SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q99435

- NELL2_HUMAN

UniProt

Q99435 - NELL2_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Protein kinase C-binding protein NELL2

Gene
NELL2, NRP2
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5 - Experimental evidence at protein leveli

Functioni

GO - Molecular functioni

  1. calcium ion binding Source: InterPro
  2. protein binding Source: IntAct
Complete GO annotation...

Keywords - Ligandi

Calcium

Names & Taxonomyi

Protein namesi
Recommended name:
Protein kinase C-binding protein NELL2
Alternative name(s):
NEL-like protein 2
Nel-related protein 2
Gene namesi
Name:NELL2
Synonyms:NRP2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 12

Organism-specific databases

HGNCiHGNC:7751. NELL2.

Subcellular locationi

Secreted By similarity

GO - Cellular componenti

  1. extracellular region Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Secreted

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA31553.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 21211 PublicationAdd
BLAST
Chaini22 – 816795Protein kinase C-binding protein NELL2PRO_0000007666Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi53 – 531N-linked (GlcNAc...) Reviewed prediction
Glycosylationi225 – 2251N-linked (GlcNAc...) Reviewed prediction
Glycosylationi293 – 2931N-linked (GlcNAc...) Reviewed prediction
Glycosylationi298 – 2981N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi401 ↔ 413 By similarity
Disulfide bondi407 ↔ 422 By similarity
Disulfide bondi424 ↔ 438 By similarity
Disulfide bondi444 ↔ 457 By similarity
Disulfide bondi451 ↔ 466 By similarity
Disulfide bondi468 ↔ 480 By similarity
Disulfide bondi486 ↔ 499 By similarity
Disulfide bondi493 ↔ 508 By similarity
Disulfide bondi510 ↔ 521 By similarity
Glycosylationi517 – 5171N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi525 ↔ 535 By similarity
Disulfide bondi529 ↔ 541 By similarity
Disulfide bondi543 ↔ 552 By similarity
Disulfide bondi559 ↔ 572 By similarity
Disulfide bondi566 ↔ 581 By similarity
Disulfide bondi583 ↔ 600 By similarity
Disulfide bondi606 ↔ 619 By similarity
Disulfide bondi613 ↔ 628 By similarity
Glycosylationi615 – 6151N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi630 ↔ 636 By similarity
Glycosylationi635 – 6351N-linked (GlcNAc...) Reviewed prediction

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiQ99435.
PRIDEiQ99435.

Expressioni

Gene expression databases

ArrayExpressiQ99435.
BgeeiQ99435.
CleanExiHS_NELL2.
HS_NRP2.
GenevestigatoriQ99435.

Organism-specific databases

HPAiHPA035715.

Interactioni

Subunit structurei

Homotrimer. Binds to PKC beta-1 By similarity.

Binary interactionsi

WithEntry#Exp.IntActNotes
GFI1BQ5VTD92EBI-946274,EBI-946212

Protein-protein interaction databases

BioGridi110828. 5 interactions.
IntActiQ99435. 9 interactions.
MINTiMINT-2856232.
STRINGi9606.ENSP00000416341.

Structurei

3D structure databases

ProteinModelPortaliQ99435.
SMRiQ99435. Positions 84-211, 370-636.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini64 – 228165Laminin G-likeAdd
BLAST
Domaini272 – 33160VWFC 1Add
BLAST
Domaini397 – 43943EGF-like 1Add
BLAST
Domaini440 – 48142EGF-like 2; calcium-binding Reviewed predictionAdd
BLAST
Domaini482 – 52241EGF-like 3; calcium-binding Reviewed predictionAdd
BLAST
Domaini523 – 55331EGF-like 4Add
BLAST
Domaini555 – 60147EGF-like 5; calcium-binding Reviewed predictionAdd
BLAST
Domaini602 – 63736EGF-like 6; calcium-binding Reviewed predictionAdd
BLAST
Domaini638 – 69356VWFC 2Add
BLAST
Domaini698 – 75659VWFC 3Add
BLAST

Sequence similaritiesi

Contains 6 EGF-like domains.
Contains 3 VWFC domains.

Keywords - Domaini

EGF-like domain, Repeat, Signal

Phylogenomic databases

eggNOGiNOG253557.
HOGENOMiHOG000217920.
HOVERGENiHBG004805.
InParanoidiQ99435.
OMAiDTICFNL.
OrthoDBiEOG71VSRX.
PhylomeDBiQ99435.
TreeFamiTF323325.

