Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q99612

- KLF6_HUMAN

UniProt

Q99612 - KLF6_HUMAN

Protein

Krueppel-like factor 6

Gene

KLF6

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 147 (01 Oct 2014)
      Sequence version 3 (30 May 2000)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Transcriptional activator By similarity. Binds a GC box motif. Could play a role in B-cell growth and development.By similarity

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Zinc fingeri200 – 22425C2H2-type 1PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri230 – 25425C2H2-type 2PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri260 – 28223C2H2-type 3PROSITE-ProRule annotationAdd
    BLAST

    GO - Molecular functioni

    1. DNA binding Source: UniProtKB-KW
    2. metal ion binding Source: UniProtKB-KW

    GO - Biological processi

    1. B cell differentiation Source: UniProtKB
    2. cytokine-mediated signaling pathway Source: Ensembl
    3. positive regulation of transcription, DNA-templated Source: UniProtKB
    4. transcription, DNA-templated Source: UniProtKB-KW

    Keywords - Molecular functioni

    Activator

    Keywords - Biological processi

    Transcription, Transcription regulation

    Keywords - Ligandi

    DNA-binding, Metal-binding, Zinc

    Enzyme and pathway databases

    SignaLinkiQ99612.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Krueppel-like factor 6
    Alternative name(s):
    B-cell-derived protein 1
    Core promoter element-binding protein
    GC-rich sites-binding factor GBF
    Proto-oncogene BCD1
    Suppressor of tumorigenicity 12 protein
    Transcription factor Zf9
    Gene namesi
    Name:KLF6
    Synonyms:BCD1, COPEB, CPBP, ST12
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 10

    Organism-specific databases

    HGNCiHGNC:2235. KLF6.

    Subcellular locationi

    GO - Cellular componenti

    1. cytoplasm Source: Ensembl
    2. nucleus Source: UniProtKB

    Keywords - Cellular componenti

    Nucleus

    Pathology & Biotechi

    Involvement in diseasei

    Gastric cancer (GASC) [MIM:613659]: A malignant disease which starts in the stomach, can spread to the esophagus or the small intestine, and can extend through the stomach wall to nearby lymph nodes and organs. It also can metastasize to other parts of the body. The term gastric cancer or gastric carcinoma refers to adenocarcinoma of the stomach that accounts for most of all gastric malignant tumors. Two main histologic types are recognized, diffuse type and intestinal type carcinomas. Diffuse tumors are poorly differentiated infiltrating lesions, resulting in thickening of the stomach. In contrast, intestinal tumors are usually exophytic, often ulcerating, and associated with intestinal metaplasia of the stomach, most often observed in sporadic disease.1 Publication
    Note: The disease is caused by mutations affecting the gene represented in this entry.
    Prostate cancer (PC) [MIM:176807]: A malignancy originating in tissues of the prostate. Most prostate cancers are adenocarcinomas that develop in the acini of the prostatic ducts. Other rare histopathologic types of prostate cancer that occur in approximately 5% of patients include small cell carcinoma, mucinous carcinoma, prostatic ductal carcinoma, transitional cell carcinoma, squamous cell carcinoma, basal cell carcinoma, adenoid cystic carcinoma (basaloid), signet-ring cell carcinoma and neuroendocrine carcinoma.1 Publication
    Note: The disease is caused by mutations affecting the gene represented in this entry.

    Organism-specific databases

    MIMi176807. phenotype.
    613659. phenotype.
    PharmGKBiPA26751.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 283283Krueppel-like factor 6PRO_0000047171Add
    BLAST

    Proteomic databases

    MaxQBiQ99612.
    PaxDbiQ99612.
    PRIDEiQ99612.

    PTM databases

    PhosphoSiteiQ99612.

    Expressioni

    Tissue specificityi

    Highly expressed in placenta followed by spleen, thymus, prostate, testis, small intestine and colon. Weakly expressed in pancreas, lung, liver, heart and skeletal muscle. Also expressed in fetal brain, spleen and thymus.

    Gene expression databases

    ArrayExpressiQ99612.
    BgeeiQ99612.
    CleanExiHS_KLF6.
    GenevestigatoriQ99612.

    Organism-specific databases

    HPAiCAB013529.

    Interactioni

    Protein-protein interaction databases

    BioGridi107711. 17 interactions.
    IntActiQ99612. 8 interactions.
    MINTiMINT-250061.
    STRINGi9606.ENSP00000419923.

    Structurei

    3D structure databases

    ProteinModelPortaliQ99612.
    SMRiQ99612. Positions 200-283.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domaini

    The acidic N-terminal part may favor interaction with the basic domain of transcription factors.

    Sequence similaritiesi

    Contains 3 C2H2-type zinc fingers.PROSITE-ProRule annotation

    Zinc finger

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Zinc fingeri200 – 22425C2H2-type 1PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri230 – 25425C2H2-type 2PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri260 – 28223C2H2-type 3PROSITE-ProRule annotationAdd
    BLAST

    Keywords - Domaini

    Repeat, Zinc-finger

    Phylogenomic databases

    eggNOGiCOG5048.
    HOGENOMiHOG000231192.
    HOVERGENiHBG000836.
    InParanoidiQ99612.
    KOiK09207.
    OMAiRRYHEFV.
    OrthoDBiEOG747PJ4.
    PhylomeDBiQ99612.
    TreeFamiTF350556.

    Family and domain databases

    Gene3Di3.30.160.60. 3 hits.
    InterProiIPR007087. Znf_C2H2.
    IPR015880. Znf_C2H2-like.
    IPR013087. Znf_C2H2/integrase_DNA-bd.
    [Graphical view]
    SMARTiSM00355. ZnF_C2H2. 3 hits.
    [Graphical view]
    PROSITEiPS00028. ZINC_FINGER_C2H2_1. 3 hits.
    PS50157. ZINC_FINGER_C2H2_2. 3 hits.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q99612-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MDVLPMCSIF QELQIVHETG YFSALPSLEE YWQQTCLELE RYLQSEPCYV    50
    SASEIKFDSQ EDLWTKIILA REKKEESELK ISSSPPEDTL ISPSFCYNLE 100
    TNSLNSDVSS ESSDSSEELS PTAKFTSDPI GEVLVSSGKL SSSVTSTPPS 150
    SPELSREPSQ LWGCVPGELP SPGKVRSGTS GKPGDKGNGD ASPDGRRRVH 200
    RCHFNGCRKV YTKSSHLKAH QRTHTGEKPY RCSWEGCEWR FARSDELTRH 250
    FRKHTGAKPF KCSHCDRCFS RSDHLALHMK RHL 283
    Length:283
    Mass (Da):31,865
    Last modified:May 30, 2000 - v3
    Checksum:i84294A7E6D0A0231
    GO
    Isoform 2 (identifier: Q99612-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         227-283: EKPYRCSWEG...HLALHMKRHL → QCPRGPRRAA...QSIRSFWSSE

    Note: No experimental confirmation available.

    Show »
    Length:281
    Mass (Da):30,615
    Checksum:i99ECF169C9933D03
    GO
    Isoform 3 (identifier: Q99612-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         227-283: EKPYRCSWEGCEWRFARSDELTRHFRKHTGAKPFKCSHCDRCFSRSDHLALHMKRHL → VFPGLTTWPCT

