Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q99612

- KLF6_HUMAN

UniProt

Q99612 - KLF6_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Krueppel-like factor 6

Gene

KLF6

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Transcriptional activator (By similarity). Binds a GC box motif. Could play a role in B-cell growth and development.By similarity

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri200 – 22425C2H2-type 1PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri230 – 25425C2H2-type 2PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri260 – 28223C2H2-type 3PROSITE-ProRule annotationAdd
BLAST

GO - Molecular functioni

  1. DNA binding Source: UniProtKB-KW
  2. metal ion binding Source: UniProtKB-KW

GO - Biological processi

  1. B cell differentiation Source: UniProtKB
  2. cytokine-mediated signaling pathway Source: Ensembl
  3. positive regulation of transcription, DNA-templated Source: UniProtKB
  4. transcription, DNA-templated Source: UniProtKB-KW
Complete GO annotation...

Keywords - Molecular functioni

Activator

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding, Metal-binding, Zinc

Enzyme and pathway databases

SignaLinkiQ99612.

Names & Taxonomyi

Protein namesi
Recommended name:
Krueppel-like factor 6
Alternative name(s):
B-cell-derived protein 1
Core promoter element-binding protein
GC-rich sites-binding factor GBF
Proto-oncogene BCD1
Suppressor of tumorigenicity 12 protein
Transcription factor Zf9
Gene namesi
Name:KLF6
Synonyms:BCD1, COPEB, CPBP, ST12
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 10

Organism-specific databases

HGNCiHGNC:2235. KLF6.

Subcellular locationi

GO - Cellular componenti

  1. cytoplasm Source: Ensembl
  2. nucleus Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Involvement in diseasei

Gastric cancer (GASC) [MIM:613659]: A malignant disease which starts in the stomach, can spread to the esophagus or the small intestine, and can extend through the stomach wall to nearby lymph nodes and organs. It also can metastasize to other parts of the body. The term gastric cancer or gastric carcinoma refers to adenocarcinoma of the stomach that accounts for most of all gastric malignant tumors. Two main histologic types are recognized, diffuse type and intestinal type carcinomas. Diffuse tumors are poorly differentiated infiltrating lesions, resulting in thickening of the stomach. In contrast, intestinal tumors are usually exophytic, often ulcerating, and associated with intestinal metaplasia of the stomach, most often observed in sporadic disease.1 Publication
Note: The disease is caused by mutations affecting the gene represented in this entry.
Prostate cancer (PC) [MIM:176807]: A malignancy originating in tissues of the prostate. Most prostate cancers are adenocarcinomas that develop in the acini of the prostatic ducts. Other rare histopathologic types of prostate cancer that occur in approximately 5% of patients include small cell carcinoma, mucinous carcinoma, prostatic ductal carcinoma, transitional cell carcinoma, squamous cell carcinoma, basal cell carcinoma, adenoid cystic carcinoma (basaloid), signet-ring cell carcinoma and neuroendocrine carcinoma.1 Publication
Note: The disease is caused by mutations affecting the gene represented in this entry.

Organism-specific databases

MIMi176807. phenotype.
613659. phenotype.
PharmGKBiPA26751.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 283283Krueppel-like factor 6PRO_0000047171Add
BLAST

Proteomic databases

MaxQBiQ99612.
PaxDbiQ99612.
PRIDEiQ99612.

PTM databases

PhosphoSiteiQ99612.

Expressioni

Tissue specificityi

Highly expressed in placenta followed by spleen, thymus, prostate, testis, small intestine and colon. Weakly expressed in pancreas, lung, liver, heart and skeletal muscle. Also expressed in fetal brain, spleen and thymus.

Gene expression databases

BgeeiQ99612.
CleanExiHS_KLF6.
ExpressionAtlasiQ99612. baseline and differential.
GenevestigatoriQ99612.

Organism-specific databases

HPAiCAB013529.

Interactioni

Protein-protein interaction databases

BioGridi107711. 17 interactions.
IntActiQ99612. 8 interactions.
MINTiMINT-250061.
STRINGi9606.ENSP00000419923.

Structurei

3D structure databases

ProteinModelPortaliQ99612.
SMRiQ99612. Positions 200-283.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domaini

The acidic N-terminal part may favor interaction with the basic domain of transcription factors.

Sequence similaritiesi

Contains 3 C2H2-type zinc fingers.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri200 – 22425C2H2-type 1PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri230 – 25425C2H2-type 2PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri260 – 28223C2H2-type 3PROSITE-ProRule annotationAdd
BLAST

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiCOG5048.
GeneTreeiENSGT00760000118998.
HOGENOMiHOG000231192.
HOVERGENiHBG000836.
InParanoidiQ99612.
KOiK09207.
OMAiRRYHEFV.
OrthoDBiEOG747PJ4.
PhylomeDBiQ99612.
TreeFamiTF350556.