Family and domain databases

Gene3Di2.60.120.200. 1 hit.
InterProiIPR008985. ConA-like_lec_gl_sf.
IPR013320. ConA-like_subgrp.
IPR000742. EG-like_dom.
IPR001881. EGF-like_Ca-bd_dom.
IPR013032. EGF-like_CS.
IPR000152. EGF-type_Asp/Asn_hydroxyl_site.
IPR018097. EGF_Ca-bd_CS.
IPR009030. Growth_fac_rcpt_N_dom.
IPR001791. Laminin_G.
IPR001007. VWF_C.
[Graphical view]
PfamiPF07645. EGF_CA. 4 hits.
PF02210. Laminin_G_2. 1 hit.
PF00093. VWC. 2 hits.
[Graphical view]
SMARTiSM00181. EGF. 2 hits.
SM00179. EGF_CA. 3 hits.
SM00282. LamG. 1 hit.
SM00210. TSPN. 1 hit.
SM00214. VWC. 3 hits.
[Graphical view]
SUPFAMiSSF49899. SSF49899. 1 hit.
SSF57184. SSF57184. 1 hit.
PROSITEiPS00010. ASX_HYDROXYL. 3 hits.
PS00022. EGF_1. 1 hit.
PS01186. EGF_2. 4 hits.
PS50026. EGF_3. 6 hits.
PS01187. EGF_CA. 3 hits.
PS01208. VWFC_1. 2 hits.
PS50184. VWFC_2. 3 hits.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q99435-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MESRVLLRTF CLIFGLGAVW GLGVDPSLQI DVLTELELGE STTGVRQVPG    50
LHNGTKAFLF QDTPRSIKAS TATAEQFFQK LRNKHEFTIL VTLKQTHLNS 100
GVILSIHHLD HRYLELESSG HRNEVRLHYR SGSHRPHTEV FPYILADDKW 150
HKLSLAISAS HLILHIDCNK IYERVVEKPS TDLPLGTTFW LGQRNNAHGY 200
FKGIMQDVQL LVMPQGFIAQ CPDLNRTCPT CNDFHGLVQK IMELQDILAK 250
TSAKLSRAEQ RMNRLDQCYC ERTCTMKGTT YREFESWIDG CKNCTCLNGT 300
IQCETLICPN PDCPLKSALA YVDGKCCKEC KSICQFQGRT YFEGERNTVY 350
SSSGVCVLYE CKDQTMKLVE SSGCPALDCP ESHQITLSHS CCKVCKGYDF 400
CSERHNCMEN SICRNLNDRA VCSCRDGFRA LREDNAYCED IDECAEGRHY 450
CRENTMCVNT PGSFMCICKT GYIRIDDYSC TEHDECITNQ HNCDENALCF 500
NTVGGHNCVC KPGYTGNGTT CKAFCKDGCR NGGACIAANV CACPQGFTGP 550
SCETDIDECS DGFVQCDSRA NCINLPGWYH CECRDGYHDN GMFSPSGESC 600
EDIDECGTGR HSCANDTICF NLDGGYDCRC PHGKNCTGDC IHDGKVKHNG 650
QIWVLENDRC SVCSCQNGFV MCRRMVCDCE NPTVDLFCCP ECDPRLSSQC 700
LHQNGETLYN SGDTWVQNCQ QCRCLQGEVD CWPLPCPDVE CEFSILPENE 750
CCPRCVTDPC QADTIRNDIT KTCLDEMNVV RFTGSSWIKH GTECTLCQCK 800
NGHICCSVDP QCLQEL 816
Length:816
Mass (Da):91,346
Last modified:May 1, 1997 - v1
Checksum:i89370B987DC7A324
GO
Isoform 2 (identifier: Q99435-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MSIRRLLILILKIGRRWTELIRTM

Note: No experimental confirmation available.

Show »
Length:839
Mass (Da):94,180
Checksum:iE7A4531EAB965749
GO
Isoform 3 (identifier: Q99435-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MGFPPLLKGQASATRSSLASCSWVVFFLSCLSRHAPEIEGGRRWTELIRTM

Note: No experimental confirmation available.