    Show »
    Length:237
    Mass (Da):26,110
    Checksum:iC83EEA8CC9654022
    GO

    Sequence cautioni

    The sequence AAC23699.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.
    The sequence BAA33050.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti276 – 2761A → G in AAC39929. (PubMed:9689109)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti64 – 641W → R Found in prostate cancer samples; somatic mutation; does not up-regulates CDKN1A in a p53-independent manner and significantly reduces cell proliferation. 1 Publication
    VAR_065136
    Natural varianti116 – 1161S → P Found in prostate cancer samples; somatic mutation; does not up-regulates CDKN1A in a p53-independent manner and significantly reduces cell proliferation. 1 Publication
    VAR_065137
    Natural varianti123 – 1231A → D Found in prostate cancer samples; somatic mutation; does not up-regulates CDKN1A in a p53-independent manner and significantly reduces cell proliferation. 1 Publication
    VAR_065138
    Natural varianti155 – 1551S → R Found in gastric cancer samples; somatic mutation. 1 Publication
    VAR_065139
    Natural varianti169 – 1691L → P Found in prostate cancer samples; somatic mutation; does not up-regulates CDKN1A in a p53-independent manner and significantly reduces cell proliferation. 1 Publication
    VAR_065140
    Natural varianti172 – 1721P → T Found in gastric cancer samples; somatic mutation. 1 Publication
    VAR_065141
    Natural varianti180 – 1801S → L Found in gastric cancer samples; somatic mutation. 1 Publication
    VAR_065142
    Natural varianti198 – 1981R → K Found in gastric cancer samples; somatic mutation. 1 Publication
    VAR_065143

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei227 – 28357EKPYR…MKRHL → QCPRGPRRAAAGGRHCIAPA LEGAGPGCTGCGQGRQILTS SDVFHQSIRSFWSSE in isoform 2. 1 PublicationVSP_015715Add
    BLAST
    Alternative sequencei227 – 28357EKPYR…MKRHL → VFPGLTTWPCT in isoform 3. CuratedVSP_045808Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U44975 mRNA. Translation: AAC23699.1. Different initiation.
    AF001461 mRNA. Translation: AAC39929.1.
    AB017493 mRNA. Translation: BAA33050.1. Different initiation.
    AF284036 Genomic DNA. Translation: AAM73548.1.
    BT006778 mRNA. Translation: AAP35424.1.
    AL513303, AL450322 Genomic DNA. Translation: CAH74049.1.
    AK293259 mRNA. Translation: BAG56791.1.
    AK316596 mRNA. Translation: BAG38183.1.
    AL513303, AL450322 Genomic DNA. Translation: CAH74050.1.
    AL450322, AL513303 Genomic DNA. Translation: CAH71010.1.
    AL450322, AL513303 Genomic DNA. Translation: CAH71011.1.
    CH471072 Genomic DNA. Translation: EAW86477.1.
    CH471072 Genomic DNA. Translation: EAW86479.1.
    BC000311 mRNA. Translation: AAH00311.1.
    CCDSiCCDS53490.1. [Q99612-3]
    CCDS7060.1. [Q99612-1]
    PIRiJE0235.
    RefSeqiNP_001153596.1. NM_001160124.1.
    NP_001153597.1. NM_001160125.1. [Q99612-3]
    NP_001291.3. NM_001300.5. [Q99612-1]
    UniGeneiHs.4055.
    Hs.709396.

    Genome annotation databases

    EnsembliENST00000469435; ENSP00000419079; ENSG00000067082. [Q99612-2]
    ENST00000497571; ENSP00000419923; ENSG00000067082. [Q99612-1]
    ENST00000542957; ENSP00000445301; ENSG00000067082. [Q99612-3]
    GeneIDi1316.
    KEGGihsa:1316.
    UCSCiuc001iha.3. human. [Q99612-1]
    uc001ihb.2. human. [Q99612-2]

