Q99246 (CAC1D_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 100.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Voltage-dependent L-type calcium channel subunit alpha-1D Alternative name(s): Calcium channel, L type, alpha-1 polypeptide isoform 2 Voltage-gated calcium channel subunit alpha Cav1.3 | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus |
Protein attributes
| Sequence length | 2179 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Voltage-sensitive calcium channels (VSCC) mediate the entry of calcium ions into excitable cells and are also involved in a variety of calcium-dependent processes, including muscle contraction, hormone or neurotransmitter release, gene expression, cell motility, cell division and cell death. The isoform alpha-1D gives rise to L-type calcium currents. Long-lasting (L-type) calcium channels belong to the 'high-voltage activated' (HVA) group. They are blocked by dihydropyridines (DHP), phenylalkylamines, benzothiazepines, and by omega-agatoxin-IIIA (omega-Aga-IIIA). They are however insensitive to omega-conotoxin-GVIA (omega-CTx-GVIA) and omega-agatoxin-IVA (omega-Aga-IVA). Ref.8 |
| Subunit structure | Voltage-dependent calcium channels are multisubunit complexes, consisting of alpha-1, alpha-2, beta and delta subunits in a 1:1:1:1 ratio. The channel activity is directed by the pore-forming and voltage-sensitive alpha-1 subunit. In many cases, this subunit is sufficient to generate voltage-sensitive calcium channel activity. The auxiliary subunits beta and alpha-2/delta linked by a disulfide bridge regulate the channel activity. Interacts (via IQ domain) with CABP1 and CABP4 in a calcium independent manner. Interacts with RIMBP2 By similarity. Ref.9 |
| Subcellular location | |
| Tissue specificity | Expressed in the inner hair cells (IHC) of the cochlea. Ref.8 |
| Developmental stage | Isoform 2 and isoform 3 are expressed in heart at 12.5 dpc (at protein level). Expressed in the heart at 9.5, 12.5 and 15.5 dpc. Isoform 2 and isoform 3 are expressed in heart at 9.5 and 12.5 dpc. Ref.1 |
| Induction | Up-regulated in CACNA1C knockout mice. Ref.1 |
| Domain | Each of the four internal repeats contains five hydrophobic transmembrane segments (S1, S2, S3, S5, S6) and one positively charged transmembrane segment (S4). S4 segments probably represent the voltage-sensor and are characterized by a series of positively charged amino acids at every third position. |
| Disruption phenotype | deafness, bradycardia and diabetic traits. Ref.5 Ref.6 Ref.7 |
| Sequence similarities | Belongs to the calcium channel alpha-1 subunit (TC 1.A.1.11) family. CACNA1D subfamily. [View classification] |
Ontologies
| Keywords | |
|---|---|
| Biological process | Calcium transport Ion transport Transport |
| Cellular component | Membrane |
| Coding sequence diversity | Alternative splicing |
| Domain | Coiled coil Repeat Transmembrane Transmembrane helix |
| Ligand | Calcium |
| Molecular function | Calcium channel Ionic channel Voltage-gated channel |
| PTM | Disulfide bond Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological process | G-protein signaling, coupled to cAMP nucleotide second messenger Inferred from mutant phenotype. Source: MGI sensory perception of soundInferred from mutant phenotype. Source: MGI |
| Cellular component | integral to plasma membrane Inferred by curator Ref.1. Source: MGI voltage-gated calcium channel complexTraceable author statement. Source: MGI |
| Molecular function | high voltage-gated calcium channel activity Inferred from direct assay Ref.1. Source: MGI protein bindingInferred from physical interaction. Source: MGI |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q99246-2) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q99246-3) Also known as: Cav1.3(1a); The sequence of this isoform differs from the canonical sequence as follows: 493-513: WCWWKRRGAAKTGPSGCRRWG → C 1311-1325: Missing. | ||||||
