Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q99435

- NELL2_HUMAN

UniProt

Q99435 - NELL2_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Protein kinase C-binding protein NELL2

Gene

NELL2

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at protein leveli

Functioni

GO - Molecular functioni

  1. calcium ion binding Source: InterPro
Complete GO annotation...

Keywords - Ligandi

Calcium

Names & Taxonomyi

Protein namesi
Recommended name:
Protein kinase C-binding protein NELL2
Alternative name(s):
NEL-like protein 2
Nel-related protein 2
Gene namesi
Name:NELL2
Synonyms:NRP2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 12

Organism-specific databases

HGNCiHGNC:7751. NELL2.

Subcellular locationi

Secreted By similarity

GO - Cellular componenti

  1. extracellular region Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Secreted

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA31553.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2121Add
BLAST
Chaini22 – 816795Protein kinase C-binding protein NELL2PRO_0000007666Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi53 – 531N-linked (GlcNAc...)Sequence Analysis
Glycosylationi225 – 2251N-linked (GlcNAc...)Sequence Analysis
Glycosylationi293 – 2931N-linked (GlcNAc...)Sequence Analysis
Glycosylationi298 – 2981N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi401 ↔ 413PROSITE-ProRule annotation
Disulfide bondi407 ↔ 422PROSITE-ProRule annotation
Disulfide bondi424 ↔ 438PROSITE-ProRule annotation
Disulfide bondi444 ↔ 457PROSITE-ProRule annotation
Disulfide bondi451 ↔ 466PROSITE-ProRule annotation
Disulfide bondi468 ↔ 480PROSITE-ProRule annotation
Disulfide bondi486 ↔ 499PROSITE-ProRule annotation
Disulfide bondi493 ↔ 508PROSITE-ProRule annotation
Disulfide bondi510 ↔ 521PROSITE-ProRule annotation
Glycosylationi517 – 5171N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi525 ↔ 535PROSITE-ProRule annotation
Disulfide bondi529 ↔ 541PROSITE-ProRule annotation
Disulfide bondi543 ↔ 552PROSITE-ProRule annotation
Disulfide bondi559 ↔ 572PROSITE-ProRule annotation
Disulfide bondi566 ↔ 581PROSITE-ProRule annotation
Disulfide bondi583 ↔ 600PROSITE-ProRule annotation
Disulfide bondi606 ↔ 619PROSITE-ProRule annotation
Disulfide bondi613 ↔ 628PROSITE-ProRule annotation
Glycosylationi615 – 6151N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi630 ↔ 636PROSITE-ProRule annotation
Glycosylationi635 – 6351N-linked (GlcNAc...)Sequence Analysis

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiQ99435.
PRIDEiQ99435.

Expressioni

Gene expression databases

BgeeiQ99435.
CleanExiHS_NELL2.
HS_NRP2.
ExpressionAtlasiQ99435. baseline and differential.
GenevestigatoriQ99435.

Organism-specific databases

HPAiHPA035715.

Interactioni

Subunit structurei

Homotrimer. Binds to PKC beta-1 By similarity.By similarity

Binary interactionsi

WithEntry#Exp.IntActNotes
GFI1BQ5VTD92EBI-946274,EBI-946212

Protein-protein interaction databases

BioGridi110828. 7 interactions.
IntActiQ99435. 9 interactions.
MINTiMINT-2856232.
STRINGi9606.ENSP00000416341.

Structurei

3D structure databases

ProteinModelPortaliQ99435.
SMRiQ99435. Positions 370-702.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini64 – 228165Laminin G-likeAdd
BLAST
Domaini272 – 33160VWFC 1PROSITE-ProRule annotationAdd
BLAST
Domaini397 – 43943EGF-like 1PROSITE-ProRule annotationAdd
BLAST
Domaini440 – 48142EGF-like 2; calcium-bindingPROSITE-ProRule annotationAdd
BLAST
Domaini482 – 52241EGF-like 3; calcium-bindingPROSITE-ProRule annotationAdd
BLAST
Domaini523 – 55331EGF-like 4PROSITE-ProRule annotationAdd
BLAST
Domaini555 – 60147EGF-like 5; calcium-bindingPROSITE-ProRule annotationAdd
BLAST
Domaini602 – 63736EGF-like 6; calcium-bindingPROSITE-ProRule annotationAdd
BLAST
Domaini638 – 69356VWFC 2PROSITE-ProRule annotationAdd
BLAST
Domaini698 – 75659VWFC 3PROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Contains 6 EGF-like domains.PROSITE-ProRule annotation
Contains 1 laminin G-like domain.Curated
Contains 3 VWFC domains.PROSITE-ProRule annotation

Keywords - Domaini

EGF-like domain, Repeat, Signal

Phylogenomic databases

eggNOGiNOG253557.
GeneTreeiENSGT00750000117321.
HOGENOMiHOG000217920.
HOVERGENiHBG004805.
InParanoidiQ99435.
OMAiDTICFNL.
OrthoDBiEOG71VSRX.
PhylomeDBiQ99435.
TreeFamiTF323325.

