Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Voltage-dependent L-type calcium channel subunit alpha-1D

Gene

Cacna1d

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Voltage-sensitive calcium channels (VSCC) mediate the entry of calcium ions into excitable cells and are also involved in a variety of calcium-dependent processes, including muscle contraction, hormone or neurotransmitter release, gene expression, cell motility, cell division and cell death. The isoform alpha-1D gives rise to L-type calcium currents. Long-lasting (L-type) calcium channels belong to the 'high-voltage activated' (HVA) group. They are blocked by dihydropyridines (DHP), phenylalkylamines, benzothiazepines, and by omega-agatoxin-IIIA (omega-Aga-IIIA). They are however insensitive to omega-conotoxin-GVIA (omega-CTx-GVIA) and omega-agatoxin-IVA (omega-Aga-IVA).1 Publication

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sitei364 – 3641Calcium ion selectivity and permeabilityBy similarity
Sitei725 – 7251Calcium ion selectivity and permeabilityBy similarity
Sitei1121 – 11211Calcium ion selectivity and permeabilityBy similarity
Sitei1426 – 14261Calcium ion selectivity and permeabilityBy similarity

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Calcium bindingi1513 – 152412By similarityAdd
BLAST

GO - Molecular functioni

  • alpha-actinin binding Source: MGI
  • ankyrin binding Source: BHF-UCL
  • high voltage-gated calcium channel activity Source: MGI
  • metal ion binding Source: UniProtKB-KW
  • voltage-gated calcium channel activity Source: MGI
  • voltage-gated calcium channel activity involved SA node cell action potential Source: MGI

GO - Biological processi

  • adenylate cyclase-modulating G-protein coupled receptor signaling pathway Source: MGI
  • calcium ion import Source: MGI
  • calcium ion transmembrane transport Source: MGI
  • calcium ion transport Source: MGI
  • cardiac conduction Source: UniProtKB
  • membrane depolarization during SA node cell action potential Source: MGI
  • positive regulation of calcium ion transport Source: MGI
  • regulation of atrial cardiac muscle cell membrane repolarization Source: BHF-UCL
  • regulation of heart rate by cardiac conduction Source: MGI
  • regulation of potassium ion transmembrane transport Source: BHF-UCL
  • regulation of potassium ion transmembrane transporter activity Source: BHF-UCL
  • sensory perception of sound Source: MGI
Complete GO annotation...

Keywords - Molecular functioni

Calcium channel, Ion channel, Voltage-gated channel

Keywords - Biological processi

Calcium transport, Ion transport, Transport

Keywords - Ligandi

Calcium, Metal-binding

Enzyme and pathway databases

ReactomeiR-MMU-419037. NCAM1 interactions.
R-MMU-422356. Regulation of insulin secretion.
R-MMU-5576892. Phase 0 - rapid depolarisation.
R-MMU-5576893. Phase 2 - plateau phase.
R-MMU-5576894. Phase 1 - inactivation of fast Na+ channels.

Names & Taxonomyi

Protein namesi
Recommended name:
Voltage-dependent L-type calcium channel subunit alpha-1D
Alternative name(s):
Calcium channel, L type, alpha-1 polypeptide isoform 2
Voltage-gated calcium channel subunit alpha Cav1.3
Gene namesi
Name:Cacna1d
Synonyms:Cach3, Cacn4, Cacnl1a2, Cchl1a2
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 14