| Isoform 3 (identifier: Q99246-4) Also known as: Cav1.3(1b); The sequence of this isoform differs from the canonical sequence as follows: 1-22: MMMMMMMKKMQHQRQHQEDHAN → MNLPTFSSDLILIKSVLSQETDARYKGRVVSAVESTEDFSQAFA 493-513: WCWWKRRGAAKTGPSGCRRWG → C 1311-1325: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 2179 | 2179 | Voltage-dependent L-type calcium channel subunit alpha-1D | PRO_0000053935 | |||||
Regions | |||||||||
| Topological domain | 1 – 126 | 126 | Cytoplasmic Potential | ||||||
| Transmembrane | 127 – 145 | 19 | Helical; Name=S1 of repeat I; Potential | ||||||
| Topological domain | 146 – 163 | 18 | Extracellular Potential | ||||||
| Transmembrane | 164 – 183 | 20 | Helical; Name=S2 of repeat I; Potential | ||||||
| Topological domain | 184 – 195 | 12 | Cytoplasmic Potential | ||||||
| Transmembrane | 196 – 214 | 19 | Helical; Name=S3 of repeat I; Potential | ||||||
| Topological domain | 215 – 235 | 21 | Extracellular Potential | ||||||
| Transmembrane | 236 – 254 | 19 | Helical; Name=S4 of repeat I; Potential | ||||||
| Topological domain | 255 – 273 | 19 | Cytoplasmic Potential | ||||||
| Transmembrane | 274 – 293 | 20 | Helical; Name=S5 of repeat I; Potential | ||||||
| Topological domain | 294 – 381 | 88 | Extracellular Potential | ||||||
| Transmembrane | 382 – 406 | 25 | Helical; Name=S6 of repeat I; Potential | ||||||
| Topological domain | 407 – 543 | 137 | Cytoplasmic Potential | ||||||
| Transmembrane | 544 – 563 | 20 | Helical; Name=S1 of repeat II; Potential | ||||||
| Topological domain | 564 – 578 | 15 | Extracellular Potential | ||||||
| Transmembrane | 579 – 597 | 19 | Helical; Name=S2 of repeat II; Potential | ||||||
| Topological domain | 598 – 605 | 8 | Cytoplasmic Potential | ||||||
| Transmembrane | 606 – 624 | 19 | Helical; Name=S3 of repeat II; Potential | ||||||
| Topological domain | 625 – 634 | 10 | Extracellular Potential | ||||||
| Transmembrane | 635 – 653 | 19 | Helical; Name=S4 of repeat II; Potential | ||||||
| Topological domain | 654 – 672 | 19 | Cytoplasmic Potential | ||||||
| Transmembrane | 673 – 693 | 21 | Helical; Name=S5 of repeat II; Potential | ||||||
| Topological domain | 694 – 747 | 54 | Extracellular Potential | ||||||
| Transmembrane | 748 – 772 | 25 | Helical; Name=S6 of repeat II; Potential | ||||||
| Topological domain | 773 – 906 | 134 | Cytoplasmic Potential | ||||||
| Transmembrane | 907 – 925 | 19 | Helical; Name=S1 of repeat III; Potential | ||||||
| Topological domain | 926 – 941 | 16 | Extracellular Potential | ||||||
| Transmembrane | 942 – 961 | 20 | Helical; Name=S2 of repeat III; Potential | ||||||
| Topological domain | 962 – 973 | 12 | Cytoplasmic Potential | ||||||
| Transmembrane | 974 – 992 | 19 | Helical; Name=S3 of repeat III; Potential | ||||||
| Topological domain | 993 – 998 | 6 | Extracellular Potential | ||||||
| Transmembrane | 999 – 1018 | 20 | Helical; Name=S4 of repeat III; Potential | ||||||
| Topological domain | 1019 – 1037 | 19 | Cytoplasmic Potential | ||||||
| Transmembrane | 1038 – 1057 | 20 | Helical; Name=S5 of repeat III; Potential | ||||||
| Topological domain | 1058 – 1147 | 90 | Extracellular Potential | ||||||
| Transmembrane | 1148 – 1168 | 21 | Helical; Name=S6 of repeat III; Potential | ||||||
| Topological domain | 1169 – 1225 | 57 | Cytoplasmic Potential | ||||||
| Transmembrane | 1226 – 1244 | 19 | Helical; Name=S1 of repeat IV; Potential | ||||||
| Topological domain | 1245 – 1259 | 15 | Extracellular Potential | ||||||
| Transmembrane | 1260 – 1279 | 20 | Helical; Name=S2 of repeat IV; Potential | ||||||
| Topological domain | 1280 – 1286 | 7 | Cytoplasmic Potential | ||||||
| Transmembrane | 1287 – 1308 | 22 | Helical; Name=S3 of repeat IV; Potential | ||||||