Family and domain databases

Gene3Di2.60.120.200. 1 hit.
InterProiIPR013320. ConA-like_dom.
IPR000742. EG-like_dom.
IPR001881. EGF-like_Ca-bd_dom.
IPR013032. EGF-like_CS.
IPR000152. EGF-type_Asp/Asn_hydroxyl_site.
IPR018097. EGF_Ca-bd_CS.
IPR009030. Growth_fac_rcpt_N_dom.
IPR001791. Laminin_G.
IPR001007. VWF_C.
[Graphical view]
PfamiPF07645. EGF_CA. 4 hits.
PF02210. Laminin_G_2. 1 hit.
PF00093. VWC. 2 hits.
[Graphical view]
SMARTiSM00181. EGF. 2 hits.
SM00179. EGF_CA. 3 hits.
SM00282. LamG. 1 hit.
SM00210. TSPN. 1 hit.
SM00214. VWC. 3 hits.
[Graphical view]
SUPFAMiSSF49899. SSF49899. 1 hit.
SSF57184. SSF57184. 1 hit.
PROSITEiPS00010. ASX_HYDROXYL. 3 hits.
PS00022. EGF_1. 1 hit.
PS01186. EGF_2. 4 hits.
PS50026. EGF_3. 6 hits.
PS01187. EGF_CA. 3 hits.
PS01208. VWFC_1. 2 hits.
PS50184. VWFC_2. 3 hits.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q99435-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MESRVLLRTF CLIFGLGAVW GLGVDPSLQI DVLTELELGE STTGVRQVPG
60 70 80 90 100
LHNGTKAFLF QDTPRSIKAS TATAEQFFQK LRNKHEFTIL VTLKQTHLNS
110 120 130 140 150
GVILSIHHLD HRYLELESSG HRNEVRLHYR SGSHRPHTEV FPYILADDKW
160 170 180 190 200
HKLSLAISAS HLILHIDCNK IYERVVEKPS TDLPLGTTFW LGQRNNAHGY
210 220 230 240 250
FKGIMQDVQL LVMPQGFIAQ CPDLNRTCPT CNDFHGLVQK IMELQDILAK
260 270 280 290 300
TSAKLSRAEQ RMNRLDQCYC ERTCTMKGTT YREFESWIDG CKNCTCLNGT
310 320 330 340 350
IQCETLICPN PDCPLKSALA YVDGKCCKEC KSICQFQGRT YFEGERNTVY
360 370 380 390 400
SSSGVCVLYE CKDQTMKLVE SSGCPALDCP ESHQITLSHS CCKVCKGYDF
410 420 430 440 450
CSERHNCMEN SICRNLNDRA VCSCRDGFRA LREDNAYCED IDECAEGRHY
460 470 480 490 500
CRENTMCVNT PGSFMCICKT GYIRIDDYSC TEHDECITNQ HNCDENALCF
510 520 530 540 550
NTVGGHNCVC KPGYTGNGTT CKAFCKDGCR NGGACIAANV CACPQGFTGP
560 570 580 590 600
SCETDIDECS DGFVQCDSRA NCINLPGWYH CECRDGYHDN GMFSPSGESC
610 620 630 640 650
EDIDECGTGR HSCANDTICF NLDGGYDCRC PHGKNCTGDC IHDGKVKHNG
660 670 680 690 700
QIWVLENDRC SVCSCQNGFV MCRRMVCDCE NPTVDLFCCP ECDPRLSSQC
710 720 730 740 750
LHQNGETLYN SGDTWVQNCQ QCRCLQGEVD CWPLPCPDVE CEFSILPENE
760 770 780 790 800
CCPRCVTDPC QADTIRNDIT KTCLDEMNVV RFTGSSWIKH GTECTLCQCK
810
NGHICCSVDP QCLQEL
Length:816
Mass (Da):91,346
Last modified:May 1, 1997 - v1
Checksum:i89370B987DC7A324
GO
Isoform 2 (identifier: Q99435-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MSIRRLLILILKIGRRWTELIRTM

Note: No experimental confirmation available.

Show »
Length:839
Mass (Da):94,180
Checksum:iE7A4531EAB965749
GO
Isoform 3 (identifier: Q99435-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MGFPPLLKGQASATRSSLASCSWVVFFLSCLSRHAPEIEGGRRWTELIRTM

Note: No experimental confirmation available.

Show »
Length:866
Mass (Da):96,880
Checksum:i87C3D940EEC2BC68
GO
Isoform 4 (identifier: Q99435-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-18: MESRVLLRTFCLIFGLGA → METGLGAPLFKAWLLIS

Show »
Length:815
Mass (Da):91,167
Checksum:i907D0AC0BD4B85D1
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti353 – 3531S → P in BAH12990. (PubMed:14702039)Curated
Sequence conflicti454 – 4541N → D in BAH12990. (PubMed:14702039)Curated
Sequence conflicti489 – 4891N → D in BAH14331. (PubMed:14702039)Curated
Sequence conflicti636 – 6361C → S in BAH14331. (PubMed:14702039)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti5 – 51V → I.
Corresponds to variant rs2658973 [ dbSNP | Ensembl ].
VAR_048987
Natural varianti347 – 3471N → D.
Corresponds to variant rs17574839 [ dbSNP | Ensembl ].
VAR_048988
Natural varianti631 – 6311P → L.
Corresponds to variant rs1050710 [ dbSNP | Ensembl ].
VAR_048989

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 1818MESRV…FGLGA → METGLGAPLFKAWLLIS in isoform 4. 2 PublicationsVSP_043869Add
BLAST
Alternative sequencei1 – 11M → MSIRRLLILILKIGRRWTEL IRTM in isoform 2. 1 PublicationVSP_043801
Alternative sequencei1 – 11M → MGFPPLLKGQASATRSSLAS CSWVVFFLSCLSRHAPEIEG GRRWTELIRTM in isoform 3. 1 PublicationVSP_043802

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
D83018 mRNA. Translation: BAA11681.1.
D89629 mRNA. Translation: BAB46925.1.
AK295125 mRNA. Translation: BAH11983.1.
AK299277 mRNA. Translation: BAH12990.1.
AK315960 mRNA. Translation: BAH14331.1.
AK316058 mRNA. Translation: BAH14429.1.
AC018923 Genomic DNA. No translation available.
AC025253 Genomic DNA. No translation available.
AC079033 Genomic DNA. No translation available.
AC079825 Genomic DNA. No translation available.
AC090012 Genomic DNA. No translation available.
CH471111 Genomic DNA. Translation: EAW57873.1.
BC020544 mRNA. Translation: AAH20544.1.
CCDSiCCDS44863.1. [Q99435-3]
CCDS44864.1. [Q99435-4]
CCDS53781.1. [Q99435-2]
CCDS8746.1. [Q99435-1]
RefSeqiNP_001138579.1. NM_001145107.1. [Q99435-3]
NP_001138580.1. NM_001145108.1. [Q99435-1]
NP_001138581.1. NM_001145109.1. [Q99435-4]
NP_001138582.1. NM_001145110.1. [Q99435-2]
NP_006150.1. NM_006159.2. [Q99435-1]
XP_005268962.1. XM_005268905.2. [Q99435-1]
UniGeneiHs.505326.

Genome annotation databases

EnsembliENST00000333837; ENSP00000327988; ENSG00000184613. [Q99435-2]
ENST00000395487; ENSP00000378866; ENSG00000184613. [Q99435-4]
ENST00000429094; ENSP00000390680; ENSG00000184613. [Q99435-1]
ENST00000437801; ENSP00000416341; ENSG00000184613. [Q99435-3]
ENST00000452445; ENSP00000394612; ENSG00000184613. [Q99435-1]
ENST00000549027; ENSP00000447927; ENSG00000184613. [Q99435-4]
GeneIDi4753.
KEGGihsa:4753.
UCSCiuc001rof.3. human. [Q99435-4]
uc001rog.2. human. [Q99435-1]
uc010skz.1. human. [Q99435-3]
uc010sla.1. human. [Q99435-2]

Polymorphism databases

DMDMi2494289.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
D83018 mRNA. Translation: BAA11681.1 .
D89629 mRNA. Translation: BAB46925.1 .
AK295125 mRNA. Translation: BAH11983.1 .
AK299277 mRNA. Translation: BAH12990.1 .
AK315960 mRNA. Translation: BAH14331.1 .
AK316058 mRNA. Translation: BAH14429.1 .
AC018923 Genomic DNA. No translation available.
AC025253 Genomic DNA. No translation available.
AC079033 Genomic DNA. No translation available.
AC079825 Genomic DNA. No translation available.
AC090012 Genomic DNA. No translation available.
CH471111 Genomic DNA. Translation: EAW57873.1 .
BC020544 mRNA. Translation: AAH20544.1 .
CCDSi CCDS44863.1. [Q99435-3 ]
CCDS44864.1. [Q99435-4 ]
CCDS53781.1. [Q99435-2 ]
CCDS8746.1. [Q99435-1 ]
RefSeqi NP_001138579.1. NM_001145107.1. [Q99435-3 ]
NP_001138580.1. NM_001145108.1. [Q99435-1 ]
NP_001138581.1. NM_001145109.1. [Q99435-4 ]
NP_001138582.1. NM_001145110.1. [Q99435-2 ]
NP_006150.1. NM_006159.2. [Q99435-1 ]
XP_005268962.1. XM_005268905.2. [Q99435-1 ]
UniGenei Hs.505326.

3D structure databases

ProteinModelPortali Q99435.
SMRi Q99435. Positions 370-702.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 110828. 7 interactions.
IntActi Q99435. 9 interactions.
MINTi MINT-2856232.
STRINGi 9606.ENSP00000416341.

Polymorphism databases

DMDMi 2494289.

Proteomic databases

PaxDbi Q99435.
PRIDEi Q99435.

Protocols and materials databases

DNASUi 4753.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000333837 ; ENSP00000327988 ; ENSG00000184613 . [Q99435-2 ]
ENST00000395487 ; ENSP00000378866 ; ENSG00000184613 . [Q99435-4 ]
ENST00000429094 ; ENSP00000390680 ; ENSG00000184613 . [Q99435-1 ]
ENST00000437801 ; ENSP00000416341 ; ENSG00000184613 . [Q99435-3 ]
ENST00000452445 ; ENSP00000394612 ; ENSG00000184613 . [Q99435-1 ]
ENST00000549027 ; ENSP00000447927 ; ENSG00000184613 . [Q99435-4 ]
GeneIDi 4753.
KEGGi hsa:4753.
UCSCi uc001rof.3. human. [Q99435-4 ]
uc001rog.2. human. [Q99435-1 ]
uc010skz.1. human. [Q99435-3 ]
uc010sla.1. human. [Q99435-2 ]

Organism-specific databases

CTDi 4753.
GeneCardsi GC12M044981.
HGNCi HGNC:7751. NELL2.
HPAi HPA035715.
MIMi 602320. gene.
neXtProti NX_Q99435.
PharmGKBi PA31553.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG253557.
GeneTreei ENSGT00750000117321.
HOGENOMi HOG000217920.
HOVERGENi HBG004805.
InParanoidi Q99435.
OMAi DTICFNL.
OrthoDBi EOG71VSRX.
PhylomeDBi Q99435.
TreeFami TF323325.

Miscellaneous databases

ChiTaRSi NELL2. human.
GeneWikii NELL2.
GenomeRNAii 4753.
NextBioi 18320.
PROi Q99435.
SOURCEi Search...

Gene expression databases

Bgeei Q99435.
CleanExi HS_NELL2.
HS_NRP2.
ExpressionAtlasi Q99435. baseline and differential.
Genevestigatori Q99435.

Family and domain databases

Gene3Di 2.60.120.200. 1 hit.
InterProi IPR013320. ConA-like_dom.
IPR000742. EG-like_dom.
IPR001881. EGF-like_Ca-bd_dom.
IPR013032. EGF-like_CS.
IPR000152. EGF-type_Asp/Asn_hydroxyl_site.
IPR018097. EGF_Ca-bd_CS.
IPR009030. Growth_fac_rcpt_N_dom.
IPR001791. Laminin_G.
IPR001007. VWF_C.
[Graphical view ]
Pfami PF07645. EGF_CA. 4 hits.
PF02210. Laminin_G_2. 1 hit.
PF00093. VWC. 2 hits.
[Graphical view ]
SMARTi SM00181. EGF. 2 hits.
SM00179. EGF_CA. 3 hits.
SM00282. LamG. 1 hit.
SM00210. TSPN. 1 hit.
SM00214. VWC. 3 hits.
[Graphical view ]
SUPFAMi SSF49899. SSF49899. 1 hit.
SSF57184. SSF57184. 1 hit.
PROSITEi PS00010. ASX_HYDROXYL. 3 hits.
PS00022. EGF_1. 1 hit.
PS01186. EGF_2. 4 hits.
PS50026. EGF_3. 6 hits.
PS01187. EGF_CA. 3 hits.
PS01208. VWFC_1. 2 hits.
PS50184. VWFC_2. 3 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Cloning and characterization of two novel human cDNAs (NELL1 and NELL2) encoding proteins with six EGF-like repeats."
    Watanabe T.K., Katagiri T., Suzuki M., Shimizu F., Fujiwara T., Kanemoto N., Nakamura Y., Hirai Y., Maekawa H., Takahashi E.
    Genomics 38:273-276(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Brain.
  2. "Biological functions of a novel human gene, hucep-12, which is specifically expressed in the central nervous system."
    Yoshimoto M., Yazaki M., Takayama K., Matsumoto K.
    Submitted (NOV-1996) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4).
    Tissue: Brain.
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2; 3 AND 4).
    Tissue: Amygdala, Brain and Hippocampus.
  4. "The finished DNA sequence of human chromosome 12."
    Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R.
    , Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Montgomery K.T., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Lovering R.C., Wheeler D.A., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clerc-Blankenburg K.P., Davis C., Delgado O., Dinh H.H., Draper H., Gonzalez-Garay M.L., Havlak P., Jackson L.R., Jacob L.S., Kelly S.H., Li L., Li Z., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Pasternak S., Perez L.M., Plopper F.J.H., Santibanez J., Shen H., Tabor P.E., Verduzco D., Waldron L., Wang Q., Williams G.A., Zhang J., Zhou J., Allen C.C., Amin A.G., Anyalebechi V., Bailey M., Barbaria J.A., Bimage K.E., Bryant N.P., Burch P.E., Burkett C.E., Burrell K.L., Calderon E., Cardenas V., Carter K., Casias K., Cavazos I., Cavazos S.R., Ceasar H., Chacko J., Chan S.N., Chavez D., Christopoulos C., Chu J., Cockrell R., Cox C.D., Dang M., Dathorne S.R., David R., Davis C.M., Davy-Carroll L., Deshazo D.R., Donlin J.E., D'Souza L., Eaves K.A., Egan A., Emery-Cohen A.J., Escotto M., Flagg N., Forbes L.D., Gabisi A.M., Garza M., Hamilton C., Henderson N., Hernandez O., Hines S., Hogues M.E., Huang M., Idlebird D.G., Johnson R., Jolivet A., Jones S., Kagan R., King L.M., Leal B., Lebow H., Lee S., LeVan J.M., Lewis L.C., London P., Lorensuhewa L.M., Loulseged H., Lovett D.A., Lucier A., Lucier R.L., Ma J., Madu R.C., Mapua P., Martindale A.D., Martinez E., Massey E., Mawhiney S., Meador M.G., Mendez S., Mercado C., Mercado I.C., Merritt C.E., Miner Z.L., Minja E., Mitchell T., Mohabbat F., Mohabbat K., Montgomery B., Moore N., Morris S., Munidasa M., Ngo R.N., Nguyen N.B., Nickerson E., Nwaokelemeh O.O., Nwokenkwo S., Obregon M., Oguh M., Oragunye N., Oviedo R.J., Parish B.J., Parker D.N., Parrish J., Parks K.L., Paul H.A., Payton B.A., Perez A., Perrin W., Pickens A., Primus E.L., Pu L.-L., Puazo M., Quiles M.M., Quiroz J.B., Rabata D., Reeves K., Ruiz S.J., Shao H., Sisson I., Sonaike T., Sorelle R.P., Sutton A.E., Svatek A.F., Svetz L.A., Tamerisa K.S., Taylor T.R., Teague B., Thomas N., Thorn R.D., Trejos Z.Y., Trevino B.K., Ukegbu O.N., Urban J.B., Vasquez L.I., Vera V.A., Villasana D.M., Wang L., Ward-Moore S., Warren J.T., Wei X., White F., Williamson A.L., Wleczyk R., Wooden H.S., Wooden S.H., Yen J., Yoon L., Yoon V., Zorrilla S.E., Nelson D., Kucherlapati R., Weinstock G., Gibbs R.A.
    Nature 440:346-351(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Duodenum.
  7. "Signal peptide prediction based on analysis of experimentally verified cleavage sites."
    Zhang Z., Henzel W.J.
    Protein Sci. 13:2819-2824(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: PROTEIN SEQUENCE OF 22-36 (ISOFORM 1).

Entry informationi

Entry nameiNELL2_HUMAN
AccessioniPrimary (citable) accession number: Q99435
Secondary accession number(s): B7Z2U7
, B7Z5Q4, B7Z9J5, B7Z9U3, Q96JS2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: May 1, 1997
Last modified: October 29, 2014
This is version 136 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3