Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q99435 (NELL2_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 134. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Protein kinase C-binding protein NELL2
Alternative name(s):
NEL-like protein 2
Nel-related protein 2
Gene names
Name:NELL2
Synonyms:NRP2
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length816 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at protein level

General annotation (Comments)

Subunit structure

Homotrimer. Binds to PKC beta-1 By similarity.

Subcellular location

Secreted By similarity.

Sequence similarities

Contains 6 EGF-like domains.

Contains 1 laminin G-like domain.

Contains 3 VWFC domains.

Ontologies

Keywords
   Cellular componentSecreted
   Coding sequence diversityAlternative splicing
Polymorphism
   DomainEGF-like domain
Repeat
Signal
   LigandCalcium
   PTMDisulfide bond
Glycoprotein
   Technical termComplete proteome
Direct protein sequencing
Reference proteome
Gene Ontology (GO)
   Cellular_componentextracellular region

Inferred from electronic annotation. Source: UniProtKB-SubCell

   Molecular_functioncalcium ion binding

Inferred from electronic annotation. Source: InterPro

protein binding

Inferred from physical interaction PubMed 16713569. Source: IntAct

Complete GO annotation...

Binary interactions

With

Entry

#Exp.

IntAct

Notes

GFI1BQ5VTD92EBI-946274,EBI-946212

Alternative products

This entry describes 4 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q99435-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q99435-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MSIRRLLILILKIGRRWTELIRTM
Note: No experimental confirmation available.
Isoform 3 (identifier: Q99435-3)

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MGFPPLLKGQASATRSSLASCSWVVFFLSCLSRHAPEIEGGRRWTELIRTM
Note: No experimental confirmation available.
Isoform 4 (identifier: Q99435-4)

The sequence of this isoform differs from the canonical sequence as follows:
     1-18: MESRVLLRTFCLIFGLGA → METGLGAPLFKAWLLIS

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Signal peptide1 – 2121 Ref.7
Chain22 – 816795Protein kinase C-binding protein NELL2
PRO_0000007666

Regions

Domain64 – 228165Laminin G-like
Domain272 – 33160VWFC 1
Domain397 – 43943EGF-like 1
Domain440 – 48142EGF-like 2; calcium-binding Potential
Domain482 – 52241EGF-like 3; calcium-binding Potential
Domain523 – 55331EGF-like 4
Domain555 – 60147EGF-like 5; calcium-binding Potential
Domain602 – 63736EGF-like 6; calcium-binding Potential
Domain638 – 69356VWFC 2
Domain698 – 75659VWFC 3

Amino acid modifications

Glycosylation531N-linked (GlcNAc...) Potential
Glycosylation2251N-linked (GlcNAc...) Potential
Glycosylation2931N-linked (GlcNAc...) Potential
Glycosylation2981N-linked (GlcNAc...) Potential
Glycosylation5171N-linked (GlcNAc...) Potential
Glycosylation6151N-linked (GlcNAc...) Potential
Glycosylation6351N-linked (GlcNAc...) Potential
Disulfide bond401 ↔ 413 By similarity
Disulfide bond407 ↔ 422 By similarity
Disulfide bond424 ↔ 438 By similarity
Disulfide bond444 ↔ 457 By similarity
Disulfide bond451 ↔ 466 By similarity
Disulfide bond468 ↔ 480 By similarity
Disulfide bond486 ↔ 499 By similarity
Disulfide bond493 ↔ 508 By similarity
Disulfide bond510 ↔ 521 By similarity
Disulfide bond525 ↔ 535 By similarity
Disulfide bond529 ↔ 541 By similarity
Disulfide bond543 ↔ 552 By similarity
Disulfide bond559 ↔ 572 By similarity
Disulfide bond566 ↔ 581 By similarity
Disulfide bond583 ↔ 600 By similarity
Disulfide bond606 ↔ 619 By similarity
Disulfide bond613 ↔ 628 By similarity
Disulfide bond630 ↔ 636 By similarity

Natural variations

Alternative sequence1 – 1818MESRV…FGLGA → METGLGAPLFKAWLLIS in isoform 4.
VSP_043869
Alternative sequence11M → MSIRRLLILILKIGRRWTEL IRTM in isoform 2.
VSP_043801
Alternative sequence11M → MGFPPLLKGQASATRSSLAS CSWVVFFLSCLSRHAPEIEG GRRWTELIRTM in isoform 3.
VSP_043802
Natural variant51V → I.
Corresponds to variant rs2658973 [ dbSNP | Ensembl ].
VAR_048987
Natural variant3471N → D.
Corresponds to variant rs17574839 [ dbSNP | Ensembl ].
VAR_048988
Natural variant6311P → L.
Corresponds to variant rs1050710 [ dbSNP | Ensembl ].
VAR_048989