Organism-specific databases

MGIiMGI:88293. Cacna1d.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 126126CytoplasmicSequence analysisAdd
BLAST
Transmembranei127 – 14519Helical; Name=S1 of repeat ISequence analysisAdd
BLAST
Topological domaini146 – 16318ExtracellularSequence analysisAdd
BLAST
Transmembranei164 – 18320Helical; Name=S2 of repeat ISequence analysisAdd
BLAST
Topological domaini184 – 19512CytoplasmicSequence analysisAdd
BLAST
Transmembranei196 – 21419Helical; Name=S3 of repeat ISequence analysisAdd
BLAST
Topological domaini215 – 23521ExtracellularSequence analysisAdd
BLAST
Transmembranei236 – 25419Helical; Name=S4 of repeat ISequence analysisAdd
BLAST
Topological domaini255 – 27319CytoplasmicSequence analysisAdd
BLAST
Transmembranei274 – 29320Helical; Name=S5 of repeat ISequence analysisAdd
BLAST
Topological domaini294 – 38188ExtracellularSequence analysisAdd
BLAST
Transmembranei382 – 40625Helical; Name=S6 of repeat ISequence analysisAdd
BLAST
Topological domaini407 – 543137CytoplasmicSequence analysisAdd
BLAST
Transmembranei544 – 56320Helical; Name=S1 of repeat IISequence analysisAdd
BLAST
Topological domaini564 – 57815ExtracellularSequence analysisAdd
BLAST
Transmembranei579 – 59719Helical; Name=S2 of repeat IISequence analysisAdd
BLAST
Topological domaini598 – 6058CytoplasmicSequence analysis
Transmembranei606 – 62419Helical; Name=S3 of repeat IISequence analysisAdd
BLAST
Topological domaini625 – 63410ExtracellularSequence analysis
Transmembranei635 – 65319Helical; Name=S4 of repeat IISequence analysisAdd
BLAST
Topological domaini654 – 67219CytoplasmicSequence analysisAdd
BLAST
Transmembranei673 – 69321Helical; Name=S5 of repeat IISequence analysisAdd
BLAST
Topological domaini694 – 74754ExtracellularSequence analysisAdd
BLAST
Transmembranei748 – 77225Helical; Name=S6 of repeat IISequence analysisAdd
BLAST
Topological domaini773 – 906134CytoplasmicSequence analysisAdd
BLAST
Transmembranei907 – 92519Helical; Name=S1 of repeat IIISequence analysisAdd
BLAST
Topological domaini926 – 94116ExtracellularSequence analysisAdd
BLAST
Transmembranei942 – 96120Helical; Name=S2 of repeat IIISequence analysisAdd
BLAST
Topological domaini962 – 97312CytoplasmicSequence analysisAdd
BLAST
Transmembranei974 – 99219Helical; Name=S3 of repeat IIISequence analysisAdd
BLAST
Topological domaini993 – 9986ExtracellularSequence analysis
Transmembranei999 – 101820Helical; Name=S4 of repeat IIISequence analysisAdd
BLAST
Topological domaini1019 – 103719CytoplasmicSequence analysisAdd
BLAST
Transmembranei1038 – 105720Helical; Name=S5 of repeat IIISequence analysisAdd
BLAST
Topological domaini1058 – 114790ExtracellularSequence analysisAdd
BLAST
Transmembranei1148 – 116821Helical; Name=S6 of repeat IIISequence analysisAdd
BLAST
Topological domaini1169 – 122557CytoplasmicSequence analysisAdd
BLAST
Transmembranei1226 – 124419Helical; Name=S1 of repeat IVSequence analysisAdd
BLAST
Topological domaini1245 – 125915ExtracellularSequence analysisAdd
BLAST
Transmembranei1260 – 127920Helical; Name=S2 of repeat IVSequence analysisAdd
BLAST
Topological domaini1280 – 12867CytoplasmicSequence analysis
Transmembranei1287 – 130822Helical; Name=S3 of repeat IVSequence analysisAdd
BLAST
Topological domaini1309 – 133325ExtracellularSequence analysisAdd
BLAST
Transmembranei1334 – 135320Helical; Name=S4 of repeat IVSequence analysisAdd
BLAST
Topological domaini1354 – 137219CytoplasmicSequence analysisAdd
BLAST
Transmembranei1373 – 139220Helical; Name=S5 of repeat IVSequence analysisAdd
BLAST
Topological domaini1393 – 145967ExtracellularSequence analysisAdd
BLAST
Transmembranei1460 – 148425Helical; Name=S6 of repeat IVSequence analysisAdd
BLAST
Topological domaini1485 – 2179695CytoplasmicSequence analysisAdd
BLAST