Show »
Length:866
Mass (Da):96,880
Checksum:i87C3D940EEC2BC68
GO
Isoform 4 (identifier: Q99435-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-18: MESRVLLRTFCLIFGLGA → METGLGAPLFKAWLLIS

Show »
Length:815
Mass (Da):91,167
Checksum:i907D0AC0BD4B85D1
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti5 – 51V → I.
Corresponds to variant rs2658973 [ dbSNP | Ensembl ].
VAR_048987
Natural varianti347 – 3471N → D.
Corresponds to variant rs17574839 [ dbSNP | Ensembl ].
VAR_048988
Natural varianti631 – 6311P → L.
Corresponds to variant rs1050710 [ dbSNP | Ensembl ].
VAR_048989

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 1818MESRV…FGLGA → METGLGAPLFKAWLLIS in isoform 4. VSP_043869Add
BLAST
Alternative sequencei1 – 11M → MSIRRLLILILKIGRRWTEL IRTM in isoform 2. VSP_043801
Alternative sequencei1 – 11M → MGFPPLLKGQASATRSSLAS CSWVVFFLSCLSRHAPEIEG GRRWTELIRTM in isoform 3. VSP_043802

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti353 – 3531S → P in BAH12990. 1 Publication
Sequence conflicti454 – 4541N → D in BAH12990. 1 Publication
Sequence conflicti489 – 4891N → D in BAH14331. 1 Publication
Sequence conflicti636 – 6361C → S in BAH14331. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
D83018 mRNA. Translation: BAA11681.1.
D89629 mRNA. Translation: BAB46925.1.
AK295125 mRNA. Translation: BAH11983.1.
AK299277 mRNA. Translation: BAH12990.1.
AK315960 mRNA. Translation: BAH14331.1.
AK316058 mRNA. Translation: BAH14429.1.
AC018923 Genomic DNA. No translation available.
AC025253 Genomic DNA. No translation available.
AC079033 Genomic DNA. No translation available.
AC079825 Genomic DNA. No translation available.
AC090012 Genomic DNA. No translation available.
CH471111 Genomic DNA. Translation: EAW57873.1.
BC020544 mRNA. Translation: AAH20544.1.
CCDSiCCDS44863.1. [Q99435-3]
CCDS44864.1. [Q99435-4]
CCDS53781.1. [Q99435-2]
CCDS8746.1. [Q99435-1]
RefSeqiNP_001138579.1. NM_001145107.1. [Q99435-3]
NP_001138580.1. NM_001145108.1. [Q99435-1]
NP_001138581.1. NM_001145109.1. [Q99435-4]
NP_001138582.1. NM_001145110.1. [Q99435-2]
NP_006150.1. NM_006159.2. [Q99435-1]
XP_005268962.1. XM_005268905.2. [Q99435-1]
UniGeneiHs.505326.

Genome annotation databases

EnsembliENST00000333837; ENSP00000327988; ENSG00000184613. [Q99435-2]
ENST00000395487; ENSP00000378866; ENSG00000184613. [Q99435-4]
ENST00000429094; ENSP00000390680; ENSG00000184613. [Q99435-1]
ENST00000437801; ENSP00000416341; ENSG00000184613. [Q99435-3]
ENST00000452445; ENSP00000394612; ENSG00000184613. [Q99435-1]
ENST00000549027; ENSP00000447927; ENSG00000184613. [Q99435-4]
GeneIDi4753.
KEGGihsa:4753.
UCSCiuc001rof.3. human. [Q99435-4]
uc001rog.2. human. [Q99435-1]
uc010skz.1. human. [Q99435-3]
uc010sla.1. human. [Q99435-2]

Polymorphism databases

DMDMi2494289.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
D83018 mRNA. Translation: BAA11681.1 .
D89629 mRNA. Translation: BAB46925.1 .
AK295125 mRNA. Translation: BAH11983.1 .
AK299277 mRNA. Translation: BAH12990.1 .
AK315960 mRNA. Translation: BAH14331.1 .
AK316058 mRNA. Translation: BAH14429.1 .
AC018923 Genomic DNA. No translation available.
AC025253 Genomic DNA. No translation available.
AC079033 Genomic DNA. No translation available.
AC079825 Genomic DNA. No translation available.
AC090012 Genomic DNA. No translation available.
CH471111 Genomic DNA. Translation: EAW57873.1 .
BC020544 mRNA. Translation: AAH20544.1 .
CCDSi CCDS44863.1. [Q99435-3 ]
CCDS44864.1. [Q99435-4 ]
CCDS53781.1. [Q99435-2 ]
CCDS8746.1. [Q99435-1 ]
RefSeqi NP_001138579.1. NM_001145107.1. [Q99435-3 ]
NP_001138580.1. NM_001145108.1. [Q99435-1 ]
NP_001138581.1. NM_001145109.1. [Q99435-4 ]
NP_001138582.1. NM_001145110.1. [Q99435-2 ]
NP_006150.1. NM_006159.2. [Q99435-1 ]
XP_005268962.1. XM_005268905.2. [Q99435-1 ]
UniGenei Hs.505326.