    Polymorphism databases

    DMDMi7387592.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Web resourcesi

    Atlas of Genetics and Cytogenetics in Oncology and Haematology

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U44975 mRNA. Translation: AAC23699.1 . Different initiation.
    AF001461 mRNA. Translation: AAC39929.1 .
    AB017493 mRNA. Translation: BAA33050.1 . Different initiation.
    AF284036 Genomic DNA. Translation: AAM73548.1 .
    BT006778 mRNA. Translation: AAP35424.1 .
    AL513303 , AL450322 Genomic DNA. Translation: CAH74049.1 .
    AK293259 mRNA. Translation: BAG56791.1 .
    AK316596 mRNA. Translation: BAG38183.1 .
    AL513303 , AL450322 Genomic DNA. Translation: CAH74050.1 .
    AL450322 , AL513303 Genomic DNA. Translation: CAH71010.1 .
    AL450322 , AL513303 Genomic DNA. Translation: CAH71011.1 .
    CH471072 Genomic DNA. Translation: EAW86477.1 .
    CH471072 Genomic DNA. Translation: EAW86479.1 .
    BC000311 mRNA. Translation: AAH00311.1 .
    CCDSi CCDS53490.1. [Q99612-3 ]
    CCDS7060.1. [Q99612-1 ]
    PIRi JE0235.
    RefSeqi NP_001153596.1. NM_001160124.1.
    NP_001153597.1. NM_001160125.1. [Q99612-3 ]
    NP_001291.3. NM_001300.5. [Q99612-1 ]
    UniGenei Hs.4055.
    Hs.709396.

    3D structure databases

    ProteinModelPortali Q99612.
    SMRi Q99612. Positions 200-283.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 107711. 17 interactions.
    IntActi Q99612. 8 interactions.
    MINTi MINT-250061.
    STRINGi 9606.ENSP00000419923.

    PTM databases

    PhosphoSitei Q99612.

    Polymorphism databases

    DMDMi 7387592.

    Proteomic databases

    MaxQBi Q99612.
    PaxDbi Q99612.
    PRIDEi Q99612.

    Protocols and materials databases

    DNASUi 1316.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000469435 ; ENSP00000419079 ; ENSG00000067082 . [Q99612-2 ]
    ENST00000497571 ; ENSP00000419923 ; ENSG00000067082 . [Q99612-1 ]
    ENST00000542957 ; ENSP00000445301 ; ENSG00000067082 . [Q99612-3 ]
    GeneIDi 1316.
    KEGGi hsa:1316.
    UCSCi uc001iha.3. human. [Q99612-1 ]
    uc001ihb.2. human. [Q99612-2 ]

    Organism-specific databases

    CTDi 1316.
    GeneCardsi GC10M003812.
    HGNCi HGNC:2235. KLF6.
    HPAi CAB013529.
    MIMi 176807. phenotype.
    602053. gene.
    613659. phenotype.
    neXtProti NX_Q99612.
    PharmGKBi PA26751.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG5048.
    HOGENOMi HOG000231192.
    HOVERGENi HBG000836.
    InParanoidi Q99612.
    KOi K09207.
    OMAi RRYHEFV.
    OrthoDBi EOG747PJ4.
    PhylomeDBi Q99612.
    TreeFami TF350556.

    Enzyme and pathway databases

    SignaLinki Q99612.

    Miscellaneous databases

    ChiTaRSi KLF6. human.
    GeneWikii KLF6.
    GenomeRNAii 1316.
    NextBioi 5383.
    PROi Q99612.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q99612.
    Bgeei Q99612.
    CleanExi HS_KLF6.
    Genevestigatori Q99612.

    Family and domain databases

    Gene3Di 3.30.160.60. 3 hits.
    InterProi IPR007087. Znf_C2H2.
    IPR015880. Znf_C2H2-like.
    IPR013087. Znf_C2H2/integrase_DNA-bd.
    [Graphical view ]
    SMARTi SM00355. ZnF_C2H2. 3 hits.
    [Graphical view ]
    PROSITEi PS00028. ZINC_FINGER_C2H2_1. 3 hits.
    PS50157. ZINC_FINGER_C2H2_2. 3 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Identification of Bcd, a novel proto-oncogene expressed in B-cells."
      El Rouby S., Newcomb E.W.
      Oncogene 13:2623-2630(1996) [PubMed] [Europe PMC] [Abstract]
      Cited for: PRELIMINARY NUCLEOTIDE SEQUENCE (ISOFORM 1).
    2. "A novel human zinc finger protein that interacts with the core promoter element of a TATA box-less gene."
      Koritschoner N.P., Bocco J.L., Panzetta-Dutari G.M., Dumur C.I., Flury A., Patrito L.C.
      J. Biol. Chem. 272:9573-9580(1997) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Tissue: Placenta.
    3. "Zf9, a Kruppel-like transcription factor up-regulated in vivo during early hepatic fibrosis."
      Ratziu V., Lalazar A., Wong L., Dang Q., Collins C., Shaulian E., Jensen S., Friedman S.L.
      Proc. Natl. Acad. Sci. U.S.A. 95:9500-9505(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Tissue: Hepatic stellate cell.
    4. "Isolation and initial characterization of GBF, a novel DNA-binding zinc finger protein that binds to the GC-rich binding sites of the HIV-1 promoter."
      Suzuki T., Yamamoto T., Kurabayashi M., Nagai R., Yazaki Y., Horikoshi M.
      J. Biochem. 124:389-395(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), CHARACTERIZATION.
      Tissue: Leukocyte.
    5. "Genomic organization of the human COPEB/CPBP locus."
      Koritschoner N.P.
      Submitted (JUN-2000) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
    6. "Cloning of human full-length CDSs in BD Creator(TM) system donor vector."
      Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A.
      Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    7. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
      Tissue: Brain.
    8. "The DNA sequence and comparative analysis of human chromosome 10."
      Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J.
      , Bird C.P., Ainscough R., Almeida J.P., Ashwell R.I.S., Ambrose K.D., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Bates K., Beasley H., Bray-Allen S., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Cahill P., Camire D., Carter N.P., Chapman J.C., Clark S.Y., Clarke G., Clee C.M., Clegg S., Corby N., Coulson A., Dhami P., Dutta I., Dunn M., Faulkner L., Frankish A., Frankland J.A., Garner P., Garnett J., Gribble S., Griffiths C., Grocock R., Gustafson E., Hammond S., Harley J.L., Hart E., Heath P.D., Ho T.P., Hopkins B., Horne J., Howden P.J., Huckle E., Hynds C., Johnson C., Johnson D., Kana A., Kay M., Kimberley A.M., Kershaw J.K., Kokkinaki M., Laird G.K., Lawlor S., Lee H.M., Leongamornlert D.A., Laird G., Lloyd C., Lloyd D.M., Loveland J., Lovell J., McLaren S., McLay K.E., McMurray A., Mashreghi-Mohammadi M., Matthews L., Milne S., Nickerson T., Nguyen M., Overton-Larty E., Palmer S.A., Pearce A.V., Peck A.I., Pelan S., Phillimore B., Porter K., Rice C.M., Rogosin A., Ross M.T., Sarafidou T., Sehra H.K., Shownkeen R., Skuce C.D., Smith M., Standring L., Sycamore N., Tester J., Thorpe A., Torcasso W., Tracey A., Tromans A., Tsolas J., Wall M., Walsh J., Wang H., Weinstock K., West A.P., Willey D.L., Whitehead S.L., Wilming L., Wray P.W., Young L., Chen Y., Lovering R.C., Moschonas N.K., Siebert R., Fechtel K., Bentley D., Durbin R.M., Hubbard T., Doucette-Stamm L., Beck S., Smith D.R., Rogers J.
      Nature 429:375-381(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    9. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    10. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Lung.
    11. Cited for: INVOLVEMENT IN PC, VARIANTS ARG-64; PRO-116; ASP-123 AND PRO-169, CHARACTERIZATION OF VARIANTS ARG-64; PRO-116; ASP-123 AND PRO-169.
    12. Cited for: INVOLVEMENT IN GASC, VARIANTS ARG-155; THR-172; LEU-180 AND LYS-198.

    Entry informationi

    Entry nameiKLF6_HUMAN
    AccessioniPrimary (citable) accession number: Q99612
    Secondary accession number(s): B2RE86
    , B4DDN0, D3DRR1, F5H3M5, Q5VUT7, Q5VUT8, Q9BT79
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: May 30, 2000
    Last sequence update: May 30, 2000
    Last modified: October 1, 2014
    This is version 147 of the entry and version 3 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 10
      Human chromosome 10: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3