Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

M-phase phosphoprotein 9

Gene

MPHOSPH9

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Caution

Names & Taxonomyi

Protein namesi
Recommended name:
M-phase phosphoprotein 9
Gene namesi
Name:MPHOSPH9
Synonyms:MPP9
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 12

Organism-specific databases

EuPathDBiHostDB:ENSG00000051825.14
HGNCiHGNC:7215 MPHOSPH9
MIMi605501 gene
neXtProtiNX_Q99550

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Golgi apparatus, Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi10198
OpenTargetsiENSG00000051825
PharmGKBiPA30921

Polymorphism and mutation databases

DMDMi215274134

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000965571 – 1183M-phase phosphoprotein 9Add BLAST1183

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei994PhosphoserineCombined sources1

Post-translational modificationi

Phosphorylated in M (mitotic) phase.1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ99550
PaxDbiQ99550
PeptideAtlasiQ99550
PRIDEiQ99550

PTM databases

iPTMnetiQ99550
PhosphoSitePlusiQ99550

Expressioni

Gene expression databases

BgeeiENSG00000051825
CleanExiHS_MPHOSPH9
ExpressionAtlasiQ99550 baseline and differential
GenevisibleiQ99550 HS

Organism-specific databases

HPAiHPA037485

Interactioni

Protein-protein interaction databases

BioGridi11549333 interactors.
IntActiQ99550 30 interactors.
STRINGi9606.ENSP00000445859

Structurei

3D structure databases

ProteinModelPortaliQ99550
SMRiQ99550
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili609 – 804Sequence analysisAdd BLAST196
Coiled coili1109 – 1174Sequence analysisAdd BLAST66

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiENOG410IKA1 Eukaryota
ENOG410XSEU LUCA
GeneTreeiENSGT00500000044984
HOGENOMiHOG000113636
HOVERGENiHBG108143
InParanoidiQ99550
KOiK16775
OMAiKQENKMF
OrthoDBiEOG091G00RN
TreeFamiTF336168

Family and domain databases

InterProiView protein in InterPro
IPR026636 MPHOSPH9
PANTHERiPTHR14926 PTHR14926, 1 hit