3D structure databases

ProteinModelPortali Q99435.
SMRi Q99435. Positions 84-211, 370-636.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 110828. 5 interactions.
IntActi Q99435. 9 interactions.
MINTi MINT-2856232.
STRINGi 9606.ENSP00000416341.

Polymorphism databases

DMDMi 2494289.

Proteomic databases

PaxDbi Q99435.
PRIDEi Q99435.

Protocols and materials databases

DNASUi 4753.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000333837 ; ENSP00000327988 ; ENSG00000184613 . [Q99435-2 ]
ENST00000395487 ; ENSP00000378866 ; ENSG00000184613 . [Q99435-4 ]
ENST00000429094 ; ENSP00000390680 ; ENSG00000184613 . [Q99435-1 ]
ENST00000437801 ; ENSP00000416341 ; ENSG00000184613 . [Q99435-3 ]
ENST00000452445 ; ENSP00000394612 ; ENSG00000184613 . [Q99435-1 ]
ENST00000549027 ; ENSP00000447927 ; ENSG00000184613 . [Q99435-4 ]
GeneIDi 4753.
KEGGi hsa:4753.
UCSCi uc001rof.3. human. [Q99435-4 ]
uc001rog.2. human. [Q99435-1 ]
uc010skz.1. human. [Q99435-3 ]
uc010sla.1. human. [Q99435-2 ]

Organism-specific databases

CTDi 4753.
GeneCardsi GC12M044981.
HGNCi HGNC:7751. NELL2.
HPAi HPA035715.
MIMi 602320. gene.
neXtProti NX_Q99435.
PharmGKBi PA31553.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG253557.
HOGENOMi HOG000217920.
HOVERGENi HBG004805.
InParanoidi Q99435.
OMAi DTICFNL.
OrthoDBi EOG71VSRX.
PhylomeDBi Q99435.
TreeFami TF323325.

Miscellaneous databases

ChiTaRSi NELL2. human.
GeneWikii NELL2.
GenomeRNAii 4753.
NextBioi 18320.
PROi Q99435.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q99435.
Bgeei Q99435.
CleanExi HS_NELL2.
HS_NRP2.
Genevestigatori Q99435.