Family and domain databases

Gene3Di3.30.160.60. 3 hits.
InterProiIPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view]
SMARTiSM00355. ZnF_C2H2. 3 hits.
[Graphical view]
PROSITEiPS00028. ZINC_FINGER_C2H2_1. 3 hits.
PS50157. ZINC_FINGER_C2H2_2. 3 hits.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q99612-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDVLPMCSIF QELQIVHETG YFSALPSLEE YWQQTCLELE RYLQSEPCYV
60 70 80 90 100
SASEIKFDSQ EDLWTKIILA REKKEESELK ISSSPPEDTL ISPSFCYNLE
110 120 130 140 150
TNSLNSDVSS ESSDSSEELS PTAKFTSDPI GEVLVSSGKL SSSVTSTPPS
160 170 180 190 200
SPELSREPSQ LWGCVPGELP SPGKVRSGTS GKPGDKGNGD ASPDGRRRVH
210 220 230 240 250
RCHFNGCRKV YTKSSHLKAH QRTHTGEKPY RCSWEGCEWR FARSDELTRH
260 270 280
FRKHTGAKPF KCSHCDRCFS RSDHLALHMK RHL
Length:283
Mass (Da):31,865
Last modified:May 30, 2000 - v3
Checksum:i84294A7E6D0A0231
GO
Isoform 2 (identifier: Q99612-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     227-283: EKPYRCSWEG...HLALHMKRHL → QCPRGPRRAA...QSIRSFWSSE

Note: No experimental confirmation available.

Show »
Length:281
Mass (Da):30,615
Checksum:i99ECF169C9933D03
GO
Isoform 3 (identifier: Q99612-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     227-283: EKPYRCSWEGCEWRFARSDELTRHFRKHTGAKPFKCSHCDRCFSRSDHLALHMKRHL → VFPGLTTWPCT

Show »
Length:237
Mass (Da):26,110
Checksum:iC83EEA8CC9654022
GO

Sequence cautioni

The sequence AAC23699.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.
The sequence BAA33050.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti276 – 2761A → G in AAC39929. (PubMed:9689109)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti64 – 641W → R Found in prostate cancer samples; somatic mutation; does not up-regulates CDKN1A in a p53-independent manner and significantly reduces cell proliferation. 1 Publication
VAR_065136
Natural varianti116 – 1161S → P Found in prostate cancer samples; somatic mutation; does not up-regulates CDKN1A in a p53-independent manner and significantly reduces cell proliferation. 1 Publication
VAR_065137
Natural varianti123 – 1231A → D Found in prostate cancer samples; somatic mutation; does not up-regulates CDKN1A in a p53-independent manner and significantly reduces cell proliferation. 1 Publication
VAR_065138
Natural varianti155 – 1551S → R Found in gastric cancer samples; somatic mutation. 1 Publication
VAR_065139
Natural varianti169 – 1691L → P Found in prostate cancer samples; somatic mutation; does not up-regulates CDKN1A in a p53-independent manner and significantly reduces cell proliferation. 1 Publication
VAR_065140
Natural varianti172 – 1721P → T Found in gastric cancer samples; somatic mutation. 1 Publication
VAR_065141
Natural varianti180 – 1801S → L Found in gastric cancer samples; somatic mutation. 1 Publication
VAR_065142
Natural varianti198 – 1981R → K Found in gastric cancer samples; somatic mutation. 1 Publication
VAR_065143

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei227 – 28357EKPYR…MKRHL → QCPRGPRRAAAGGRHCIAPA LEGAGPGCTGCGQGRQILTS SDVFHQSIRSFWSSE in isoform 2. 1 PublicationVSP_015715Add
BLAST
Alternative sequencei227 – 28357EKPYR…MKRHL → VFPGLTTWPCT in isoform 3. CuratedVSP_045808Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U44975 mRNA. Translation: AAC23699.1. Different initiation.
AF001461 mRNA. Translation: AAC39929.1.
AB017493 mRNA. Translation: BAA33050.1. Different initiation.
AF284036 Genomic DNA. Translation: AAM73548.1.
BT006778 mRNA. Translation: AAP35424.1.
AL513303, AL450322 Genomic DNA. Translation: CAH74049.1.
AK293259 mRNA. Translation: BAG56791.1.
AK316596 mRNA. Translation: BAG38183.1.
AL513303, AL450322 Genomic DNA. Translation: CAH74050.1.
AL450322, AL513303 Genomic DNA. Translation: CAH71010.1.
AL450322, AL513303 Genomic DNA. Translation: CAH71011.1.
CH471072 Genomic DNA. Translation: EAW86477.1.
CH471072 Genomic DNA. Translation: EAW86479.1.
BC000311 mRNA. Translation: AAH00311.1.
CCDSiCCDS53490.1. [Q99612-3]
CCDS7060.1. [Q99612-1]
PIRiJE0235.
RefSeqiNP_001153596.1. NM_001160124.1.
NP_001153597.1. NM_001160125.1. [Q99612-3]
NP_001291.3. NM_001300.5. [Q99612-1]
UniGeneiHs.4055.
Hs.709396.