GO - Cellular componenti

  • integral component of plasma membrane Source: MGI
  • L-type voltage-gated calcium channel complex Source: MGI
  • plasma membrane Source: BHF-UCL
  • voltage-gated calcium channel complex Source: MGI
  • Z disc Source: BHF-UCL
Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Disruption phenotypei

deafness, bradycardia and diabetic traits.3 Publications

Chemistry

GuidetoPHARMACOLOGYi530.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 21792179Voltage-dependent L-type calcium channel subunit alpha-1DPRO_0000053935Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei1495 – 14951Phosphoserine; by PKABy similarity

Keywords - PTMi

Disulfide bond, Phosphoprotein

Proteomic databases

MaxQBiQ99246.
PaxDbiQ99246.
PRIDEiQ99246.

PTM databases

iPTMnetiQ99246.
PhosphoSiteiQ99246.

Expressioni

Tissue specificityi

Expressed in the inner hair cells (IHC) of the cochlea.1 Publication

Developmental stagei

Isoform 2 and isoform 3 are expressed in heart at 12.5 dpc (at protein level). Expressed in the heart at 9.5, 12.5 and 15.5 dpc. Isoform 2 and isoform 3 are expressed in heart at 9.5 and 12.5 dpc.1 Publication

Inductioni

Up-regulated in CACNA1C knockout mice.1 Publication

Gene expression databases

BgeeiENSMUSG00000015968.
GenevisibleiQ99246. MM.

Interactioni

Subunit structurei

Voltage-dependent calcium channels are multisubunit complexes, consisting of alpha-1, alpha-2, beta and delta subunits in a 1:1:1:1 ratio. The channel activity is directed by the pore-forming and voltage-sensitive alpha-1 subunit. In many cases, this subunit is sufficient to generate voltage-sensitive calcium channel activity. The auxiliary subunits beta and alpha-2/delta linked by a disulfide bridge regulate the channel activity. Interacts (via IQ domain) with CABP1 and CABP4 in a calcium independent manner. Interacts with RIMBP2 (By similarity).By similarity

GO - Molecular functioni

  • alpha-actinin binding Source: MGI
  • ankyrin binding Source: BHF-UCL

Protein-protein interaction databases

BioGridi198433. 2 interactions.
IntActiQ99246. 1 interaction.
STRINGi10090.ENSMUSP00000107869.

Structurei

3D structure databases

ProteinModelPortaliQ99246.
SMRiQ99246. Positions 420-448, 1568-1648.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati113 – 409297IAdd
BLAST
Repeati529 – 775247IIAdd
BLAST
Repeati893 – 1175283IIIAdd
BLAST
Repeati1212 – 1487276IVAdd
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni429 – 44618Binding to the beta subunitBy similarityAdd
BLAST
Regioni1095 – 118591Dihydropyridine bindingBy similarityAdd
BLAST
Regioni1440 – 150667Dihydropyridine bindingBy similarityAdd
BLAST
Regioni1452 – 149544Phenylalkylamine bindingBy similarityAdd
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili771 – 81040Sequence analysisAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi1 – 77Poly-Met
Compositional biasi673 – 6797Poly-Leu
Compositional biasi847 – 85812Poly-GluAdd
BLAST

Domaini

Each of the four internal repeats contains five hydrophobic transmembrane segments (S1, S2, S3, S5, S6) and one positively charged transmembrane segment (S4). S4 segments probably represent the voltage-sensor and are characterized by a series of positively charged amino acids at every third position.

