Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Krueppel-like factor 6

Gene

KLF6

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Transcriptional activator (By similarity). Binds a GC box motif. Could play a role in B-cell growth and development.By similarity

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri200 – 224C2H2-type 1PROSITE-ProRule annotationAdd BLAST25
Zinc fingeri230 – 254C2H2-type 2PROSITE-ProRule annotationAdd BLAST25
Zinc fingeri260 – 282C2H2-type 3PROSITE-ProRule annotationAdd BLAST23

GO - Molecular functioni

GO - Biological processi

  • B cell differentiation Source: UniProtKB
  • positive regulation of transcription, DNA-templated Source: UniProtKB
  • positive regulation of transcription by RNA polymerase II Source: NTNU_SB

Keywordsi

Molecular functionActivator, DNA-binding
Biological processTranscription, Transcription regulation
LigandMetal-binding, Zinc

Enzyme and pathway databases

SignaLinkiQ99612
SIGNORiQ99612

Names & Taxonomyi

Protein namesi
Recommended name:
Krueppel-like factor 6
Alternative name(s):
B-cell-derived protein 1
Core promoter element-binding protein
GC-rich sites-binding factor GBF
Proto-oncogene BCD1
Suppressor of tumorigenicity 12 protein
Transcription factor Zf9
Gene namesi
Name:KLF6
Synonyms:BCD1, COPEB, CPBP, ST12
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 10

Organism-specific databases

EuPathDBiHostDB:ENSG00000067082.14
HGNCiHGNC:2235 KLF6
MIMi602053 gene
neXtProtiNX_Q99612

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Involvement in diseasei

Gastric cancer (GASC)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA malignant disease which starts in the stomach, can spread to the esophagus or the small intestine, and can extend through the stomach wall to nearby lymph nodes and organs. It also can metastasize to other parts of the body. The term gastric cancer or gastric carcinoma refers to adenocarcinoma of the stomach that accounts for most of all gastric malignant tumors. Two main histologic types are recognized, diffuse type and intestinal type carcinomas. Diffuse tumors are poorly differentiated infiltrating lesions, resulting in thickening of the stomach. In contrast, intestinal tumors are usually exophytic, often ulcerating, and associated with intestinal metaplasia of the stomach, most often observed in sporadic disease.
See also OMIM:613659
Prostate cancer (PC)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA malignancy originating in tissues of the prostate. Most prostate cancers are adenocarcinomas that develop in the acini of the prostatic ducts. Other rare histopathologic types of prostate cancer that occur in approximately 5% of patients include small cell carcinoma, mucinous carcinoma, prostatic ductal carcinoma, transitional cell carcinoma, squamous cell carcinoma, basal cell carcinoma, adenoid cystic carcinoma (basaloid), signet-ring cell carcinoma and neuroendocrine carcinoma.
See also OMIM:176807

Organism-specific databases

DisGeNETi1316
MalaCardsiKLF6
MIMi176807 phenotype
613659 phenotype
OpenTargetsiENSG00000067082
PharmGKBiPA26751

Polymorphism and mutation databases

BioMutaiKLF6
DMDMi7387592

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000471711 – 283Krueppel-like factor 6Add BLAST283

Proteomic databases

MaxQBiQ99612
PaxDbiQ99612
PeptideAtlasiQ99612
PRIDEiQ99612

PTM databases

iPTMnetiQ99612
PhosphoSitePlusiQ99612

Expressioni

Tissue specificityi

Highly expressed in placenta followed by spleen, thymus, prostate, testis, small intestine and colon. Weakly expressed in pancreas, lung, liver, heart and skeletal muscle. Also expressed in fetal brain, spleen and thymus.

Gene expression databases

BgeeiENSG00000067082
CleanExiHS_KLF6
GenevisibleiQ99612 HS

Organism-specific databases

HPAiCAB013529
HPA069585

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
RELAQ042066EBI-714994,EBI-73886

Protein-protein interaction databases

BioGridi107711, 18 interactors
IntActiQ99612, 9 interactors
STRINGi9606.ENSP00000419923

Structurei

3D structure databases

ProteinModelPortaliQ99612
SMRiQ99612
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domaini

The acidic N-terminal part may favor interaction with the basic domain of transcription factors.

Sequence similaritiesi

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri200 – 224C2H2-type 1PROSITE-ProRule annotationAdd BLAST25
Zinc fingeri230 – 254C2H2-type 2PROSITE-ProRule annotationAdd BLAST25
Zinc fingeri260 – 282C2H2-type 3PROSITE-ProRule annotationAdd BLAST23

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiKOG1721 Eukaryota
COG5048 LUCA
GeneTreeiENSGT00760000118998
HOGENOMiHOG000231192
HOVERGENiHBG000836
InParanoidiQ99612
KOiK09207
OMAiPSHLWGC
OrthoDBiEOG091G1BN0
PhylomeDBiQ99612
TreeFamiTF350556

Family and domain databases

InterProiView protein in InterPro
IPR036236 Znf_C2H2_sf
IPR013087 Znf_C2H2_type
SMARTiView protein in SMART
SM00355 ZnF_C2H2, 3 hits
SUPFAMiSSF57667 SSF57667, 2 hits
PROSITEiView protein in PROSITE
PS00028 ZINC_FINGER_C2H2_1, 3 hits
PS50157 ZINC_FINGER_C2H2_2, 3 hits