Experimental info

Sequence conflict3531S → P in BAH12990. Ref.3
Sequence conflict4541N → D in BAH12990. Ref.3
Sequence conflict4891N → D in BAH14331. Ref.3
Sequence conflict6361C → S in BAH14331. Ref.3

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified May 1, 1997. Version 1.
Checksum: 89370B987DC7A324

FASTA81691,346
        10         20         30         40         50         60 
MESRVLLRTF CLIFGLGAVW GLGVDPSLQI DVLTELELGE STTGVRQVPG LHNGTKAFLF 

        70         80         90        100        110        120 
QDTPRSIKAS TATAEQFFQK LRNKHEFTIL VTLKQTHLNS GVILSIHHLD HRYLELESSG 

       130        140        150        160        170        180 
HRNEVRLHYR SGSHRPHTEV FPYILADDKW HKLSLAISAS HLILHIDCNK IYERVVEKPS 

       190        200        210        220        230        240 
TDLPLGTTFW LGQRNNAHGY FKGIMQDVQL LVMPQGFIAQ CPDLNRTCPT CNDFHGLVQK 

       250        260        270        280        290        300 
IMELQDILAK TSAKLSRAEQ RMNRLDQCYC ERTCTMKGTT YREFESWIDG CKNCTCLNGT 

       310        320        330        340        350        360 
IQCETLICPN PDCPLKSALA YVDGKCCKEC KSICQFQGRT YFEGERNTVY SSSGVCVLYE 

       370        380        390        400        410        420 
CKDQTMKLVE SSGCPALDCP ESHQITLSHS CCKVCKGYDF CSERHNCMEN SICRNLNDRA 

       430        440        450        460        470        480 
VCSCRDGFRA LREDNAYCED IDECAEGRHY CRENTMCVNT PGSFMCICKT GYIRIDDYSC 

       490        500        510        520        530        540 
TEHDECITNQ HNCDENALCF NTVGGHNCVC KPGYTGNGTT CKAFCKDGCR NGGACIAANV 

       550        560        570        580        590        600 
CACPQGFTGP SCETDIDECS DGFVQCDSRA NCINLPGWYH CECRDGYHDN GMFSPSGESC 

       610        620        630        640        650        660 
EDIDECGTGR HSCANDTICF NLDGGYDCRC PHGKNCTGDC IHDGKVKHNG QIWVLENDRC 

       670        680        690        700        710        720 
SVCSCQNGFV MCRRMVCDCE NPTVDLFCCP ECDPRLSSQC LHQNGETLYN SGDTWVQNCQ 

       730        740        750        760        770        780 
QCRCLQGEVD CWPLPCPDVE CEFSILPENE CCPRCVTDPC QADTIRNDIT KTCLDEMNVV 

       790        800        810 
RFTGSSWIKH GTECTLCQCK NGHICCSVDP QCLQEL 

« Hide

Isoform 2 [UniParc].

Checksum: E7A4531EAB965749
Show »

FASTA83994,180
Isoform 3 [UniParc].

Checksum: 87C3D940EEC2BC68
Show »

FASTA86696,880
Isoform 4 [UniParc].

Checksum: 907D0AC0BD4B85D1
Show »