Sequence similaritiesi

Keywords - Domaini

Coiled coil, Repeat, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG2301. Eukaryota.
ENOG410XNP6. LUCA.
GeneTreeiENSGT00830000128247.
HOGENOMiHOG000231529.
HOVERGENiHBG050763.
InParanoidiQ99246.
KOiK04851.
OMAiIQVERPE.
OrthoDBiEOG091G0TKO.
TreeFamiTF312805.

Family and domain databases

Gene3Di1.20.120.350. 5 hits.
InterProiIPR031688. CAC1F_C.
IPR027359. Channel_four-helix_dom.
IPR031649. GPHH_dom.
IPR005821. Ion_trans_dom.
IPR005452. LVDCC_a1dsu.
IPR014873. VDCC_a1su_IQ.
IPR005446. VDCC_L_a1su.
IPR002077. VDCCAlpha1.
[Graphical view]
PANTHERiPTHR10037:SF139. PTHR10037:SF139. 1 hit.
PfamiPF08763. Ca_chan_IQ. 1 hit.
PF16885. CAC1F_C. 1 hit.
PF16905. GPHH. 1 hit.
PF00520. Ion_trans. 4 hits.
[Graphical view]
PRINTSiPR00167. CACHANNEL.
PR01630. LVDCCALPHA1.
PR01636. LVDCCALPHA1D.
SMARTiSM01062. Ca_chan_IQ. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q99246-2) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MMMMMMMKKM QHQRQHQEDH ANEANYARGT RLPISGEGPT SQPNSSKQTV
60 70 80 90 100
LSWQAAIDAA RQAKAAQTMS TSAPPPVGSL SQRKRQQYAK SKKQGNSSNS
110 120 130 140 150
RPARALFCLS LNNPIRRACI SIVEWKPFDI FILLAIFANC VALAIYIPFP
160 170 180 190 200
EDDSNSTNHN LEKVEYAFLI IFTVETFLKI IAYGLLLHPN AYVRNGWNLL
210 220 230 240 250
DFVIVIVGLF SVILEQLTKE TEGGNHSSGK SGGFDVKALR AFRVLRPLRL
260 270 280 290 300
VSGVPSLQVV LNSIIKAMVP LLHIALLVLF VIIIYAIIGL ELFIGKMHKT
310 320 330 340 350
CFFADSDIVA EEDPAPCAFS GNGRQCTANG TECRSGWVGP NGGITNFDNF
360 370 380 390 400
AFAMLTVFQC ITMEGWTDVL YWVNDAIGWE WPWVYFVSLI ILGSFFVLNL
410 420 430 440 450
VLGVLSGEFS KEREKAKARG DFQKLREKQQ LEEDLKGYLD WITQAEDIDP
460 470 480 490 500
ENEEEGGEEG KRNTSMPTSE TESVNTENVS GEGETQGCCG TLWCWWKRRG
510 520 530 540 550
AAKTGPSGCR RWGQAISKSK LSRRWRRWNR FNRRRCRAAV KSVTFYWLVI
560 570 580 590 600
VLVFLNTLTI SSEHYNQPDW LTQIQDIANK VLLALFTCEM LVKMYSLGLQ
610 620 630 640 650
AYFVSLFNRF DCFVVCGGIT ETILVELELM SPLGVSVFRC VRLLRIFKVT
660 670 680 690 700
RHWTSLSNLV ASLLNSMKSI ASLLLLLFLF IIIFSLLGMQ LFGGKFNFDE
710 720 730 740 750
TQTKRSTFDN FPQALLTVFQ ILTGEDWNAV MYDGIMAYGG PSSSGMIVCI
760 770 780 790 800
YFIILFICGN YILLNVFLAI AVDNLADAES LNTAQKEEAE EKERKKIARK
810 820 830 840 850
ESLENKKNNK PEVNQIANSD NKVTIDDYQE DAEDKDPYPP CDVPVGEEEE
860 870 880 890 900
