Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q99435

- NELL2_HUMAN

UniProt

Q99435 - NELL2_HUMAN

Protein

Protein kinase C-binding protein NELL2

Gene

NELL2

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 135 (01 Oct 2014)
      Sequence version 1 (01 May 1997)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    GO - Molecular functioni

    1. calcium ion binding Source: InterPro
    2. protein binding Source: IntAct

    Keywords - Ligandi

    Calcium

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Protein kinase C-binding protein NELL2
    Alternative name(s):
    NEL-like protein 2
    Nel-related protein 2
    Gene namesi
    Name:NELL2
    Synonyms:NRP2
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 12

    Organism-specific databases

    HGNCiHGNC:7751. NELL2.

    Subcellular locationi

    Secreted By similarity

    GO - Cellular componenti

    1. extracellular region Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Secreted

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA31553.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 2121Add
    BLAST
    Chaini22 – 816795Protein kinase C-binding protein NELL2PRO_0000007666Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi53 – 531N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi225 – 2251N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi293 – 2931N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi298 – 2981N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi401 ↔ 413PROSITE-ProRule annotation
    Disulfide bondi407 ↔ 422PROSITE-ProRule annotation
    Disulfide bondi424 ↔ 438PROSITE-ProRule annotation
    Disulfide bondi444 ↔ 457PROSITE-ProRule annotation
    Disulfide bondi451 ↔ 466PROSITE-ProRule annotation
    Disulfide bondi468 ↔ 480PROSITE-ProRule annotation
    Disulfide bondi486 ↔ 499PROSITE-ProRule annotation
    Disulfide bondi493 ↔ 508PROSITE-ProRule annotation
    Disulfide bondi510 ↔ 521PROSITE-ProRule annotation
    Glycosylationi517 – 5171N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi525 ↔ 535PROSITE-ProRule annotation
    Disulfide bondi529 ↔ 541PROSITE-ProRule annotation
    Disulfide bondi543 ↔ 552PROSITE-ProRule annotation
    Disulfide bondi559 ↔ 572PROSITE-ProRule annotation
    Disulfide bondi566 ↔ 581PROSITE-ProRule annotation
    Disulfide bondi583 ↔ 600PROSITE-ProRule annotation
    Disulfide bondi606 ↔ 619PROSITE-ProRule annotation
    Disulfide bondi613 ↔ 628PROSITE-ProRule annotation
    Glycosylationi615 – 6151N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi630 ↔ 636PROSITE-ProRule annotation
    Glycosylationi635 – 6351N-linked (GlcNAc...)Sequence Analysis

    Keywords - PTMi

    Disulfide bond, Glycoprotein

    Proteomic databases

    PaxDbiQ99435.
    PRIDEiQ99435.

    Expressioni

    Gene expression databases

    ArrayExpressiQ99435.
    BgeeiQ99435.
    CleanExiHS_NELL2.
    HS_NRP2.
    GenevestigatoriQ99435.

    Organism-specific databases

    HPAiHPA035715.

    Interactioni

    Subunit structurei

    Homotrimer. Binds to PKC beta-1 By similarity.By similarity

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    GFI1BQ5VTD92EBI-946274,EBI-946212

    Protein-protein interaction databases

    BioGridi110828. 5 interactions.
    IntActiQ99435. 9 interactions.
    MINTiMINT-2856232.
    STRINGi9606.ENSP00000416341.

    Structurei

    3D structure databases

    ProteinModelPortaliQ99435.
    SMRiQ99435. Positions 84-211, 370-636.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini64 – 228165Laminin G-likeAdd
    BLAST
    Domaini272 – 33160VWFC 1PROSITE-ProRule annotationAdd
    BLAST
    Domaini397 – 43943EGF-like 1PROSITE-ProRule annotationAdd
    BLAST
    Domaini440 – 48142EGF-like 2; calcium-bindingPROSITE-ProRule annotationAdd
    BLAST
    Domaini482 – 52241EGF-like 3; calcium-bindingPROSITE-ProRule annotationAdd
    BLAST
    Domaini523 – 55331EGF-like 4PROSITE-ProRule annotationAdd
    BLAST
    Domaini555 – 60147EGF-like 5; calcium-bindingPROSITE-ProRule annotationAdd
    BLAST
    Domaini602 – 63736EGF-like 6; calcium-bindingPROSITE-ProRule annotationAdd
    BLAST
    Domaini638 – 69356VWFC 2PROSITE-ProRule annotationAdd
    BLAST
    Domaini698 – 75659VWFC 3PROSITE-ProRule annotationAdd
    BLAST

    Sequence similaritiesi

    Contains 6 EGF-like domains.PROSITE-ProRule annotation
    Contains 1 laminin G-like domain.Curated
    Contains 3 VWFC domains.PROSITE-ProRule annotation

    Keywords - Domaini

    EGF-like domain, Repeat, Signal

    Phylogenomic databases

    eggNOGiNOG253557.
    HOGENOMiHOG000217920.
    HOVERGENiHBG004805.
    InParanoidiQ99435.
    OMAiDTICFNL.
    OrthoDBiEOG71VSRX.
    PhylomeDBiQ99435.
    TreeFamiTF323325.

    Family and domain databases

    Gene3Di2.60.120.200. 1 hit.
    InterProiIPR008985. ConA-like_lec_gl_sf.
    IPR013320. ConA-like_subgrp.
    IPR000742. EG-like_dom.
    IPR001881. EGF-like_Ca-bd_dom.
    IPR013032. EGF-like_CS.
    IPR000152. EGF-type_Asp/Asn_hydroxyl_site.
    IPR018097. EGF_Ca-bd_CS.
    IPR009030. Growth_fac_rcpt_N_dom.
    IPR001791. Laminin_G.
    IPR001007. VWF_C.
    [Graphical view]
    PfamiPF07645. EGF_CA. 4 hits.
    PF02210. Laminin_G_2. 1 hit.
    PF00093. VWC. 2 hits.
    [Graphical view]
    SMARTiSM00181. EGF. 2 hits.
    SM00179. EGF_CA. 3 hits.
    SM00282. LamG. 1 hit.
    SM00210. TSPN. 1 hit.
    SM00214. VWC. 3 hits.
    [Graphical view]
    SUPFAMiSSF49899. SSF49899. 1 hit.
    SSF57184. SSF57184. 1 hit.
    PROSITEiPS00010. ASX_HYDROXYL. 3 hits.
    PS00022. EGF_1. 1 hit.
    PS01186. EGF_2. 4 hits.
    PS50026. EGF_3. 6 hits.
    PS01187. EGF_CA. 3 hits.
    PS01208. VWFC_1. 2 hits.
    PS50184. VWFC_2. 3 hits.
    [Graphical view]

    Sequences (4)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q99435-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MESRVLLRTF CLIFGLGAVW GLGVDPSLQI DVLTELELGE STTGVRQVPG    50
    LHNGTKAFLF QDTPRSIKAS TATAEQFFQK LRNKHEFTIL VTLKQTHLNS 100
    GVILSIHHLD HRYLELESSG HRNEVRLHYR SGSHRPHTEV FPYILADDKW 150
    HKLSLAISAS HLILHIDCNK IYERVVEKPS TDLPLGTTFW LGQRNNAHGY 200
    FKGIMQDVQL LVMPQGFIAQ CPDLNRTCPT CNDFHGLVQK IMELQDILAK 250
    TSAKLSRAEQ RMNRLDQCYC ERTCTMKGTT YREFESWIDG CKNCTCLNGT 300
    IQCETLICPN PDCPLKSALA YVDGKCCKEC KSICQFQGRT YFEGERNTVY 350
    SSSGVCVLYE CKDQTMKLVE SSGCPALDCP ESHQITLSHS CCKVCKGYDF 400
    CSERHNCMEN SICRNLNDRA VCSCRDGFRA LREDNAYCED IDECAEGRHY 450
    CRENTMCVNT PGSFMCICKT GYIRIDDYSC TEHDECITNQ HNCDENALCF 500
    NTVGGHNCVC KPGYTGNGTT CKAFCKDGCR NGGACIAANV CACPQGFTGP 550
    SCETDIDECS DGFVQCDSRA NCINLPGWYH CECRDGYHDN GMFSPSGESC 600
    EDIDECGTGR HSCANDTICF NLDGGYDCRC PHGKNCTGDC IHDGKVKHNG 650
    QIWVLENDRC SVCSCQNGFV MCRRMVCDCE NPTVDLFCCP ECDPRLSSQC 700
    LHQNGETLYN SGDTWVQNCQ QCRCLQGEVD CWPLPCPDVE CEFSILPENE 750
    CCPRCVTDPC QADTIRNDIT KTCLDEMNVV RFTGSSWIKH GTECTLCQCK 800
    NGHICCSVDP QCLQEL 816
    Length:816
    Mass (Da):91,346
    Last modified:May 1, 1997 - v1
    Checksum:i89370B987DC7A324
    GO
    Isoform 2 (identifier: Q99435-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MSIRRLLILILKIGRRWTELIRTM

    Note: No experimental confirmation available.

    Show »
    Length:839
    Mass (Da):94,180
    Checksum:iE7A4531EAB965749
    GO
    Isoform 3 (identifier: Q99435-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MGFPPLLKGQASATRSSLASCSWVVFFLSCLSRHAPEIEGGRRWTELIRTM

    Note: No experimental confirmation available.

    Show »
    Length:866
    Mass (Da):96,880
    Checksum:i87C3D940EEC2BC68
    GO
    Isoform 4 (identifier: Q99435-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-18: MESRVLLRTFCLIFGLGA → METGLGAPLFKAWLLIS

    Show »
    Length:815
    Mass (Da):91,167
    Checksum:i907D0AC0BD4B85D1
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti353 – 3531S → P in BAH12990. (PubMed:14702039)Curated
    Sequence conflicti454 – 4541N → D in BAH12990. (PubMed:14702039)Curated
    Sequence conflicti489 – 4891N → D in BAH14331. (PubMed:14702039)Curated
    Sequence conflicti636 – 6361C → S in BAH14331. (PubMed:14702039)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti5 – 51V → I.
    Corresponds to variant rs2658973 [ dbSNP | Ensembl ].
    VAR_048987
    Natural varianti347 – 3471N → D.
    Corresponds to variant rs17574839 [ dbSNP | Ensembl ].
    VAR_048988
    Natural varianti631 – 6311P → L.
    Corresponds to variant rs1050710 [ dbSNP | Ensembl ].
    VAR_048989

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 1818MESRV…FGLGA → METGLGAPLFKAWLLIS in isoform 4. 2 PublicationsVSP_043869Add
    BLAST
    Alternative sequencei1 – 11M → MSIRRLLILILKIGRRWTEL IRTM in isoform 2. 1 PublicationVSP_043801
    Alternative sequencei1 – 11M → MGFPPLLKGQASATRSSLAS CSWVVFFLSCLSRHAPEIEG GRRWTELIRTM in isoform 3. 1 PublicationVSP_043802

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    D83018 mRNA. Translation: BAA11681.1.
    D89629 mRNA. Translation: BAB46925.1.
    AK295125 mRNA. Translation: BAH11983.1.
    AK299277 mRNA. Translation: BAH12990.1.
    AK315960 mRNA. Translation: BAH14331.1.
    AK316058 mRNA. Translation: BAH14429.1.
    AC018923 Genomic DNA. No translation available.
    AC025253 Genomic DNA. No translation available.
    AC079033 Genomic DNA. No translation available.
    AC079825 Genomic DNA. No translation available.
    AC090012 Genomic DNA. No translation available.
    CH471111 Genomic DNA. Translation: EAW57873.1.
    BC020544 mRNA. Translation: AAH20544.1.
    CCDSiCCDS44863.1. [Q99435-3]
    CCDS44864.1. [Q99435-4]
    CCDS53781.1. [Q99435-2]
    CCDS8746.1. [Q99435-1]
    RefSeqiNP_001138579.1. NM_001145107.1. [Q99435-3]
    NP_001138580.1. NM_001145108.1. [Q99435-1]
    NP_001138581.1. NM_001145109.1. [Q99435-4]
    NP_001138582.1. NM_001145110.1. [Q99435-2]
    NP_006150.1. NM_006159.2. [Q99435-1]
    XP_005268962.1. XM_005268905.2. [Q99435-1]
    UniGeneiHs.505326.

    Genome annotation databases

    EnsembliENST00000333837; ENSP00000327988; ENSG00000184613. [Q99435-2]
    ENST00000395487; ENSP00000378866; ENSG00000184613. [Q99435-4]
    ENST00000429094; ENSP00000390680; ENSG00000184613. [Q99435-1]
    ENST00000437801; ENSP00000416341; ENSG00000184613. [Q99435-3]
    ENST00000452445; ENSP00000394612; ENSG00000184613. [Q99435-1]
    ENST00000549027; ENSP00000447927; ENSG00000184613. [Q99435-4]
    GeneIDi4753.
    KEGGihsa:4753.
    UCSCiuc001rof.3. human. [Q99435-4]
    uc001rog.2. human. [Q99435-1]
    uc010skz.1. human. [Q99435-3]
    uc010sla.1. human. [Q99435-2]

    Polymorphism databases

    DMDMi2494289.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    D83018 mRNA. Translation: BAA11681.1 .
    D89629 mRNA. Translation: BAB46925.1 .
    AK295125 mRNA. Translation: BAH11983.1 .
    AK299277 mRNA. Translation: BAH12990.1 .
    AK315960 mRNA. Translation: BAH14331.1 .
    AK316058 mRNA. Translation: BAH14429.1 .
    AC018923 Genomic DNA. No translation available.
    AC025253 Genomic DNA. No translation available.
    AC079033 Genomic DNA. No translation available.
    AC079825 Genomic DNA. No translation available.
    AC090012 Genomic DNA. No translation available.
    CH471111 Genomic DNA. Translation: EAW57873.1 .
    BC020544 mRNA. Translation: AAH20544.1 .
    CCDSi CCDS44863.1. [Q99435-3 ]
    CCDS44864.1. [Q99435-4 ]
    CCDS53781.1. [Q99435-2 ]
    CCDS8746.1. [Q99435-1 ]
    RefSeqi NP_001138579.1. NM_001145107.1. [Q99435-3 ]
    NP_001138580.1. NM_001145108.1. [Q99435-1 ]
    NP_001138581.1. NM_001145109.1. [Q99435-4 ]
    NP_001138582.1. NM_001145110.1. [Q99435-2 ]
    NP_006150.1. NM_006159.2. [Q99435-1 ]
    XP_005268962.1. XM_005268905.2. [Q99435-1 ]
    UniGenei Hs.505326.

    3D structure databases

    ProteinModelPortali Q99435.
    SMRi Q99435. Positions 84-211, 370-636.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 110828. 5 interactions.
    IntActi Q99435. 9 interactions.
    MINTi MINT-2856232.
    STRINGi 9606.ENSP00000416341.

    Polymorphism databases

    DMDMi 2494289.

    Proteomic databases

    PaxDbi Q99435.
    PRIDEi Q99435.

    Protocols and materials databases

    DNASUi 4753.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000333837 ; ENSP00000327988 ; ENSG00000184613 . [Q99435-2 ]
    ENST00000395487 ; ENSP00000378866 ; ENSG00000184613 . [Q99435-4 ]
    ENST00000429094 ; ENSP00000390680 ; ENSG00000184613 . [Q99435-1 ]
    ENST00000437801 ; ENSP00000416341 ; ENSG00000184613 . [Q99435-3 ]
    ENST00000452445 ; ENSP00000394612 ; ENSG00000184613 . [Q99435-1 ]
    ENST00000549027 ; ENSP00000447927 ; ENSG00000184613 . [Q99435-4 ]
    GeneIDi 4753.
    KEGGi hsa:4753.
    UCSCi uc001rof.3. human. [Q99435-4 ]
    uc001rog.2. human. [Q99435-1 ]
    uc010skz.1. human. [Q99435-3 ]
    uc010sla.1. human. [Q99435-2 ]

    Organism-specific databases

    CTDi 4753.
    GeneCardsi GC12M044981.
    HGNCi HGNC:7751. NELL2.
    HPAi HPA035715.
    MIMi 602320. gene.
    neXtProti NX_Q99435.
    PharmGKBi PA31553.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG253557.
    HOGENOMi HOG000217920.
    HOVERGENi HBG004805.
    InParanoidi Q99435.
    OMAi DTICFNL.
    OrthoDBi EOG71VSRX.
    PhylomeDBi Q99435.
    TreeFami TF323325.

    Miscellaneous databases

    ChiTaRSi NELL2. human.
    GeneWikii NELL2.
    GenomeRNAii 4753.
    NextBioi 18320.
    PROi Q99435.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q99435.
    Bgeei Q99435.
    CleanExi HS_NELL2.
    HS_NRP2.
    Genevestigatori Q99435.

    Family and domain databases

    Gene3Di 2.60.120.200. 1 hit.
    InterProi IPR008985. ConA-like_lec_gl_sf.
    IPR013320. ConA-like_subgrp.
    IPR000742. EG-like_dom.
    IPR001881. EGF-like_Ca-bd_dom.
    IPR013032. EGF-like_CS.
    IPR000152. EGF-type_Asp/Asn_hydroxyl_site.
    IPR018097. EGF_Ca-bd_CS.
    IPR009030. Growth_fac_rcpt_N_dom.
    IPR001791. Laminin_G.
    IPR001007. VWF_C.
    [Graphical view ]
    Pfami PF07645. EGF_CA. 4 hits.
    PF02210. Laminin_G_2. 1 hit.
    PF00093. VWC. 2 hits.
    [Graphical view ]
    SMARTi SM00181. EGF. 2 hits.
    SM00179. EGF_CA. 3 hits.
    SM00282. LamG. 1 hit.
    SM00210. TSPN. 1 hit.
    SM00214. VWC. 3 hits.
    [Graphical view ]
    SUPFAMi SSF49899. SSF49899. 1 hit.
    SSF57184. SSF57184. 1 hit.
    PROSITEi PS00010. ASX_HYDROXYL. 3 hits.
    PS00022. EGF_1. 1 hit.
    PS01186. EGF_2. 4 hits.
    PS50026. EGF_3. 6 hits.
    PS01187. EGF_CA. 3 hits.
    PS01208. VWFC_1. 2 hits.
    PS50184. VWFC_2. 3 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Cloning and characterization of two novel human cDNAs (NELL1 and NELL2) encoding proteins with six EGF-like repeats."
      Watanabe T.K., Katagiri T., Suzuki M., Shimizu F., Fujiwara T., Kanemoto N., Nakamura Y., Hirai Y., Maekawa H., Takahashi E.
      Genomics 38:273-276(1996) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Tissue: Brain.
    2. "Biological functions of a novel human gene, hucep-12, which is specifically expressed in the central nervous system."
      Yoshimoto M., Yazaki M., Takayama K., Matsumoto K.
      Submitted (NOV-1996) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4).
      Tissue: Brain.
    3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2; 3 AND 4).
      Tissue: Amygdala, Brain and Hippocampus.
    4. "The finished DNA sequence of human chromosome 12."
      Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R.
      , Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Montgomery K.T., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Lovering R.C., Wheeler D.A., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clerc-Blankenburg K.P., Davis C., Delgado O., Dinh H.H., Draper H., Gonzalez-Garay M.L., Havlak P., Jackson L.R., Jacob L.S., Kelly S.H., Li L., Li Z., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Pasternak S., Perez L.M., Plopper F.J.H., Santibanez J., Shen H., Tabor P.E., Verduzco D., Waldron L., Wang Q., Williams G.A., Zhang J., Zhou J., Allen C.C., Amin A.G., Anyalebechi V., Bailey M., Barbaria J.A., Bimage K.E., Bryant N.P., Burch P.E., Burkett C.E., Burrell K.L., Calderon E., Cardenas V., Carter K., Casias K., Cavazos I., Cavazos S.R., Ceasar H., Chacko J., Chan S.N., Chavez D., Christopoulos C., Chu J., Cockrell R., Cox C.D., Dang M., Dathorne S.R., David R., Davis C.M., Davy-Carroll L., Deshazo D.R., Donlin J.E., D'Souza L., Eaves K.A., Egan A., Emery-Cohen A.J., Escotto M., Flagg N., Forbes L.D., Gabisi A.M., Garza M., Hamilton C., Henderson N., Hernandez O., Hines S., Hogues M.E., Huang M., Idlebird D.G., Johnson R., Jolivet A., Jones S., Kagan R., King L.M., Leal B., Lebow H., Lee S., LeVan J.M., Lewis L.C., London P., Lorensuhewa L.M., Loulseged H., Lovett D.A., Lucier A., Lucier R.L., Ma J., Madu R.C., Mapua P., Martindale A.D., Martinez E., Massey E., Mawhiney S., Meador M.G., Mendez S., Mercado C., Mercado I.C., Merritt C.E., Miner Z.L., Minja E., Mitchell T., Mohabbat F., Mohabbat K., Montgomery B., Moore N., Morris S., Munidasa M., Ngo R.N., Nguyen N.B., Nickerson E., Nwaokelemeh O.O., Nwokenkwo S., Obregon M., Oguh M., Oragunye N., Oviedo R.J., Parish B.J., Parker D.N., Parrish J., Parks K.L., Paul H.A., Payton B.A., Perez A., Perrin W., Pickens A., Primus E.L., Pu L.-L., Puazo M., Quiles M.M., Quiroz J.B., Rabata D., Reeves K., Ruiz S.J., Shao H., Sisson I., Sonaike T., Sorelle R.P., Sutton A.E., Svatek A.F., Svetz L.A., Tamerisa K.S., Taylor T.R., Teague B., Thomas N., Thorn R.D., Trejos Z.Y., Trevino B.K., Ukegbu O.N., Urban J.B., Vasquez L.I., Vera V.A., Villasana D.M., Wang L., Ward-Moore S., Warren J.T., Wei X., White F., Williamson A.L., Wleczyk R., Wooden H.S., Wooden S.H., Yen J., Yoon L., Yoon V., Zorrilla S.E., Nelson D., Kucherlapati R., Weinstock G., Gibbs R.A.
      Nature 440:346-351(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Duodenum.
    7. "Signal peptide prediction based on analysis of experimentally verified cleavage sites."
      Zhang Z., Henzel W.J.
      Protein Sci. 13:2819-2824(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: PROTEIN SEQUENCE OF 22-36 (ISOFORM 1).

    Entry informationi

    Entry nameiNELL2_HUMAN
    AccessioniPrimary (citable) accession number: Q99435
    Secondary accession number(s): B7Z2U7
    , B7Z5Q4, B7Z9J5, B7Z9U3, Q96JS2
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: November 1, 1997
    Last sequence update: May 1, 1997
    Last modified: October 1, 2014
    This is version 135 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Direct protein sequencing, Reference proteome

    Documents

    1. Human chromosome 12
      Human chromosome 12: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3