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q99550-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEEFDLVKTL HKTSSSVGSD ENSLHSLGLN LNTDRSSPHL STNGVSSFSG
60 70 80 90 100
KTRPSVIQGT VEVLTSLMQE LQNSGKTDSE LWKNCETRWL QLFNLVEKQC
110 120 130 140 150
QEQIVAQQEQ FHNQIQHIQE EIKNLVKLQT SSASLASCEG NSSNKQVSSE
160 170 180 190 200
SQMGFFSLSS ERNESVIHYP ESTEPEIQQE MSTSQPDCNV DSCSVSSGYG
210 220 230 240 250
TFCISELNLY KSKDPKEFME HIDVPKGQYV APAVPAESLV DGVKNENFYI
260 270 280 290 300
QTPEECHVSL KEDVSISPGE FEHNFLGENK VSEVYSGKTN SNAITSWAQK
310 320 330 340 350
LKQNQPKRAH VEDGGSRSKQ GNEQSKKTPI EKSDFAAATH PRAFYLSKPD
360 370 380 390 400
ETPNAWMSDS GTGLTYWKLE EKDMHHSLPE TLEKTFISLS STDVSPNQSN
410 420 430 440 450
TSNEMKLPSL KDIYYKKQRE NKQLPERNLT SASNPNHPPE VLTLDPTLHM
460 470 480 490 500
KPKQQISGIQ PHGLPNALDD RISFSPDSVL EPSMSSPSDI DSFSQASNVT
510 520 530 540 550
SQLPGFPKYP SHTKASPVDS WKNQTFQNES RTSSTFPSVY TITSNDISVN
560 570 580 590 600
TVDEENTVMV ASASVSQSQL PGTANSVPEC ISLTSLEDPV ILSKIRQNLK
610 620 630 640 650
EKHARHIADL RAYYESEINS LKQKLEAKEI SGVEDWKITN QILVDRCGQL
660 670 680 690 700
DSALHEATSR VRTLENKNNL LEIEVNDLRE RFSAASSASK ILQERIEEMR
710 720 730 740 750
TSSKEKDNTI IRLKSRLQDL EEAFENAYKL SDDKEAQLKQ ENKMFQDLLG
760 770 780 790 800
EYESLGKEHR RVKDALNTTE NKLLDAYTQI SDLKRMISKL EAQVKQVEHE
810 820 830 840 850
NMLSLRHNSR IHVRPSRANT LATSDVSRRK WLIPGAEYSI FTGQPLDTQD
860 870 880 890 900
SNVDNQLEET CSLGHRSPLE KDSSPGSSST SLLIKKQRET SDTPIMRALK
910 920 930 940 950
ELDEGKIFKN WGTQTEKEDT SNINPRQTET SVNASRSPEK CAQQRQKRLN
960 970 980 990 1000
SASQRSSSLP PSNRKSSTPT KREIMLTPVT VAYSPKRSPK ENLSPGFSHL
1010 1020 1030 1040 1050
LSKNESSPIR FDILLDDLDT VPVSTLQRTN PRKQLQFLPL DDSEEKTYSE
1060 1070 1080 1090 1100
KATDNHVNHS SCPEPVPNGV KKVSVRTAWE KNKSVSYEQC KPVSVTPQGN
1110 1120 1130 1140 1150
DFEYTAKIRT LAETERFFDE LTKEKDQIEA ALSRMPSPGG RITLQTRLNQ
1160 1170 1180
EALEDRLERI NRELGSVRMT LKKFHVLRTS ANL
Note: No experimental confirmation. Gene prediction based on EST data.
Length:1,183
Mass (Da):133,024
Last modified:July 9, 2014 - v4
Checksum:i035ABB95C20547E4
GO
Isoform 2 (identifier: Q99550-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1151-1183: EALEDRLERINRELGSVRMTLKKFHVLRTSANL → TPQICEESSHKCAFAGHYVPCHLYDYRFQG

Note: No experimental confirmation available.
Show »
Length:1,180
Mass (Da):132,615
Checksum:iE663949CB98D606B
GO

Sequence cautioni

The sequence BAB14359 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence BAG52299 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence EAW98394 differs from that shown. Reason: Erroneous gene model prediction.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti947K → E in BAB14359 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_047643277G → S1 PublicationCorresponds to variant dbSNP:rs36121382Ensembl.1
Natural variantiVAR_0476441078A → D. Corresponds to variant dbSNP:rs1260318Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0358381151 – 1183EALED…TSANL → TPQICEESSHKCAFAGHYVP CHLYDYRFQG in isoform 2. 1 PublicationAdd BLAST33

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC068768 Genomic DNA No translation available.
AC073857 Genomic DNA No translation available.
CH471054 Genomic DNA Translation: EAW98392.1
CH471054 Genomic DNA Translation: EAW98394.1 Sequence problems.
AK023016 mRNA Translation: BAB14359.1 Different initiation.
AK091181 mRNA Translation: BAG52299.1 Different initiation.
BC130440 mRNA Translation: AAI30441.1
X98258 mRNA Translation: CAA66911.1
CCDSiCCDS9243.2 [Q99550-1]
RefSeqiNP_073619.3, NM_022782.3 [Q99550-1]
XP_016874162.1, XM_017018673.1 [Q99550-1]
XP_016874168.1, XM_017018679.1
XP_016874169.1, XM_017018680.1
UniGeneiHs.577404
Hs.735822

Genome annotation databases

EnsembliENST00000606320; ENSP00000475489; ENSG00000051825 [Q99550-1]
GeneIDi10198
KEGGihsa:10198
UCSCiuc001uel.5 human [Q99550-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiMPP9_HUMAN
AccessioniPrimary (citable) accession number: Q99550
Secondary accession number(s): A1L486
, A6NEE2, B3KR87, Q9H976, U3KQ28
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: July 9, 2014
Last modified: February 28, 2018
This is version 141 of the entry and version 4 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome