Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Krueppel-like factor 6

Gene

KLF6

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Transcriptional activator (By similarity). Binds a GC box motif. Could play a role in B-cell growth and development.By similarity

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri200 – 22425C2H2-type 1PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri230 – 25425C2H2-type 2PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri260 – 28223C2H2-type 3PROSITE-ProRule annotationAdd
BLAST

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Activator

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding, Metal-binding, Zinc

Enzyme and pathway databases

SignaLinkiQ99612.

Names & Taxonomyi

Protein namesi
Recommended name:
Krueppel-like factor 6
Alternative name(s):
B-cell-derived protein 1
Core promoter element-binding protein
GC-rich sites-binding factor GBF
Proto-oncogene BCD1
Suppressor of tumorigenicity 12 protein
Transcription factor Zf9
Gene namesi
Name:KLF6
Synonyms:BCD1, COPEB, CPBP, ST12
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640 Componenti: Chromosome 10

Organism-specific databases

HGNCiHGNC:2235. KLF6.

Subcellular locationi

GO - Cellular componenti

  • nucleus Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Involvement in diseasei

Gastric cancer (GASC)1 Publication

The disease is caused by mutations affecting the gene represented in this entry.

Disease descriptionA malignant disease which starts in the stomach, can spread to the esophagus or the small intestine, and can extend through the stomach wall to nearby lymph nodes and organs. It also can metastasize to other parts of the body. The term gastric cancer or gastric carcinoma refers to adenocarcinoma of the stomach that accounts for most of all gastric malignant tumors. Two main histologic types are recognized, diffuse type and intestinal type carcinomas. Diffuse tumors are poorly differentiated infiltrating lesions, resulting in thickening of the stomach. In contrast, intestinal tumors are usually exophytic, often ulcerating, and associated with intestinal metaplasia of the stomach, most often observed in sporadic disease.

See also OMIM:613659
Prostate cancer (PC)1 Publication

The disease is caused by mutations affecting the gene represented in this entry.

Disease descriptionA malignancy originating in tissues of the prostate. Most prostate cancers are adenocarcinomas that develop in the acini of the prostatic ducts. Other rare histopathologic types of prostate cancer that occur in approximately 5% of patients include small cell carcinoma, mucinous carcinoma, prostatic ductal carcinoma, transitional cell carcinoma, squamous cell carcinoma, basal cell carcinoma, adenoid cystic carcinoma (basaloid), signet-ring cell carcinoma and neuroendocrine carcinoma.

See also OMIM:176807

Organism-specific databases

MIMi176807. phenotype.
613659. phenotype.
PharmGKBiPA26751.

Polymorphism and mutation databases

BioMutaiKLF6.
DMDMi7387592.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 283283Krueppel-like factor 6PRO_0000047171Add
BLAST

Proteomic databases

MaxQBiQ99612.
PaxDbiQ99612.
PRIDEiQ99612.

PTM databases

PhosphoSiteiQ99612.

Expressioni

Tissue specificityi

Highly expressed in placenta followed by spleen, thymus, prostate, testis, small intestine and colon. Weakly expressed in pancreas, lung, liver, heart and skeletal muscle. Also expressed in fetal brain, spleen and thymus.

Gene expression databases

BgeeiQ99612.
CleanExiHS_KLF6.
GenevisibleiQ99612. HS.

Organism-specific databases

HPAiCAB013529.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
RELAQ042066EBI-714994,EBI-73886

Protein-protein interaction databases

BioGridi107711. 16 interactions.
IntActiQ99612. 9 interactions.
MINTiMINT-250061.
STRINGi9606.ENSP00000419923.

Structurei

3D structure databases

ProteinModelPortaliQ99612.
SMRiQ99612. Positions 200-283.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domaini

The acidic N-terminal part may favor interaction with the basic domain of transcription factors.

Sequence similaritiesi

Contains 3 C2H2-type zinc fingers.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri200 – 22425C2H2-type 1PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri230 – 25425C2H2-type 2PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri260 – 28223C2H2-type 3PROSITE-ProRule annotationAdd
BLAST

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiCOG5048.
GeneTreeiENSGT00760000118998.
HOGENOMiHOG000231192.
HOVERGENiHBG000836.
InParanoidiQ99612.
KOiK09207.
OMAiPSHLWGC.
OrthoDBiEOG747PJ4.
PhylomeDBiQ99612.
TreeFamiTF350556.

Family and domain databases

Gene3Di3.30.160.60. 3 hits.
InterProiIPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view]
SMARTiSM00355. ZnF_C2H2. 3 hits.
[Graphical view]
PROSITEiPS00028. ZINC_FINGER_C2H2_1. 3 hits.
PS50157. ZINC_FINGER_C2H2_2. 3 hits.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q99612-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDVLPMCSIF QELQIVHETG YFSALPSLEE YWQQTCLELE RYLQSEPCYV
60 70 80 90 100
SASEIKFDSQ EDLWTKIILA REKKEESELK ISSSPPEDTL ISPSFCYNLE
110 120 130 140 150
TNSLNSDVSS ESSDSSEELS PTAKFTSDPI GEVLVSSGKL SSSVTSTPPS
160 170 180 190 200
SPELSREPSQ LWGCVPGELP SPGKVRSGTS GKPGDKGNGD ASPDGRRRVH
210 220 230 240 250
RCHFNGCRKV YTKSSHLKAH QRTHTGEKPY RCSWEGCEWR FARSDELTRH
260 270 280
FRKHTGAKPF KCSHCDRCFS RSDHLALHMK RHL
Length:283
Mass (Da):31,865
Last modified:May 30, 2000 - v3
Checksum:i84294A7E6D0A0231
GO
Isoform 2 (identifier: Q99612-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     227-283: EKPYRCSWEG...HLALHMKRHL → QCPRGPRRAA...QSIRSFWSSE

Note: No experimental confirmation available.
Show »
Length:281
Mass (Da):30,615
Checksum:i99ECF169C9933D03
GO
Isoform 3 (identifier: Q99612-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     227-283: EKPYRCSWEGCEWRFARSDELTRHFRKHTGAKPFKCSHCDRCFSRSDHLALHMKRHL → VFPGLTTWPCT

Show »
Length:237
Mass (Da):26,110
Checksum:iC83EEA8CC9654022
GO

Sequence cautioni

The sequence AAC23699.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence BAA33050.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti276 – 2761A → G in AAC39929 (PubMed:9689109).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti64 – 641W → R Found in prostate cancer samples; somatic mutation; does not up-regulates CDKN1A in a p53-independent manner and significantly reduces cell proliferation. 1 Publication
VAR_065136
Natural varianti116 – 1161S → P Found in prostate cancer samples; somatic mutation; does not up-regulates CDKN1A in a p53-independent manner and significantly reduces cell proliferation. 1 Publication
VAR_065137
Natural varianti123 – 1231A → D Found in prostate cancer samples; somatic mutation; does not up-regulates CDKN1A in a p53-independent manner and significantly reduces cell proliferation. 1 Publication
VAR_065138
Natural varianti155 – 1551S → R Found in gastric cancer samples; somatic mutation. 1 Publication
VAR_065139
Natural varianti169 – 1691L → P Found in prostate cancer samples; somatic mutation; does not up-regulates CDKN1A in a p53-independent manner and significantly reduces cell proliferation. 1 Publication
VAR_065140
Natural varianti172 – 1721P → T Found in gastric cancer samples; somatic mutation. 1 Publication
VAR_065141
Natural varianti180 – 1801S → L Found in gastric cancer samples; somatic mutation. 1 Publication
VAR_065142
Natural varianti198 – 1981R → K Found in gastric cancer samples; somatic mutation. 1 Publication
VAR_065143

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei227 – 28357EKPYR…MKRHL → QCPRGPRRAAAGGRHCIAPA LEGAGPGCTGCGQGRQILTS SDVFHQSIRSFWSSE in isoform 2. 1 PublicationVSP_015715Add
BLAST
Alternative sequencei227 – 28357EKPYR…MKRHL → VFPGLTTWPCT in isoform 3. CuratedVSP_045808Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U44975 mRNA. Translation: AAC23699.1. Different initiation.
AF001461 mRNA. Translation: AAC39929.1.
AB017493 mRNA. Translation: BAA33050.1. Different initiation.
AF284036 Genomic DNA. Translation: AAM73548.1.
BT006778 mRNA. Translation: AAP35424.1.
AL513303, AL450322 Genomic DNA. Translation: CAH74049.1.
AK293259 mRNA. Translation: BAG56791.1.
AK316596 mRNA. Translation: BAG38183.1.
AL513303, AL450322 Genomic DNA. Translation: CAH74050.1.
AL450322, AL513303 Genomic DNA. Translation: CAH71010.1.
AL450322, AL513303 Genomic DNA. Translation: CAH71011.1.
CH471072 Genomic DNA. Translation: EAW86477.1.
CH471072 Genomic DNA. Translation: EAW86479.1.
BC000311 mRNA. Translation: AAH00311.1.
CCDSiCCDS53490.1. [Q99612-3]
CCDS7060.1. [Q99612-1]
PIRiJE0235.
RefSeqiNP_001153596.1. NM_001160124.1.
NP_001153597.1. NM_001160125.1. [Q99612-3]
NP_001291.3. NM_001300.5. [Q99612-1]
UniGeneiHs.4055.
Hs.709396.

Genome annotation databases

EnsembliENST00000469435; ENSP00000419079; ENSG00000067082. [Q99612-2]
ENST00000497571; ENSP00000419923; ENSG00000067082.
ENST00000542957; ENSP00000445301; ENSG00000067082. [Q99612-3]
GeneIDi1316.
KEGGihsa:1316.
UCSCiuc001iha.3. human. [Q99612-1]
uc001ihb.2. human. [Q99612-2]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U44975 mRNA. Translation: AAC23699.1. Different initiation.
AF001461 mRNA. Translation: AAC39929.1.
AB017493 mRNA. Translation: BAA33050.1. Different initiation.
AF284036 Genomic DNA. Translation: AAM73548.1.
BT006778 mRNA. Translation: AAP35424.1.
AL513303, AL450322 Genomic DNA. Translation: CAH74049.1.
AK293259 mRNA. Translation: BAG56791.1.
AK316596 mRNA. Translation: BAG38183.1.
AL513303, AL450322 Genomic DNA. Translation: CAH74050.1.
AL450322, AL513303 Genomic DNA. Translation: CAH71010.1.
AL450322, AL513303 Genomic DNA. Translation: CAH71011.1.
CH471072 Genomic DNA. Translation: EAW86477.1.
CH471072 Genomic DNA. Translation: EAW86479.1.
BC000311 mRNA. Translation: AAH00311.1.
CCDSiCCDS53490.1. [Q99612-3]
CCDS7060.1. [Q99612-1]
PIRiJE0235.
RefSeqiNP_001153596.1. NM_001160124.1.
NP_001153597.1. NM_001160125.1. [Q99612-3]
NP_001291.3. NM_001300.5. [Q99612-1]
UniGeneiHs.4055.
Hs.709396.

3D structure databases

ProteinModelPortaliQ99612.
SMRiQ99612. Positions 200-283.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi107711. 16 interactions.
IntActiQ99612. 9 interactions.
MINTiMINT-250061.
STRINGi9606.ENSP00000419923.

PTM databases

PhosphoSiteiQ99612.

Polymorphism and mutation databases

BioMutaiKLF6.
DMDMi7387592.

Proteomic databases

MaxQBiQ99612.
PaxDbiQ99612.
PRIDEiQ99612.

Protocols and materials databases

DNASUi1316.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000469435; ENSP00000419079; ENSG00000067082. [Q99612-2]
ENST00000497571; ENSP00000419923; ENSG00000067082.
ENST00000542957; ENSP00000445301; ENSG00000067082. [Q99612-3]
GeneIDi1316.
KEGGihsa:1316.
UCSCiuc001iha.3. human. [Q99612-1]
uc001ihb.2. human. [Q99612-2]

Organism-specific databases

CTDi1316.
GeneCardsiGC10M003812.
HGNCiHGNC:2235. KLF6.
HPAiCAB013529.
MIMi176807. phenotype.
602053. gene.
613659. phenotype.
neXtProtiNX_Q99612.
PharmGKBiPA26751.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiCOG5048.
GeneTreeiENSGT00760000118998.
HOGENOMiHOG000231192.
HOVERGENiHBG000836.
InParanoidiQ99612.
KOiK09207.
OMAiPSHLWGC.
OrthoDBiEOG747PJ4.
PhylomeDBiQ99612.
TreeFamiTF350556.

Enzyme and pathway databases

SignaLinkiQ99612.

Miscellaneous databases

ChiTaRSiKLF6. human.
GeneWikiiKLF6.
GenomeRNAii1316.
NextBioi5383.
PROiQ99612.
SOURCEiSearch...

Gene expression databases

BgeeiQ99612.
CleanExiHS_KLF6.
GenevisibleiQ99612. HS.

Family and domain databases

Gene3Di3.30.160.60. 3 hits.
InterProiIPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view]
SMARTiSM00355. ZnF_C2H2. 3 hits.
[Graphical view]
PROSITEiPS00028. ZINC_FINGER_C2H2_1. 3 hits.
PS50157. ZINC_FINGER_C2H2_2. 3 hits.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Identification of Bcd, a novel proto-oncogene expressed in B-cells."
    El Rouby S., Newcomb E.W.
    Oncogene 13:2623-2630(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: PRELIMINARY NUCLEOTIDE SEQUENCE (ISOFORM 1).
  2. "A novel human zinc finger protein that interacts with the core promoter element of a TATA box-less gene."
    Koritschoner N.P., Bocco J.L., Panzetta-Dutari G.M., Dumur C.I., Flury A., Patrito L.C.
    J. Biol. Chem. 272:9573-9580(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Placenta.
  3. "Zf9, a Kruppel-like transcription factor up-regulated in vivo during early hepatic fibrosis."
    Ratziu V., Lalazar A., Wong L., Dang Q., Collins C., Shaulian E., Jensen S., Friedman S.L.
    Proc. Natl. Acad. Sci. U.S.A. 95:9500-9505(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Hepatic stellate cell.
  4. "Isolation and initial characterization of GBF, a novel DNA-binding zinc finger protein that binds to the GC-rich binding sites of the HIV-1 promoter."
    Suzuki T., Yamamoto T., Kurabayashi M., Nagai R., Yazaki Y., Horikoshi M.
    J. Biochem. 124:389-395(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), CHARACTERIZATION.
    Tissue: Leukocyte.
  5. "Genomic organization of the human COPEB/CPBP locus."
    Koritschoner N.P.
    Submitted (JUN-2000) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
  6. "Cloning of human full-length CDSs in BD Creator(TM) system donor vector."
    Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A.
    Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  7. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Tissue: Brain.
  8. "The DNA sequence and comparative analysis of human chromosome 10."
    Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J.
    , Bird C.P., Ainscough R., Almeida J.P., Ashwell R.I.S., Ambrose K.D., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Bates K., Beasley H., Bray-Allen S., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Cahill P., Camire D., Carter N.P., Chapman J.C., Clark S.Y., Clarke G., Clee C.M., Clegg S., Corby N., Coulson A., Dhami P., Dutta I., Dunn M., Faulkner L., Frankish A., Frankland J.A., Garner P., Garnett J., Gribble S., Griffiths C., Grocock R., Gustafson E., Hammond S., Harley J.L., Hart E., Heath P.D., Ho T.P., Hopkins B., Horne J., Howden P.J., Huckle E., Hynds C., Johnson C., Johnson D., Kana A., Kay M., Kimberley A.M., Kershaw J.K., Kokkinaki M., Laird G.K., Lawlor S., Lee H.M., Leongamornlert D.A., Laird G., Lloyd C., Lloyd D.M., Loveland J., Lovell J., McLaren S., McLay K.E., McMurray A., Mashreghi-Mohammadi M., Matthews L., Milne S., Nickerson T., Nguyen M., Overton-Larty E., Palmer S.A., Pearce A.V., Peck A.I., Pelan S., Phillimore B., Porter K., Rice C.M., Rogosin A., Ross M.T., Sarafidou T., Sehra H.K., Shownkeen R., Skuce C.D., Smith M., Standring L., Sycamore N., Tester J., Thorpe A., Torcasso W., Tracey A., Tromans A., Tsolas J., Wall M., Walsh J., Wang H., Weinstock K., West A.P., Willey D.L., Whitehead S.L., Wilming L., Wray P.W., Young L., Chen Y., Lovering R.C., Moschonas N.K., Siebert R., Fechtel K., Bentley D., Durbin R.M., Hubbard T., Doucette-Stamm L., Beck S., Smith D.R., Rogers J.
    Nature 429:375-381(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  9. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  10. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Lung.
  11. Cited for: INVOLVEMENT IN PC, VARIANTS ARG-64; PRO-116; ASP-123 AND PRO-169, CHARACTERIZATION OF VARIANTS ARG-64; PRO-116; ASP-123 AND PRO-169.
  12. Cited for: INVOLVEMENT IN GASC, VARIANTS ARG-155; THR-172; LEU-180 AND LYS-198.

Entry informationi

Entry nameiKLF6_HUMAN
AccessioniPrimary (citable) accession number: Q99612
Secondary accession number(s): B2RE86
, B4DDN0, D3DRR1, F5H3M5, Q5VUT7, Q5VUT8, Q9BT79
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: May 30, 2000
Last modified: July 22, 2015
This is version 154 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.