| Topological domain | 1309 – 1333 | 25 | Extracellular Potential | ||||||
| Transmembrane | 1334 – 1353 | 20 | Helical; Name=S4 of repeat IV; Potential | ||||||
| Topological domain | 1354 – 1372 | 19 | Cytoplasmic Potential | ||||||
| Transmembrane | 1373 – 1392 | 20 | Helical; Name=S5 of repeat IV; Potential | ||||||
| Topological domain | 1393 – 1459 | 67 | Extracellular Potential | ||||||
| Transmembrane | 1460 – 1484 | 25 | Helical; Name=S6 of repeat IV; Potential | ||||||
| Topological domain | 1485 – 2179 | 695 | Cytoplasmic Potential | ||||||
| Repeat | 113 – 409 | 297 | I | ||||||
| Repeat | 529 – 775 | 247 | II | ||||||
| Repeat | 893 – 1175 | 283 | III | ||||||
| Repeat | 1212 – 1487 | 276 | IV | ||||||
| Calcium binding | 1513 – 1524 | 12 | By similarity | ||||||
| Region | 429 – 446 | 18 | Binding to the beta subunit By similarity | ||||||
| Region | 1095 – 1185 | 91 | Dihydropyridine binding By similarity | ||||||
| Region | 1440 – 1506 | 67 | Dihydropyridine binding By similarity | ||||||
| Region | 1452 – 1495 | 44 | Phenylalkylamine binding By similarity | ||||||
| Coiled coil | 771 – 810 | 40 | Potential | ||||||
| Compositional bias | 1 – 7 | 7 | Poly-Met | ||||||
| Compositional bias | 673 – 679 | 7 | Poly-Leu | ||||||
| Compositional bias | 847 – 858 | 12 | Poly-Glu | ||||||
Sites | |||||||||
| Site | 364 | 1 | Calcium ion selectivity and permeability By similarity | ||||||
| Site | 725 | 1 | Calcium ion selectivity and permeability By similarity | ||||||
| Site | 1121 | 1 | Calcium ion selectivity and permeability By similarity | ||||||
| Site | 1426 | 1 | Calcium ion selectivity and permeability By similarity | ||||||
Amino acid modifications | |||||||||
| Modified residue | 1495 | 1 | Phosphoserine; by PKA By similarity | ||||||
| Modified residue | 1923 | 1 | Phosphoserine By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 22 | 22 | MMMMM…EDHAN → MNLPTFSSDLILIKSVLSQE TDARYKGRVVSAVESTEDFS QAFA in isoform 3. | VSP_027090 | |||||
| Alternative sequence | 493 – 513 | 21 | WCWWK…CRRWG → C in isoform 2 and isoform 3. | VSP_027091 | |||||
| Alternative sequence | 1311 – 1325 | 15 | Missing in isoform 2 and isoform 3. | VSP_027092 | |||||
Experimental info | |||||||||
| Sequence conflict | 445 | 1 | A → V in CAD26883. Ref.1 | ||||||
| Sequence conflict | 445 | 1 | A → V in CAD26884. Ref.1 | ||||||
| Sequence conflict | 868 | 1 | I → T in CAD26883. Ref.1 | ||||||
| Sequence conflict | 868 | 1 | I → T in CAD26884. Ref.1 | ||||||
| Sequence conflict | 1871 | 1 | E → G in CAD26883. Ref.1 | ||||||
| Sequence conflict | 1871 | 1 | E → G in CAD26884. Ref.1 | ||||||
| Sequence conflict | 2043 | 1 | Y → S in BAC77259. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Enhanced expression of L-type Cav1.3 calcium channels in murine embryonic hearts from Cav1.2-deficient mice." Xu M., Welling A., Paparisto S., Hofmann F., Klugbauer N. J. Biol. Chem. 278:40837-40841(2003) [PubMed: 12900400] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 3), INDUCTION, DEVELOPMENTAL STAGE. Strain: C57BL/6. Tissue: Heart. |
| [2] | "Cloning of the L-type Ca2+ channel alpha1D-subunit from mouse brain and characterization of its expression in the liver." Okamoto T., Kobayashi T., Hino O. Submitted (JUN-2002) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Strain: BALB/c. Tissue: Brain. |
| [3] | "Lineage-specific biology revealed by a finished genome assembly of the mouse." Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S. Ponting C.P.PLoS Biol. 7:E1000112-E1000112(2009) [PubMed: 19468303] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: C57BL/6. |
| [4] | "Molecular diversity of L-type calcium channels. Evidence for alternative splicing of the transcripts of three non-allelic genes." Perez-Reyes E., Wei X., Castellano A., Birnbaumer L. J. Biol. Chem. 265:20430-20436(1990) [PubMed: 2173707] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1168-1463 (ISOFORMS 2/3). Strain: ICR. Tissue: Ovary. |