FASTA81591,167

References

« Hide 'large scale' references
[1]"Cloning and characterization of two novel human cDNAs (NELL1 and NELL2) encoding proteins with six EGF-like repeats."
Watanabe T.K., Katagiri T., Suzuki M., Shimizu F., Fujiwara T., Kanemoto N., Nakamura Y., Hirai Y., Maekawa H., Takahashi E.
Genomics 38:273-276(1996) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
Tissue: Brain.
[2]"Biological functions of a novel human gene, hucep-12, which is specifically expressed in the central nervous system."
Yoshimoto M., Yazaki M., Takayama K., Matsumoto K.
Submitted (NOV-1996) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4).
Tissue: Brain.
[3]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2; 3 AND 4).
Tissue: Amygdala, Brain and Hippocampus.
[4]"The finished DNA sequence of human chromosome 12."
Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R. expand/collapse author list , Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Montgomery K.T., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Lovering R.C., Wheeler D.A., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clerc-Blankenburg K.P., Davis C., Delgado O., Dinh H.H., Draper H., Gonzalez-Garay M.L., Havlak P., Jackson L.R., Jacob L.S., Kelly S.H., Li L., Li Z., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Pasternak S., Perez L.M., Plopper F.J.H., Santibanez J., Shen H., Tabor P.E., Verduzco D., Waldron L., Wang Q., Williams G.A., Zhang J., Zhou J., Allen C.C., Amin A.G., Anyalebechi V., Bailey M., Barbaria J.A., Bimage K.E., Bryant N.P., Burch P.E., Burkett C.E., Burrell K.L., Calderon E., Cardenas V., Carter K., Casias K., Cavazos I., Cavazos S.R., Ceasar H., Chacko J., Chan S.N., Chavez D., Christopoulos C., Chu J., Cockrell R., Cox C.D., Dang M., Dathorne S.R., David R., Davis C.M., Davy-Carroll L., Deshazo D.R., Donlin J.E., D'Souza L., Eaves K.A., Egan A., Emery-Cohen A.J., Escotto M., Flagg N., Forbes L.D., Gabisi A.M., Garza M., Hamilton C., Henderson N., Hernandez O., Hines S., Hogues M.E., Huang M., Idlebird D.G., Johnson R., Jolivet A., Jones S., Kagan R., King L.M., Leal B., Lebow H., Lee S., LeVan J.M., Lewis L.C., London P., Lorensuhewa L.M., Loulseged H., Lovett D.A., Lucier A., Lucier R.L., Ma J., Madu R.C., Mapua P., Martindale A.D., Martinez E., Massey E., Mawhiney S., Meador M.G., Mendez S., Mercado C., Mercado I.C., Merritt C.E., Miner Z.L., Minja E., Mitchell T., Mohabbat F., Mohabbat K., Montgomery B., Moore N., Morris S., Munidasa M., Ngo R.N., Nguyen N.B., Nickerson E., Nwaokelemeh O.O., Nwokenkwo S., Obregon M., Oguh M., Oragunye N., Oviedo R.J., Parish B.J., Parker D.N., Parrish J., Parks K.L., Paul H.A., Payton B.A., Perez A., Perrin W., Pickens A., Primus E.L., Pu L.-L., Puazo M., Quiles M.M., Quiroz J.B., Rabata D., Reeves K., Ruiz S.J., Shao H., Sisson I., Sonaike T., Sorelle R.P., Sutton A.E., Svatek A.F., Svetz L.A., Tamerisa K.S., Taylor T.R., Teague B., Thomas N., Thorn R.D., Trejos Z.Y., Trevino B.K., Ukegbu O.N., Urban J.B., Vasquez L.I., Vera V.A., Villasana D.M., Wang L., Ward-Moore S., Warren J.T., Wei X., White F., Williamson A.L., Wleczyk R., Wooden H.S., Wooden S.H., Yen J., Yoon L., Yoon V., Zorrilla S.E., Nelson D., Kucherlapati R., Weinstock G., Gibbs R.A.
Nature 440:346-351(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[5]Mural R.J., Istrail S., Sutton G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[6]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Duodenum.
[7]"Signal peptide prediction based on analysis of experimentally verified cleavage sites."
Zhang Z., Henzel W.J.
Protein Sci. 13:2819-2824(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: PROTEIN SEQUENCE OF 22-36 (ISOFORM 1).
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
D83018 mRNA. Translation: BAA11681.1.
D89629 mRNA. Translation: BAB46925.1.
AK295125 mRNA. Translation: BAH11983.1.
AK299277 mRNA. Translation: BAH12990.1.
AK315960 mRNA. Translation: BAH14331.1.
AK316058 mRNA. Translation: BAH14429.1.
AC018923 Genomic DNA. No translation available.
AC025253 Genomic DNA. No translation available.
AC079033 Genomic DNA. No translation available.
AC079825 Genomic DNA. No translation available.
AC090012 Genomic DNA. No translation available.
CH471111 Genomic DNA. Translation: EAW57873.1.
BC020544 mRNA. Translation: AAH20544.1.
CCDSCCDS44863.1. [Q99435-3]
CCDS44864.1. [Q99435-4]
CCDS53781.1. [Q99435-2]
CCDS8746.1. [Q99435-1]
RefSeqNP_001138579.1. NM_001145107.1. [Q99435-3]
NP_001138580.1. NM_001145108.1. [Q99435-1]
NP_001138581.1. NM_001145109.1. [Q99435-4]
NP_001138582.1. NM_001145110.1. [Q99435-2]
NP_006150.1. NM_006159.2. [Q99435-1]
XP_005268962.1. XM_005268905.2. [Q99435-1]
UniGeneHs.505326.