Genome annotation databases

EnsembliENST00000469435; ENSP00000419079; ENSG00000067082. [Q99612-2]
ENST00000497571; ENSP00000419923; ENSG00000067082. [Q99612-1]
ENST00000542957; ENSP00000445301; ENSG00000067082. [Q99612-3]
GeneIDi1316.
KEGGihsa:1316.
UCSCiuc001iha.3. human. [Q99612-1]
uc001ihb.2. human. [Q99612-2]

Polymorphism databases

DMDMi7387592.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U44975 mRNA. Translation: AAC23699.1 . Different initiation.
AF001461 mRNA. Translation: AAC39929.1 .
AB017493 mRNA. Translation: BAA33050.1 . Different initiation.
AF284036 Genomic DNA. Translation: AAM73548.1 .
BT006778 mRNA. Translation: AAP35424.1 .
AL513303 , AL450322 Genomic DNA. Translation: CAH74049.1 .
AK293259 mRNA. Translation: BAG56791.1 .
AK316596 mRNA. Translation: BAG38183.1 .
AL513303 , AL450322 Genomic DNA. Translation: CAH74050.1 .
AL450322 , AL513303 Genomic DNA. Translation: CAH71010.1 .
AL450322 , AL513303 Genomic DNA. Translation: CAH71011.1 .
CH471072 Genomic DNA. Translation: EAW86477.1 .
CH471072 Genomic DNA. Translation: EAW86479.1 .
BC000311 mRNA. Translation: AAH00311.1 .
CCDSi CCDS53490.1. [Q99612-3 ]
CCDS7060.1. [Q99612-1 ]
PIRi JE0235.
RefSeqi NP_001153596.1. NM_001160124.1.
NP_001153597.1. NM_001160125.1. [Q99612-3 ]
NP_001291.3. NM_001300.5. [Q99612-1 ]
UniGenei Hs.4055.
Hs.709396.

3D structure databases

ProteinModelPortali Q99612.
SMRi Q99612. Positions 200-283.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 107711. 17 interactions.
IntActi Q99612. 8 interactions.
MINTi MINT-250061.
STRINGi 9606.ENSP00000419923.

PTM databases

PhosphoSitei Q99612.

Polymorphism databases

DMDMi 7387592.

Proteomic databases

MaxQBi Q99612.
PaxDbi Q99612.
PRIDEi Q99612.

Protocols and materials databases

DNASUi 1316.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000469435 ; ENSP00000419079 ; ENSG00000067082 . [Q99612-2 ]
ENST00000497571 ; ENSP00000419923 ; ENSG00000067082 . [Q99612-1 ]
ENST00000542957 ; ENSP00000445301 ; ENSG00000067082 . [Q99612-3 ]
GeneIDi 1316.
KEGGi hsa:1316.
UCSCi uc001iha.3. human. [Q99612-1 ]
uc001ihb.2. human. [Q99612-2 ]

Organism-specific databases

CTDi 1316.
GeneCardsi GC10M003812.
HGNCi HGNC:2235. KLF6.
HPAi CAB013529.
MIMi 176807. phenotype.
602053. gene.
613659. phenotype.
neXtProti NX_Q99612.
PharmGKBi PA26751.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG5048.
GeneTreei ENSGT00760000118998.
HOGENOMi HOG000231192.
HOVERGENi HBG000836.
InParanoidi Q99612.
KOi K09207.
OMAi RRYHEFV.
OrthoDBi EOG747PJ4.
PhylomeDBi Q99612.
TreeFami TF350556.

Enzyme and pathway databases

SignaLinki Q99612.

Miscellaneous databases

ChiTaRSi KLF6. human.
GeneWikii KLF6.
GenomeRNAii 1316.
NextBioi 5383.
PROi Q99612.
SOURCEi Search...

Gene expression databases

Bgeei Q99612.
CleanExi HS_KLF6.
ExpressionAtlasi Q99612. baseline and differential.
Genevestigatori Q99612.

Family and domain databases

Gene3Di 3.30.160.60. 3 hits.
InterProi IPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view ]
SMARTi SM00355. ZnF_C2H2. 3 hits.
[Graphical view ]
PROSITEi PS00028. ZINC_FINGER_C2H2_1. 3 hits.
PS50157. ZINC_FINGER_C2H2_2. 3 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Identification of Bcd, a novel proto-oncogene expressed in B-cells."
    El Rouby S., Newcomb E.W.
    Oncogene 13:2623-2630(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: PRELIMINARY NUCLEOTIDE SEQUENCE (ISOFORM 1).
  2. "A novel human zinc finger protein that interacts with the core promoter element of a TATA box-less gene."
    Koritschoner N.P., Bocco J.L., Panzetta-Dutari G.M., Dumur C.I., Flury A., Patrito L.C.
    J. Biol. Chem. 272:9573-9580(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Placenta.
  3. "Zf9, a Kruppel-like transcription factor up-regulated in vivo during early hepatic fibrosis."
    Ratziu V., Lalazar A., Wong L., Dang Q., Collins C., Shaulian E., Jensen S., Friedman S.L.
    Proc. Natl. Acad. Sci. U.S.A. 95:9500-9505(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Hepatic stellate cell.
  4. "Isolation and initial characterization of GBF, a novel DNA-binding zinc finger protein that binds to the GC-rich binding sites of the HIV-1 promoter."
    Suzuki T., Yamamoto T., Kurabayashi M., Nagai R., Yazaki Y., Horikoshi M.
    J. Biochem. 124:389-395(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), CHARACTERIZATION.
    Tissue: Leukocyte.
  5. "Genomic organization of the human COPEB/CPBP locus."
    Koritschoner N.P.
    Submitted (JUN-2000) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
  6. "Cloning of human full-length CDSs in BD Creator(TM) system donor vector."
    Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A.
    Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  7. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Tissue: Brain.
  8. "The DNA sequence and comparative analysis of human chromosome 10."
    Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J.
    , Bird C.P., Ainscough R., Almeida J.P., Ashwell R.I.S., Ambrose K.D., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Bates K., Beasley H., Bray-Allen S., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Cahill P., Camire D., Carter N.P., Chapman J.C., Clark S.Y., Clarke G., Clee C.M., Clegg S., Corby N., Coulson A., Dhami P., Dutta I., Dunn M., Faulkner L., Frankish A., Frankland J.A., Garner P., Garnett J., Gribble S., Griffiths C., Grocock R., Gustafson E., Hammond S., Harley J.L., Hart E., Heath P.D., Ho T.P., Hopkins B., Horne J., Howden P.J., Huckle E., Hynds C., Johnson C., Johnson D., Kana A., Kay M., Kimberley A.M., Kershaw J.K., Kokkinaki M., Laird G.K., Lawlor S., Lee H.M., Leongamornlert D.A., Laird G., Lloyd C., Lloyd D.M., Loveland J., Lovell J., McLaren S., McLay K.E., McMurray A., Mashreghi-Mohammadi M., Matthews L., Milne S., Nickerson T., Nguyen M., Overton-Larty E., Palmer S.A., Pearce A.V., Peck A.I., Pelan S., Phillimore B., Porter K., Rice C.M., Rogosin A., Ross M.T., Sarafidou T., Sehra H.K., Shownkeen R., Skuce C.D., Smith M., Standring L., Sycamore N., Tester J., Thorpe A., Torcasso W., Tracey A., Tromans A., Tsolas J., Wall M., Walsh J., Wang H., Weinstock K., West A.P., Willey D.L., Whitehead S.L., Wilming L., Wray P.W., Young L., Chen Y., Lovering R.C., Moschonas N.K., Siebert R., Fechtel K., Bentley D., Durbin R.M., Hubbard T., Doucette-Stamm L., Beck S., Smith D.R., Rogers J.
    Nature 429:375-381(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  9. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  10. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Lung.
  11. Cited for: INVOLVEMENT IN PC, VARIANTS ARG-64; PRO-116; ASP-123 AND PRO-169, CHARACTERIZATION OF VARIANTS ARG-64; PRO-116; ASP-123 AND PRO-169.
  12. Cited for: INVOLVEMENT IN GASC, VARIANTS ARG-155; THR-172; LEU-180 AND LYS-198.

Entry informationi

Entry nameiKLF6_HUMAN
AccessioniPrimary (citable) accession number: Q99612
Secondary accession number(s): B2RE86
, B4DDN0, D3DRR1, F5H3M5, Q5VUT7, Q5VUT8, Q9BT79
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: May 30, 2000
Last modified: October 29, 2014
This is version 148 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3