Family and domain databases

Gene3Di 2.60.120.200. 1 hit.
InterProi IPR008985. ConA-like_lec_gl_sf.
IPR013320. ConA-like_subgrp.
IPR000742. EG-like_dom.
IPR001881. EGF-like_Ca-bd_dom.
IPR013032. EGF-like_CS.
IPR000152. EGF-type_Asp/Asn_hydroxyl_site.
IPR018097. EGF_Ca-bd_CS.
IPR009030. Growth_fac_rcpt_N_dom.
IPR001791. Laminin_G.
IPR001007. VWF_C.
[Graphical view ]
Pfami PF07645. EGF_CA. 4 hits.
PF02210. Laminin_G_2. 1 hit.
PF00093. VWC. 2 hits.
[Graphical view ]
SMARTi SM00181. EGF. 2 hits.
SM00179. EGF_CA. 3 hits.
SM00282. LamG. 1 hit.
SM00210. TSPN. 1 hit.
SM00214. VWC. 3 hits.
[Graphical view ]
SUPFAMi SSF49899. SSF49899. 1 hit.
SSF57184. SSF57184. 1 hit.
PROSITEi PS00010. ASX_HYDROXYL. 3 hits.
PS00022. EGF_1. 1 hit.
PS01186. EGF_2. 4 hits.
PS50026. EGF_3. 6 hits.
PS01187. EGF_CA. 3 hits.
PS01208. VWFC_1. 2 hits.
PS50184. VWFC_2. 3 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Cloning and characterization of two novel human cDNAs (NELL1 and NELL2) encoding proteins with six EGF-like repeats."
    Watanabe T.K., Katagiri T., Suzuki M., Shimizu F., Fujiwara T., Kanemoto N., Nakamura Y., Hirai Y., Maekawa H., Takahashi E.
    Genomics 38:273-276(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Brain.
  2. "Biological functions of a novel human gene, hucep-12, which is specifically expressed in the central nervous system."
    Yoshimoto M., Yazaki M., Takayama K., Matsumoto K.
    Submitted (NOV-1996) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4).
    Tissue: Brain.
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2; 3 AND 4).
    Tissue: Amygdala, Brain and Hippocampus.
  4. "The finished DNA sequence of human chromosome 12."
    Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R.
    , Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Montgomery K.T., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Lovering R.C., Wheeler D.A., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clerc-Blankenburg K.P., Davis C., Delgado O., Dinh H.H., Draper H., Gonzalez-Garay M.L., Havlak P., Jackson L.R., Jacob L.S., Kelly S.H., Li L., Li Z., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Pasternak S., Perez L.M., Plopper F.J.H., Santibanez J., Shen H., Tabor P.E., Verduzco D., Waldron L., Wang Q., Williams G.A., Zhang J., Zhou J., Allen C.C., Amin A.G., Anyalebechi V., Bailey M., Barbaria J.A., Bimage K.E., Bryant N.P., Burch P.E., Burkett C.E., Burrell K.L., Calderon E., Cardenas V., Carter K., Casias K., Cavazos I., Cavazos S.R., Ceasar H., Chacko J., Chan S.N., Chavez D., Christopoulos C., Chu J., Cockrell R., Cox C.D., Dang M., Dathorne S.R., David R., Davis C.M., Davy-Carroll L., Deshazo D.R., Donlin J.E., D'Souza L., Eaves K.A., Egan A., Emery-Cohen A.J., Escotto M., Flagg N., Forbes L.D., Gabisi A.M., Garza M., Hamilton C., Henderson N., Hernandez O., Hines S., Hogues M.E., Huang M., Idlebird D.G., Johnson R., Jolivet A., Jones S., Kagan R., King L.M., Leal B., Lebow H., Lee S., LeVan J.M., Lewis L.C., London P., Lorensuhewa L.M., Loulseged H., Lovett D.A., Lucier A., Lucier R.L., Ma J., Madu R.C., Mapua P., Martindale A.D., Martinez E., Massey E., Mawhiney S., Meador M.G., Mendez S., Mercado C., Mercado I.C., Merritt C.E., Miner Z.L., Minja E., Mitchell T., Mohabbat F., Mohabbat K., Montgomery B., Moore N., Morris S., Munidasa M., Ngo R.N., Nguyen N.B., Nickerson E., Nwaokelemeh O.O., Nwokenkwo S., Obregon M., Oguh M., Oragunye N., Oviedo R.J., Parish B.J., Parker D.N., Parrish J., Parks K.L., Paul H.A., Payton B.A., Perez A., Perrin W., Pickens A., Primus E.L., Pu L.-L., Puazo M., Quiles M.M., Quiroz J.B., Rabata D., Reeves K., Ruiz S.J., Shao H., Sisson I., Sonaike T., Sorelle R.P., Sutton A.E., Svatek A.F., Svetz L.A., Tamerisa K.S., Taylor T.R., Teague B., Thomas N., Thorn R.D., Trejos Z.Y., Trevino B.K., Ukegbu O.N., Urban J.B., Vasquez L.I., Vera V.A., Villasana D.M., Wang L., Ward-Moore S., Warren J.T., Wei X., White F., Williamson A.L., Wleczyk R., Wooden H.S., Wooden S.H., Yen J., Yoon L., Yoon V., Zorrilla S.E., Nelson D., Kucherlapati R., Weinstock G., Gibbs R.A.
    Nature 440:346-351(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Duodenum.
  7. "Signal peptide prediction based on analysis of experimentally verified cleavage sites."
    Zhang Z., Henzel W.J.
    Protein Sci. 13:2819-2824(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: PROTEIN SEQUENCE OF 22-36 (ISOFORM 1).

Entry informationi

Entry nameiNELL2_HUMAN
AccessioniPrimary (citable) accession number: Q99435
Secondary accession number(s): B7Z2U7
, B7Z5Q4, B7Z9J5, B7Z9U3, Q96JS2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: May 1, 1997
Last modified: July 9, 2014
This is version 134 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi