOLVEMENT IN PC, VARIANTS ARG-64; PRO-116; ASP-123 AND PRO-169, CHARACTERIZATION OF VARIANTS ARG-64; PRO-116; ASP-123 AND PRO-169.
[12]"Genetic alterations of the KLF6 gene in gastric cancer."
Cho Y.G., Kim C.J., Park C.H., Yang Y.M., Kim S.Y., Nam S.W., Lee S.H., Yoo N.J., Lee J.Y., Park W.S.
Oncogene 24:4588-4590(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: INVOLVEMENT IN GASC, VARIANTS ARG-155; THR-172; LEU-180 AND LYS-198.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
U44975 mRNA. Translation: AAC23699.1. Different initiation.
AF001461 mRNA. Translation: AAC39929.1.
AB017493 mRNA. Translation: BAA33050.1. Different initiation.
AF284036 Genomic DNA. Translation: AAM73548.1.
BT006778 mRNA. Translation: AAP35424.1.
AL513303, AL450322 Genomic DNA. Translation: CAH74049.1.
AK293259 mRNA. Translation: BAG56791.1.
AK316596 mRNA. Translation: BAG38183.1.
AL513303, AL450322 Genomic DNA. Translation: CAH74050.1.
AL450322, AL513303 Genomic DNA. Translation: CAH71010.1.
AL450322, AL513303 Genomic DNA. Translation: CAH71011.1.
CH471072 Genomic DNA. Translation: EAW86477.1.
CH471072 Genomic DNA. Translation: EAW86479.1.
BC000311 mRNA. Translation: AAH00311.1.
CCDSCCDS53490.1. [Q99612-3]
CCDS7060.1. [Q99612-1]
PIRJE0235.
RefSeqNP_001153596.1. NM_001160124.1.
NP_001153597.1. NM_001160125.1. [Q99612-3]
NP_001291.3. NM_001300.5. [Q99612-1]
UniGeneHs.4055.
Hs.709396.

3D structure databases

ProteinModelPortalQ99612.
SMRQ99612. Positions 200-283.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid107711. 17 interactions.
IntActQ99612. 8 interactions.
MINTMINT-250061.
STRING9606.ENSP00000419923.

PTM databases

PhosphoSiteQ99612.

Polymorphism databases

DMDM7387592.

Proteomic databases

MaxQBQ99612.
PaxDbQ99612.
PRIDEQ99612.

Protocols and materials databases

DNASU1316.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000469435; ENSP00000419079; ENSG00000067082. [Q99612-2]
ENST00000497571; ENSP00000419923; ENSG00000067082. [Q99612-1]
ENST00000542957; ENSP00000445301; ENSG00000067082. [Q99612-3]
GeneID1316.
KEGGhsa:1316.
UCSCuc001iha.3. human. [Q99612-1]
uc001ihb.2. human. [Q99612-2]

Organism-specific databases

CTD1316.
GeneCardsGC10M003812.
HGNCHGNC:2235. KLF6.
HPACAB013529.
MIM176807. phenotype.
602053. gene.
613659. phenotype.
neXtProtNX_Q99612.
PharmGKBPA26751.
GenAtlasSearch...

Phylogenomic databases

eggNOGCOG5048.
HOGENOMHOG000231192.
HOVERGENHBG000836.
InParanoidQ99612.
KOK09207.
OMARRYHEFV.
OrthoDBEOG747PJ4.
PhylomeDBQ99612.
TreeFamTF350556.

Enzyme and pathway databases

SignaLinkQ99612.

Gene expression databases

ArrayExpressQ99612.
BgeeQ99612.
CleanExHS_KLF6.
GenevestigatorQ99612.

Family and domain databases

Gene3D3.30.160.60. 3 hits.
InterProIPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view]
SMARTSM00355. ZnF_C2H2. 3 hits.
[Graphical view]
PROSITEPS00028. ZINC_FINGER_C2H2_1. 3 hits.
PS50157. ZINC_FINGER_C2H2_2. 3 hits.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSKLF6. human.
GeneWikiKLF6.
GenomeRNAi1316.
NextBio5383.
PROQ99612.
SOURCESearch...

Entry information

Entry nameKLF6_HUMAN
AccessionPrimary (citable) accession number: Q99612
Secondary accession number(s): B2RE86 expand/collapse secondary AC list , B4DDN0, D3DRR1, F5H3M5, Q5VUT7, Q5VUT8, Q9BT79
Entry history
Integrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: May 30, 2000
Last modified: July 9, 2014
This is version 146 of the entry and version 3 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 10

Human chromosome 10: entries, gene names and cross-references to MIM