Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q99576 (T22D3_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 130. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (3) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
TSC22 domain family protein 3
Alternative name(s):
DSIP-immunoreactive peptide
Short name=Protein DIP
Short name=hDIP
Delta sleep-inducing peptide immunoreactor
Glucocorticoid-induced leucine zipper protein
Short name=GILZ
TSC-22-like protein
TSC-22-related protein
Short name=TSC-22R
Gene names
Name:TSC22D3
Synonyms:DSIPI, GILZ
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length134 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Protects T-cells from IL2 deprivation-induced apoptosis through the inhibition of FOXO3A transcriptional activity that leads to the down-regulation of the pro-apoptotic factor BCL2L11. In macrophages, plays a role in the anti-inflammatory and immunosuppressive effects of glucocorticoids and IL10. In T-cells, inhibits anti-CD3-induced NFKB1 nuclear translocation. In vitro, suppresses AP1 and NFKB1 DNA-binding activities By similarity. Ref.15

Subunit structure

Can form homodimers, however it is likely to function as a monomer. Interacts with AP1 By similarity. Interacts with NFKB1. Ref.13 Ref.14

Tissue specificity

Expressed in brain, lung, spleen and skeletal muscle. Lower levels detected in heart and kidney. Not detected in the pancreas. In non-lymphoid tissues, in the absence of inflammation, the major source of constitutive expression is the macrophage lineage. Also expressed in cells from different hemopoietic cell lineages, including bone marrow cells, CD34+ stem cells, mature B- and T-cells, monocytes and granulocytes. Down-regulated in activated macrophages from inflammatory lesions of delayed-type hypersensitivity (DTH) reactions, such as in tuberculosis and in Crohn disease, whereas in Burkitt lymphoma, persists in macrophages involved in the phagocytosis of apoptotic malignant cells. Ref.2 Ref.14

Induction

By glucocorticoids in lymphoid cells and upon IL4, IL10, IL13 or glucocorticoid treatment in monocyte/macrophage cells. Transiently induced by IL2 deprivation in T-cells. Ref.14 Ref.15

Domain

The leucine-zipper is involved in homodimerization By similarity.

Sequence similarities

Belongs to the TSC-22/Dip/Bun family.

Sequence caution

The sequence AAH18148.3 differs from that shown. Reason: Erroneous initiation.

The sequence CAA90644.1 differs from that shown. Reason: Erroneous initiation.

The sequence CAB53669.1 differs from that shown. Reason: Frameshift at position 4.

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q99576-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q99576-3)

The sequence of this isoform differs from the canonical sequence as follows:
     1-40: MNTEMYQTPM...GDVVSVKLDN → MAQSKLDCRS...TMLSILLFFH
Note: Contains a phosphoserine at position 42. Contains a phosphoserine at position 73.
Isoform 3 (identifier: Q99576-4)

The sequence of this isoform differs from the canonical sequence as follows:
     1-41: MNTEMYQTPMEVAVYQLHNFSISFFSSLLGGDVVSVKLDNS → GGWPSAVRAWEKAGSLPAEKEFLASFRAG
Note: Incomplete sequence. No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 134134TSC22 domain family protein 3
PRO_0000219370

Regions

Region1 – 6060AP1-binding By similarity
Region76 – 9722Leucine-zipper

Natural variations

Alternative sequence1 – 4141MNTEM…KLDNS → GGWPSAVRAWEKAGSLPAEK EFLASFRAG in isoform 3.
VSP_020732
Alternative sequence1 – 4040MNTEM…VKLDN → MAQSKLDCRSPVGLDCCNCC LDLAHRSGLQRGSSGENNNP GSPTVSNFRQLQEKLVFENL NTDKLNSIMRQDSLEPVLRD PCYLINEGICNRNIDQTMLS ILLFFH in isoform 2.
VSP_012689

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified June 1, 2001. Version 2.
Checksum: 77B1024969FA8687

FASTA13414,810
        10         20         30         40         50         60 
MNTEMYQTPM EVAVYQLHNF SISFFSSLLG GDVVSVKLDN SASGASVVAI DNKIEQAMDL 

        70         80         90        100        110        120 
VKNHLMYAVR EEVEILKEQI RELVEKNSQL ERENTLLKTL ASPEQLEKFQ SCLSPEEPAP 

       130 
ESPQVPEAPG GSAV 

« Hide

Isoform 2 [UniParc].

Checksum: 5CBFE801E1700C8C
Show »

FASTA20022,213
Isoform 3 [UniParc].

Checksum: 3FA577D9052EDB7C
Show »

FASTA12213,286

References

« Hide 'large scale' references
[1]"hDIP -- a potential transcriptional regulator related to murine TSC-22 and Drosophila shortsighted (shs) -- is expressed in a large number of human tissues."
Vogel P., Maegert H.-J., Cieslak A., Adermann K., Forssmann W.-G.
Biochim. Biophys. Acta 1309:200-204(1996) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3).
Tissue: Fetal brain.
[2]"Cloning, chromosomal assignment and tissue distribution of human GILZ, a glucocorticoid hormone-induced gene."
Cannarile L., Zollo O., D'Adamio F., Ayroldi E., Marchetti C., Tabilio A., Bruscoli S., Riccardi C.
Cell Death Differ. 8:201-203(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY.
Tissue: T-cell.
[3]"Full-length sequence of ocular cDNA clones."
Wistow G.J.
Submitted (SEP-1999) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
Tissue: Iris.
[4]"Human GILZ."
Okada T.
Submitted (MAR-1999) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
[5]"A catalogue of genes in the human dermal papilla cells as identified by expressed sequence tags."
Kim M.K., Kim Y.H., Suh J.M., Lee H.M., Chung H.J., Sohn M.Y., Hwang S.Y., Im S.U., Jung E.J., Kim J.C.
Submitted (MAY-1999) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Hair follicle dermal papilla.
[6]"Towards a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs."
Wiemann S., Weil B., Wellenreuther R., Gassenhuber J., Glassl S., Ansorge W., Boecher M., Bloecker H., Bauersachs S., Blum H., Lauber J., Duesterhoeft A., Beyer A., Koehrer K., Strack N., Mewes H.-W., Ottenwaelder B., Obermaier B. expand/collapse author list , Tampe J., Heubner D., Wambutt R., Korn B., Klein M., Poustka A.
Genome Res. 11:422-435(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Fetal kidney.
[7]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
Tissue: Prostate and Pulmonary artery.
[8]"The full-ORF clone resource of the German cDNA consortium."
Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I.
BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Adipose tissue.
[9]"The DNA sequence of the human X chromosome."
Ross M.T., Grafham D.V., Coffey A.J., Scherer S., McLay K., Muzny D., Platzer M., Howell G.R., Burrows C., Bird C.P., Frankish A., Lovell F.L., Howe K.L., Ashurst J.L., Fulton R.S., Sudbrak R., Wen G., Jones M.C. expand/collapse author list , Hurles M.E., Andrews T.D., Scott C.E., Searle S., Ramser J., Whittaker A., Deadman R., Carter N.P., Hunt S.E., Chen R., Cree A., Gunaratne P., Havlak P., Hodgson A., Metzker M.L., Richards S., Scott G., Steffen D., Sodergren E., Wheeler D.A., Worley K.C., Ainscough R., Ambrose K.D., Ansari-Lari M.A., Aradhya S., Ashwell R.I., Babbage A.K., Bagguley C.L., Ballabio A., Banerjee R., Barker G.E., Barlow K.F., Barrett I.P., Bates K.N., Beare D.M., Beasley H., Beasley O., Beck A., Bethel G., Blechschmidt K., Brady N., Bray-Allen S., Bridgeman A.M., Brown A.J., Brown M.J., Bonnin D., Bruford E.A., Buhay C., Burch P., Burford D., Burgess J., Burrill W., Burton J., Bye J.M., Carder C., Carrel L., Chako J., Chapman J.C., Chavez D., Chen E., Chen G., Chen Y., Chen Z., Chinault C., Ciccodicola A., Clark S.Y., Clarke G., Clee C.M., Clegg S., Clerc-Blankenburg K., Clifford K., Cobley V., Cole C.G., Conquer J.S., Corby N., Connor R.E., David R., Davies J., Davis C., Davis J., Delgado O., Deshazo D., Dhami P., Ding Y., Dinh H., Dodsworth S., Draper H., Dugan-Rocha S., Dunham A., Dunn M., Durbin K.J., Dutta I., Eades T., Ellwood M., Emery-Cohen A., Errington H., Evans K.L., Faulkner L., Francis F., Frankland J., Fraser A.E., Galgoczy P., Gilbert J., Gill R., Gloeckner G., Gregory S.G., Gribble S., Griffiths C., Grocock R., Gu Y., Gwilliam R., Hamilton C., Hart E.A., Hawes A., Heath P.D., Heitmann K., Hennig S., Hernandez J., Hinzmann B., Ho S., Hoffs M., Howden P.J., Huckle E.J., Hume J., Hunt P.J., Hunt A.R., Isherwood J., Jacob L., Johnson D., Jones S., de Jong P.J., Joseph S.S., Keenan S., Kelly S., Kershaw J.K., Khan Z., Kioschis P., Klages S., Knights A.J., Kosiura A., Kovar-Smith C., Laird G.K., Langford C., Lawlor S., Leversha M., Lewis L., Liu W., Lloyd C., Lloyd D.M., Loulseged H., Loveland J.E., Lovell J.D., Lozado R., Lu J., Lyne R., Ma J., Maheshwari M., Matthews L.H., McDowall J., McLaren S., McMurray A., Meidl P., Meitinger T., Milne S., Miner G., Mistry S.L., Morgan M., Morris S., Mueller I., Mullikin J.C., Nguyen N., Nordsiek G., Nyakatura G., O'dell C.N., Okwuonu G., Palmer S., Pandian R., Parker D., Parrish J., Pasternak S., Patel D., Pearce A.V., Pearson D.M., Pelan S.E., Perez L., Porter K.M., Ramsey Y., Reichwald K., Rhodes S., Ridler K.A., Schlessinger D., Schueler M.G., Sehra H.K., Shaw-Smith C., Shen H., Sheridan E.M., Shownkeen R., Skuce C.D., Smith M.L., Sotheran E.C., Steingruber H.E., Steward C.A., Storey R., Swann R.M., Swarbreck D., Tabor P.E., Taudien S., Taylor T., Teague B., Thomas K., Thorpe A., Timms K., Tracey A., Trevanion S., Tromans A.C., d'Urso M., Verduzco D., Villasana D., Waldron L., Wall M., Wang Q., Warren J., Warry G.L., Wei X., West A., Whitehead S.L., Whiteley M.N., Wilkinson J.E., Willey D.L., Williams G., Williams L., Williamson A., Williamson H., Wilming L., Woodmansey R.L., Wray P.W., Yen J., Zhang J., Zhou J., Zoghbi H., Zorilla S., Buck D., Reinhardt R., Poustka A., Rosenthal A., Lehrach H., Meindl A., Minx P.J., Hillier L.W., Willard H.F., Wilson R.K., Waterston R.H., Rice C.M., Vaudin M., Coulson A., Nelson D.L., Weinstock G., Sulston J.E., Durbin R.M., Hubbard T., Gibbs R.A., Beck S., Rogers J., Bentley D.R.
Nature 434:325-337(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[10]Mural R.J., Istrail S., Sutton G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[11]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 12-122 (ISOFORM 3).
Tissue: Colon and Melanoma.
[12]"Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)."
Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 5-134.
[13]"Modulation of T-cell activation by the glucocorticoid-induced leucine zipper factor via inhibition of nuclear factor kappa B."
Ayroldi E., Migliorati G., Bruscoli S., Marchetti C., Zollo O., Cannarile L., D'Adamio F., Riccardi C.
Blood 98:743-753(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: INTERACTION WITH NFKB1.
[14]"Synthesis of glucocorticoid-induced leucine zipper (GILZ) by macrophages: an anti-inflammatory and immunosuppressive mechanism shared by glucocorticoids and IL-10."
Berrebi D., Bruscoli S., Cohen N., Foussat A., Migliorati G., Bouchet-Delbos L., Maillot M.-C., Portier A., Couderc J., Galanaud P., Peuchmaur M., Riccardi C., Emilie D.
Blood 101:729-738(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: TISSUE SPECIFICITY, INDUCTION, INTERACTION WITH NFKB1.
[15]"GILZ, a new target for the transcription factor FoxO3, protects T lymphocytes from interleukin-2 withdrawal-induced apoptosis."
Asselin-Labat M.-L., David M., Biola-Vidamment A., Lecoeuche D., Zennaro M.-C., Bertoglio J., Pallardy M.
Blood 104:215-223(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION, INDUCTION.
[16]"A quantitative atlas of mitotic phosphorylation."
Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P.
Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-42 AND SER-73 (ISOFORM 2), IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[17]"Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
[18]"Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
Z50781 mRNA. Translation: CAA90644.1. Different initiation.
AF228339 mRNA. Translation: AAG12456.1.
AF183393 mRNA. Translation: AAD56234.1.
AB025432 mRNA. Translation: BAB18680.1.
AF153603 mRNA. Translation: AAD41085.1.
AL110191 mRNA. Translation: CAB53669.1. Frameshift.
AK092645 mRNA. Translation: BAC03934.1.
AK092669 mRNA. Translation: BAG52587.1.
AL590423 Genomic DNA. Translation: CAI41544.1.
CH471120 Genomic DNA. Translation: EAX02704.1.
CH471120 Genomic DNA. Translation: EAX02705.1.
CH471120 Genomic DNA. Translation: EAX02706.1.
CR933650 mRNA. Translation: CAI45951.1.
BC018148 mRNA. Translation: AAH18148.3. Different initiation.
BC072446 mRNA. Translation: AAH72446.1.
CR533450 mRNA. Translation: CAG38481.1.
PIRT14749.
RefSeqNP_001015881.1. NM_001015881.1.
NP_004080.2. NM_004089.3.
NP_932174.1. NM_198057.2.
XP_005262155.1. XM_005262098.1.
XP_005262156.1. XM_005262099.1.
XP_005262157.1. XM_005262100.1.
XP_005262158.1. XM_005262101.1.
XP_005262159.1. XM_005262102.1.
XP_005262160.1. XM_005262103.1.
UniGeneHs.522074.

3D structure databases

ProteinModelPortalQ99576.
SMRQ99576. Positions 58-134.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid108165. 22 interactions.
IntActQ99576. 5 interactions.
MINTMINT-4715756.
STRING9606.ENSP00000361458.

PTM databases

PhosphoSiteQ99576.

Polymorphism databases

DMDM14195584.

Proteomic databases

PaxDbQ99576.
PRIDEQ99576.

Protocols and materials databases

DNASU1831.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000315660; ENSP00000314655; ENSG00000157514. [Q99576-3]
ENST00000372383; ENSP00000361458; ENSG00000157514. [Q99576-3]
ENST00000372384; ENSP00000361459; ENSG00000157514. [Q99576-3]
ENST00000372397; ENSP00000361474; ENSG00000157514. [Q99576-1]
ENST00000506081; ENSP00000427427; ENSG00000157514. [Q99576-3]
GeneID1831.
KEGGhsa:1831.
UCSCuc004enf.3. human. [Q99576-1]
uc004enh.3. human. [Q99576-3]

Organism-specific databases

CTD1831.
GeneCardsGC0XM106956.
HGNCHGNC:3051. TSC22D3.
HPAHPA001916.
MIM300506. gene.
neXtProtNX_Q99576.
PharmGKBPA27504.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG329226.
HOVERGENHBG056226.
OMASTEMFAK.
PhylomeDBQ99576.
TreeFamTF329224.

Enzyme and pathway databases

ReactomeREACT_15518. Transmembrane transport of small molecules.

Gene expression databases

ArrayExpressQ99576.
BgeeQ99576.
CleanExHS_TSC22D3.
GenevestigatorQ99576.

Family and domain databases

InterProIPR000580. TSC-22_Dip_Bun.
[Graphical view]
PANTHERPTHR12348. PTHR12348. 1 hit.
PfamPF01166. TSC22. 1 hit.
[Graphical view]
ProDomPD007152. TSC-22_Dip_Bun. 1 hit.
[Graphical view] [Entries sharing at least one domain]
PROSITEPS01289. TSC22. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSTSC22D3. human.
GeneWikiTSC22D3.
GenomeRNAi1831.
NextBio7473.
PROQ99576.
SOURCESearch...

Entry information

Entry nameT22D3_HUMAN
AccessionPrimary (citable) accession number: Q99576
Secondary accession number(s): Q5H9S3 expand/collapse secondary AC list , Q5JRI9, Q6FIH6, Q8NAI1, Q8WVB9, Q9UBN5, Q9UG13
Entry history
Integrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: June 1, 2001
Last modified: April 16, 2014
This is version 130 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human chromosome X

Human chromosome X: entries, gene names and cross-references to MIM