EEEEDEPEVP AGPRPRRISE LNMKEKIAPI PEGSAFFILS KTNPIRVGCH
910 920 930 940 950
KLINHHIFTN LILVFIMLSS AALAAEDPIR SHSFRNTILG YFDYAFTAIF
960 970 980 990 1000
TVEILLKMTT FGAFLHKGAF CRNYFNLLDM LVVGVSLVSF GIQSSAISVV
1010 1020 1030 1040 1050
KILRVLRVLR PLRAINRAKG LKHVVQCVFV AIRTIGNIMI VTTLLQFMFA
1060 1070 1080 1090 1100
CIGVQLFKGK FYRCTDEAKS NPEECRGLFI LYKDGDVDSP VVRERIWQNS
1110 1120 1130 1140 1150
DFNFDNVLSA MMALFTVSTF EGWPALLYKA IDSNGENVGP VYNYRVEISI
1160 1170 1180 1190 1200
FFIIYIIIVA FFMMNIFVGF VIVTFQEQGE KEYKNCELDK NQRQCVEYAL
1210 1220 1230 1240 1250
KARPLRRYIP KNPYQYKFWY VVNSSPFEYM MFVLIMLNTL CLAMQHYEQS
1260 1270 1280 1290 1300
KMFNDAMDIL NMVFTGVFTV EMVLKVIAFK PKGYFSDAWN TFDSLIVIGS
1310 1320 1330 1340 1350
IIDVALSEAD PSESETIPLP TATPGNSEES NRISITFFRL FRVMRLVKLL
1360 1370 1380 1390 1400
SRGEGIRTLL WTFIKSFQAL PYVALLIAML FFIYAVIGMQ MFGKVAMRDN
1410 1420 1430 1440 1450
NQINRNNNFQ TFPQAVLLLF RCATGEAWQE IMLACLPGKL CDPDSDYNPG
1460 1470 1480 1490 1500
EEYTCGSNFA IVYFISFYML CAFLIINLFV AVIMDNFDYL TRDWSILGPH
1510 1520 1530 1540 1550
HLDEFKRIWS EYDPEAKGRI KHLDVVTLLR RIQPPLGFGK LCPHRVACKR
1560 1570 1580 1590 1600
LVAMNMPLNS DGTVMFNATL FALVRTALKI KTEGNLEQAN EELRAVIKKI
1610 1620 1630 1640 1650
WKKTSMKLLD QVVPPAGDDE VTVGKFYATF LIQDYFRKFK KRKEQGLVGK
1660 1670 1680 1690 1700
YPAKNTTIAL QAGLRTLHDI GPEIRRAISC DLQDDEPEDS KPEEEDVFKR
1710 1720 1730 1740 1750
NGALLGNHVN HVNSDRRDSL QQTNTTHRPL HVQRPSMPPA SDTEKPLFPP
1760 1770 1780 1790 1800
AGNSGCHNHH NHNSIGKQAP TSTNANLNNA NMSKAAHGKP PSIGNLEHVS
1810 1820 1830 1840 1850
ENGHYSCKHD RELQRRSSIK RTRYYETYIR SESGDEQFPT ICREDPEIHG
1860 1870 1880 1890 1900
YFRDPRCLGE QEYFSSEECC EDDSSPTWSR QNYNYYNRYP GSSMDFERPR
1910 1920 1930 1940 1950
GYHHPQGFLE DDDSPTGYDS RRSPRRRLLP PTPPSHRRSS FNFECLRRQS
1960 1970 1980 1990 2000
SQDDVLPSPA LPHRAALPLH LMQQQIMAVA GLDSSKAQKY SPSHSTRSWA
2010 2020 2030 2040 2050
TPPATPPYRD WSPCYTPLIQ VDRSESMDQV NGSLPSLHRS SWYTDEPDIS
2060 2070 2080 2090 2100
YRTFTPASLT VPSSFRNKNS DKQRSADSLV EAVLISEGLG RYARDPKFVS
2110 2120 2130 2140 2150
ATKHEIADAC DLTIDEMESA ASTLLNGSVC PRANGDMGPI SHRQDYELQD
2160 2170
FGPGYSDEEP DPGREEEDLA DEMICITTL
Length:2,179
Mass (Da):247,061
Last modified:July 27, 2011 - v3
Checksum:iBEED5EF140E75782
GO
Isoform 2 (identifier: Q99246-3) [UniParc]FASTAAdd to basket
Also known as: Cav1.3(1a)

The sequence of this isoform differs from the canonical sequence as follows:
     493-513: WCWWKRRGAAKTGPSGCRRWG → C
     1311-1325: Missing.

Show »
Length:2,144
Mass (Da):243,198
Checksum:i2CDC0111051527D3
GO
Isoform 3 (identifier: Q99246-4) [UniParc]FASTAAdd to basket
Also known as: Cav1.3(1b)

The sequence of this isoform differs from the canonical sequence as follows:
     1-22: MMMMMMMKKMQHQRQHQEDHAN → MNLPTFSSDLILIKSVLSQETDARYKGRVVSAVESTEDFSQAFA
     493-513: WCWWKRRGAAKTGPSGCRRWG → C
     1311-1325: Missing.

Show »
Length:2,166
Mass (Da):245,217
Checksum:i842E4AD6D5F07A91
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti445 – 4451A → V in CAD26883 (PubMed:12900400).Curated
Sequence conflicti445 – 4451A → V in CAD26884 (PubMed:12900400).Curated
Sequence conflicti868 – 8681I → T in CAD26883 (PubMed:12900400).Curated
Sequence conflicti868 – 8681I → T in CAD26884 (PubMed:12900400).Curated
Sequence conflicti1871 – 18711E → G in CAD26883 (PubMed:12900400).Curated
Sequence conflicti1871 – 18711E → G in CAD26884 (PubMed:12900400).Curated
Sequence conflicti2043 – 20431Y → S in BAC77259 (Ref. 2) Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 2222MMMMM…EDHAN → MNLPTFSSDLILIKSVLSQE TDARYKGRVVSAVESTEDFS QAFA in isoform 3. 1 PublicationVSP_027090Add
BLAST
Alternative sequencei493 – 51321WCWWK…CRRWG → C in isoform 2 and isoform 3. 1 PublicationVSP_027091Add
BLAST
Alternative sequencei1311 – 132515Missing in isoform 2 and isoform 3. 1 PublicationVSP_027092Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ437291 mRNA. Translation: CAD26883.1.
AJ437292 mRNA. Translation: CAD26884.1.
AB086123 mRNA. Translation: BAC77259.1.
AC119886 Genomic DNA. No translation available.
AC154305 Genomic DNA. No translation available.
AC154669 Genomic DNA. No translation available.
AC154690 Genomic DNA. No translation available.
CT009536 Genomic DNA. No translation available.
M57975 mRNA. Translation: AAA63292.1.
CCDSiCCDS36846.1. [Q99246-4]
CCDS36847.1. [Q99246-3]
RefSeqiNP_001077085.1. NM_001083616.2. [Q99246-3]
NP_001289566.1. NM_001302637.1. [Q99246-2]
NP_083257.2. NM_028981.3. [Q99246-4]
UniGeneiMm.9772.

Genome annotation databases

EnsembliENSMUST00000112249; ENSMUSP00000107868; ENSMUSG00000015968. [Q99246-3]
ENSMUST00000112250; ENSMUSP00000107869; ENSMUSG00000015968. [Q99246-4]
GeneIDi12289.
KEGGimmu:12289.
UCSCiuc007suu.2. mouse. [Q99246-3]
uc007suw.2. mouse. [Q99246-2]
uc007sux.2. mouse. [Q99246-4]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ437291 mRNA. Translation: CAD26883.1.
AJ437292 mRNA. Translation: CAD26884.1.
AB086123 mRNA. Translation: BAC77259.1.
AC119886 Genomic DNA. No translation available.
AC154305 Genomic DNA. No translation available.
AC154669 Genomic DNA. No translation available.
AC154690 Genomic DNA. No translation available.
CT009536 Genomic DNA. No translation available.
M57975 mRNA. Translation: AAA63292.1.
CCDSiCCDS36846.1. [Q99246-4]
CCDS36847.1. [Q99246-3]
RefSeqiNP_001077085.1. NM_001083616.2. [Q99246-3]
NP_001289566.1. NM_001302637.1. [Q99246-2]
NP_083257.2. NM_028981.3. [Q99246-4]
UniGeneiMm.9772.

3D structure databases

ProteinModelPortaliQ99246.
SMRiQ99246. Positions 420-448, 1568-1648.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi198433. 2 interactions.
IntActiQ99246. 1 interaction.
STRINGi10090.ENSMUSP00000107869.

Chemistry

GuidetoPHARMACOLOGYi530.

PTM databases

iPTMnetiQ99246.
PhosphoSiteiQ99246.

Proteomic databases

MaxQBiQ99246.
PaxDbiQ99246.
PRIDEiQ99246.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000112249; ENSMUSP00000107868; ENSMUSG00000015968. [Q99246-3]
ENSMUST00000112250; ENSMUSP00000107869; ENSMUSG00000015968. [Q99246-4]
GeneIDi12289.
KEGGimmu:12289.
UCSCiuc007suu.2. mouse. [Q99246-3]
uc007suw.2. mouse. [Q99246-2]
uc007sux.2. mouse. [Q99246-4]

Organism-specific databases

CTDi776.
MGIiMGI:88293. Cacna1d.

Phylogenomic databases

eggNOGiKOG2301. Eukaryota.
ENOG410XNP6. LUCA.
GeneTreeiENSGT00830000128247.
HOGENOMiHOG000231529.
HOVERGENiHBG050763.
InParanoidiQ99246.
KOiK04851.
OMAiIQVERPE.
OrthoDBiEOG091G0TKO.
TreeFamiTF312805.

Enzyme and pathway databases

ReactomeiR-MMU-419037. NCAM1 interactions.
R-MMU-422356. Regulation of insulin secretion.
R-MMU-5576892. Phase 0 - rapid depolarisation.
R-MMU-5576893. Phase 2 - plateau phase.
R-MMU-5576894. Phase 1 - inactivation of fast Na+ channels.

Miscellaneous databases

ChiTaRSiCacna1d. mouse.
PROiQ99246.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000015968.
GenevisibleiQ99246. MM.

Family and domain databases

Gene3Di1.20.120.350. 5 hits.
InterProiIPR031688. CAC1F_C.
IPR027359. Channel_four-helix_dom.
IPR031649. GPHH_dom.
IPR005821. Ion_trans_dom.
IPR005452. LVDCC_a1dsu.
IPR014873. VDCC_a1su_IQ.
IPR005446. VDCC_L_a1su.
IPR002077. VDCCAlpha1.
[Graphical view]
PANTHERiPTHR10037:SF139. PTHR10037:SF139. 1 hit.
PfamiPF08763. Ca_chan_IQ. 1 hit.
PF16885. CAC1F_C. 1 hit.
PF16905. GPHH. 1 hit.
PF00520. Ion_trans. 4 hits.
[Graphical view]
PRINTSiPR00167. CACHANNEL.
PR01630. LVDCCALPHA1.
PR01636. LVDCCALPHA1D.
SMARTiSM01062. Ca_chan_IQ. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiCAC1D_MOUSE
AccessioniPrimary (citable) accession number: Q99246
Secondary accession number(s): Q7TSD2, Q8R2I9, Q8R2J0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 15, 1999
Last sequence update: July 27, 2011
Last modified: September 7, 2016
This is version 144 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.