3D structure databases

ProteinModelPortalQ99435.
SMRQ99435. Positions 84-211, 370-636.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid110828. 5 interactions.
IntActQ99435. 9 interactions.
MINTMINT-2856232.
STRING9606.ENSP00000416341.

Polymorphism databases

DMDM2494289.

Proteomic databases

PaxDbQ99435.
PRIDEQ99435.

Protocols and materials databases

DNASU4753.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000333837; ENSP00000327988; ENSG00000184613. [Q99435-2]
ENST00000395487; ENSP00000378866; ENSG00000184613. [Q99435-4]
ENST00000429094; ENSP00000390680; ENSG00000184613. [Q99435-1]
ENST00000437801; ENSP00000416341; ENSG00000184613. [Q99435-3]
ENST00000452445; ENSP00000394612; ENSG00000184613. [Q99435-1]
ENST00000549027; ENSP00000447927; ENSG00000184613. [Q99435-4]
GeneID4753.
KEGGhsa:4753.
UCSCuc001rof.3. human. [Q99435-4]
uc001rog.2. human. [Q99435-1]
uc010skz.1. human. [Q99435-3]
uc010sla.1. human. [Q99435-2]

Organism-specific databases

CTD4753.
GeneCardsGC12M044981.
HGNCHGNC:7751. NELL2.
HPAHPA035715.
MIM602320. gene.
neXtProtNX_Q99435.
PharmGKBPA31553.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG253557.
HOGENOMHOG000217920.
HOVERGENHBG004805.
InParanoidQ99435.
OMADTICFNL.
OrthoDBEOG71VSRX.
PhylomeDBQ99435.
TreeFamTF323325.

Gene expression databases

ArrayExpressQ99435.
BgeeQ99435.
CleanExHS_NELL2.
HS_NRP2.
GenevestigatorQ99435.

Family and domain databases

Gene3D2.60.120.200. 1 hit.
InterProIPR008985. ConA-like_lec_gl_sf.
IPR013320. ConA-like_subgrp.
IPR000742. EG-like_dom.
IPR001881. EGF-like_Ca-bd_dom.
IPR013032. EGF-like_CS.
IPR000152. EGF-type_Asp/Asn_hydroxyl_site.
IPR018097. EGF_Ca-bd_CS.
IPR009030. Growth_fac_rcpt_N_dom.
IPR001791. Laminin_G.
IPR001007. VWF_C.
[Graphical view]
PfamPF07645. EGF_CA. 4 hits.
PF02210. Laminin_G_2. 1 hit.
PF00093. VWC. 2 hits.
[Graphical view]
SMARTSM00181. EGF. 2 hits.
SM00179. EGF_CA. 3 hits.
SM00282. LamG. 1 hit.
SM00210. TSPN. 1 hit.
SM00214. VWC. 3 hits.
[Graphical view]
SUPFAMSSF49899. SSF49899. 1 hit.
SSF57184. SSF57184. 1 hit.
PROSITEPS00010. ASX_HYDROXYL. 3 hits.
PS00022. EGF_1. 1 hit.
PS01186. EGF_2. 4 hits.
PS50026. EGF_3. 6 hits.
PS01187. EGF_CA. 3 hits.
PS01208. VWFC_1. 2 hits.
PS50184. VWFC_2. 3 hits.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSNELL2. human.
GeneWikiNELL2.
GenomeRNAi4753.
NextBio18320.
PROQ99435.
SOURCESearch...

Entry information

Entry nameNELL2_HUMAN
AccessionPrimary (citable) accession number: Q99435
Secondary accession number(s): B7Z2U7 expand/collapse secondary AC list , B7Z5Q4, B7Z9J5, B7Z9U3, Q96JS2
Entry history
Integrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: May 1, 1997
Last modified: July 9, 2014
This is version 134 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 12

Human chromosome 12: entries, gene names and cross-references to MIM