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q99612-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDVLPMCSIF QELQIVHETG YFSALPSLEE YWQQTCLELE RYLQSEPCYV
60 70 80 90 100
SASEIKFDSQ EDLWTKIILA REKKEESELK ISSSPPEDTL ISPSFCYNLE
110 120 130 140 150
TNSLNSDVSS ESSDSSEELS PTAKFTSDPI GEVLVSSGKL SSSVTSTPPS
160 170 180 190 200
SPELSREPSQ LWGCVPGELP SPGKVRSGTS GKPGDKGNGD ASPDGRRRVH
210 220 230 240 250
RCHFNGCRKV YTKSSHLKAH QRTHTGEKPY RCSWEGCEWR FARSDELTRH
260 270 280
FRKHTGAKPF KCSHCDRCFS RSDHLALHMK RHL
Length:283
Mass (Da):31,865
Last modified:May 30, 2000 - v3
Checksum:i84294A7E6D0A0231
GO
Isoform 2 (identifier: Q99612-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     227-283: EKPYRCSWEG...HLALHMKRHL → QCPRGPRRAA...QSIRSFWSSE

Note: No experimental confirmation available.
Show »
Length:281
Mass (Da):30,615
Checksum:i99ECF169C9933D03
GO
Isoform 3 (identifier: Q99612-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     227-283: EKPYRCSWEGCEWRFARSDELTRHFRKHTGAKPFKCSHCDRCFSRSDHLALHMKRHL → VFPGLTTWPCT

Show »
Length:237
Mass (Da):26,110
Checksum:iC83EEA8CC9654022
GO

Sequence cautioni

The sequence AAC23699 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence BAA33050 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti276A → G in AAC39929 (PubMed:9689109).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_06513664W → R Found in prostate cancer samples; somatic mutation; does not up-regulates CDKN1A in a p53-independent manner and significantly reduces cell proliferation. 1 PublicationCorresponds to variant dbSNP:rs121909142EnsemblClinVar.1
Natural variantiVAR_065137116S → P Found in prostate cancer samples; somatic mutation; does not up-regulates CDKN1A in a p53-independent manner and significantly reduces cell proliferation. 1 PublicationCorresponds to variant dbSNP:rs121909139EnsemblClinVar.1
Natural variantiVAR_065138123A → D Found in prostate cancer samples; somatic mutation; does not up-regulates CDKN1A in a p53-independent manner and significantly reduces cell proliferation. 1 PublicationCorresponds to variant dbSNP:rs121909141EnsemblClinVar.1
Natural variantiVAR_065139155S → R Found in gastric cancer samples; somatic mutation. 1 PublicationCorresponds to variant dbSNP:rs121909144EnsemblClinVar.1
Natural variantiVAR_065140169L → P Found in prostate cancer samples; somatic mutation; does not up-regulates CDKN1A in a p53-independent manner and significantly reduces cell proliferation. 1 PublicationCorresponds to variant dbSNP:rs121909143EnsemblClinVar.1
Natural variantiVAR_065141172P → T Found in gastric cancer samples; somatic mutation. 1 Publication1
Natural variantiVAR_065142180S → L Found in gastric cancer samples; somatic mutation. 1 PublicationCorresponds to variant dbSNP:rs372338890Ensembl.1
Natural variantiVAR_065143198R → K Found in gastric cancer samples; somatic mutation. 1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_015715227 – 283EKPYR…MKRHL → QCPRGPRRAAAGGRHCIAPA LEGAGPGCTGCGQGRQILTS SDVFHQSIRSFWSSE in isoform 2. 1 PublicationAdd BLAST57
Alternative sequenceiVSP_045808227 – 283EKPYR…MKRHL → VFPGLTTWPCT in isoform 3. CuratedAdd BLAST57

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U44975 mRNA Translation: AAC23699.1 Different initiation.
AF001461 mRNA Translation: AAC39929.1
AB017493 mRNA Translation: BAA33050.1 Different initiation.
AF284036 Genomic DNA Translation: AAM73548.1
BT006778 mRNA Translation: AAP35424.1
AL513303, AL450322 Genomic DNA Translation: CAH74049.1
AK293259 mRNA Translation: BAG56791.1
AK316596 mRNA Translation: BAG38183.1
AL513303, AL450322 Genomic DNA Translation: CAH74050.1
AL450322, AL513303 Genomic DNA Translation: CAH71010.1
AL450322, AL513303 Genomic DNA Translation: CAH71011.1
CH471072 Genomic DNA Translation: EAW86477.1
CH471072 Genomic DNA Translation: EAW86479.1
BC000311 mRNA Translation: AAH00311.1
CCDSiCCDS53490.1 [Q99612-3]
CCDS7060.1 [Q99612-1]
PIRiJE0235
RefSeqiNP_001153596.1, NM_001160124.1
NP_001153597.1, NM_001160125.1 [Q99612-3]
NP_001291.3, NM_001300.5 [Q99612-1]
UniGeneiHs.4055
Hs.709396

Genome annotation databases

EnsembliENST00000469435; ENSP00000419079; ENSG00000067082 [Q99612-2]
ENST00000497571; ENSP00000419923; ENSG00000067082 [Q99612-1]
ENST00000542957; ENSP00000445301; ENSG00000067082 [Q99612-3]
GeneIDi1316
KEGGihsa:1316
UCSCiuc001iha.4 human [Q99612-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiKLF6_HUMAN
AccessioniPrimary (citable) accession number: Q99612
Secondary accession number(s): B2RE86
, B4DDN0, D3DRR1, F5H3M5, Q5VUT7, Q5VUT8, Q9BT79
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: May 30, 2000
Last modified: May 23, 2018
This is version 177 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Cookie policy

We would like to use anonymized google analytics cookies to gather statistics on how uniprot.org is used in aggregate. Learn more

UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health