| [5] | "Congenital deafness and sinoatrial node dysfunction in mice lacking class D L-type Ca2+ channels." Platzer J., Engel J., Schrott-Fischer A., Stephan K., Bova S., Chen H., Zheng H., Striessnig J. Cell 102:89-97(2000) [PubMed: 10929716] [Abstract] Cited for: DISRUPTION PHENOTYPE. |
| [6] | "Requirement for the L-type Ca(2+) channel alpha(1D) subunit in postnatal pancreatic beta cell generation." Namkung Y., Skrypnyk N., Jeong M.J., Lee T., Lee M.S., Kim H.L., Chin H., Suh P.G., Kim S.S., Shin H.S. J. Clin. Invest. 108:1015-1022(2001) [PubMed: 11581302] [Abstract] Cited for: DISRUPTION PHENOTYPE. |
| [7] | "Functional role of L-type Cav1.3 Ca2+ channels in cardiac pacemaker activity." Mangoni M.E., Couette B., Bourinet E., Platzer J., Reimer D., Striessnig J., Nargeot J. Proc. Natl. Acad. Sci. U.S.A. 100:5543-5548(2003) [PubMed: 12700358] [Abstract] Cited for: DISRUPTION PHENOTYPE. |
| [8] | "Few CaV1.3 channels regulate the exocytosis of a synaptic vesicle at the hair cell ribbon synapse." Brandt A., Khimich D., Moser T. J. Neurosci. 25:11577-11585(2005) [PubMed: 16354915] [Abstract] Cited for: FUNCTION, TISSUE SPECIFICITY. |
| [9] | "Ca2+-binding proteins tune Ca2+-feedback to Cav1.3 channels in mouse auditory hair cells." Cui G., Meyer A.C., Calin-Jageman I., Neef J., Haeseleer F., Moser T., Lee A. J. Physiol. (Lond.) 585:791-803(2007) [PubMed: 17947313] [Abstract] Cited for: INTERACTION WITH CABP1 AND CABP4. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AJ437291 mRNA. Translation: CAD26883.1. AJ437292 mRNA. Translation: CAD26884.1. AB086123 mRNA. Translation: BAC77259.1. AC119886 Genomic DNA. No translation available. AC154305 Genomic DNA. No translation available. AC154669 Genomic DNA. No translation available. AC154690 Genomic DNA. No translation available. CT009536 Genomic DNA. No translation available. M57975 mRNA. Translation: AAA63292.1. |
| IPI | IPI00230232. IPI00855172. IPI01008081. |
| RefSeq | NP_001077085.1. NM_001083616.1. NP_083257.2. NM_028981.2. |
| UniGene | Mm.9772. |
3D structure databases | |
| ProteinModelPortal | Q99246. |
| SMR | Q99246. Positions 1568-1648. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q99246. 1 interaction. |
| STRING | Q99246. |
PTM databases | |
| PhosphoSite | Q99246. |
Proteomic databases | |
| PRIDE | Q99246. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSMUST00000057695; ENSMUSP00000057745; ENSMUSG00000015968. ENSMUST00000112249; ENSMUSP00000107868; ENSMUSG00000015968. ENSMUST00000112250; ENSMUSP00000107869; ENSMUSG00000015968. |
| GeneID | 12289. |
| KEGG | mmu:12289. |
| UCSC | uc007suu.1. mouse. uc007suv.1. mouse. uc007sux.1. mouse. |
Organism-specific databases | |
| CTD | 776. |
| MGI | MGI:88293. Cacna1d. |
Phylogenomic databases | |
| eggNOG | roNOG09300. |
| HOVERGEN | HBG050763. |
| OrthoDB | EOG47D9F6. |
Gene expression databases | |
| ArrayExpress | Q99246. |
| Bgee | Q99246. |
| Genevestigator | Q99246. |
| GermOnline | ENSMUSG00000015968. Mus musculus. |
Family and domain databases | |
| InterPro | IPR005821. Ion_trans. IPR005452. LVDCC_a1dsu. IPR014873. VDCC_a1su_IQ. IPR005446. VDCC_L_a1su. IPR002077. VDCCAlpha1. [Graphical view] |
| KO | K04851. |
| Pfam | PF08763. Ca_chan_IQ. 1 hit. PF00520. Ion_trans. 4 hits. [Graphical view] |
| PRINTS | PR00167. CACHANNEL. PR01630. LVDCCALPHA1. PR01636. LVDCCALPHA1D. |
| SMART | SM01062. Ca_chan_IQ. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 280770. |
| SOURCE | Search... |
Entry information
| Entry name | CAC1D_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q99246 Secondary accession number(s): Q7TSD2, Q8R2I9, Q8R2J0 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with