Q99244 (CAC1D_MESAU) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 88.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Voltage-dependent L-type calcium channel subunit alpha-1D Alternative name(s): Calcium channel, L type, alpha-1 polypeptide isoform 2 Voltage-gated calcium channel subunit alpha Cav1.3 | ||||
| Gene names |
| ||||
| Organism | Mesocricetus auratus (Golden hamster) | ||||
| Taxonomic identifier | 10036 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Cricetidae › Cricetinae › Mesocricetus![]() |
Protein attributes
| Sequence length | 1610 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | Voltage-sensitive calcium channels (VSCC) mediate the entry of calcium ions into excitable cells and are also involved in a variety of calcium-dependent processes, including muscle contraction, hormone or neurotransmitter release, gene expression, cell motility, cell division and cell death. The isoform alpha-1D gives rise to L-type calcium currents. Long-lasting (L-type) calcium channels belong to the 'high-voltage activated' (HVA) group. They are blocked by dihydropyridines (DHP), phenylalkylamines, benzothiazepines, and by omega-agatoxin-IIIA (omega-Aga-IIIA). They are however insensitive to omega-conotoxin-GVIA (omega-CTx-GVIA) and omega-agatoxin-IVA (omega-Aga-IVA). |
| Subunit structure | Voltage-dependent calcium channels are multisubunit complexes, consisting of alpha-1, alpha-2, beta and delta subunits in a 1:1:1:1 ratio. The channel activity is directed by the pore-forming and voltage-sensitive alpha-1 subunit. In many cases, this subunit is sufficient to generate voltage-sensitive calcium channel activity. The auxiliary subunits beta and alpha-2/delta linked by a disulfide bridge regulate the channel activity. Interacts with RIMBP2. Interacts with CABP1 and CABP4, resulting in a near elimination of calcium-dependent inactivation of the channel By similarity. |
| Subcellular location | |
| Tissue specificity | Expressed in brain, heart and skeletal muscle. |
| Domain | Each of the four internal repeats contains five hydrophobic transmembrane segments (S1, S2, S3, S5, S6) and one positively charged transmembrane segment (S4). S4 segments probably represent the voltage-sensor and are characterized by a series of positively charged amino acids at every third position. |
| Sequence similarities | Belongs to the calcium channel alpha-1 subunit (TC 1.A.1.11) family. CACNA1D subfamily. [View classification] |
Ontologies
| Keywords | |
|---|---|
| Biological process | Calcium transport Ion transport Transport |
| Cellular component | Membrane |
| Coding sequence diversity | Alternative splicing |
| Domain | Repeat Transmembrane Transmembrane helix |
| Ligand | Calcium Metal-binding |
| Molecular function | Calcium channel Ion channel Voltage-gated channel |
| PTM | Disulfide bond Glycoprotein Phosphoprotein |
| Gene Ontology (GO) | |
| Cellular_component | voltage-gated calcium channel complex Inferred from electronic annotation. Source: InterPro |
| Molecular_function | metal ion binding Inferred from electronic annotation. Source: UniProtKB-KW voltage-gated calcium channel activityInferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] Note: Additional isoforms seem to exist. | ||||||
| Isoform HCA3A (identifier: Q99244-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform CACH3B (identifier: Q99244-3) The sequence of this isoform is not available. | ||||||
| Isoform CACH3D (identifier: Q99244-2) The sequence of this isoform differs from the canonical sequence as follows: 1261-1303: GYFSDAWNTFDSLIVIGSIIDVALSEADPTESESLPLPTATPG → HYFTDAWNTFDALIVVGSVVDIAITEVN |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1610 | 1610 | Voltage-dependent L-type calcium channel subunit alpha-1D | PRO_0000053934 | |||||
Regions | |||||||||
| Topological domain | 1 – 125 | 125 | Cytoplasmic Potential | ||||||
| Transmembrane | 126 – 144 | 19 | Helical; Name=S1 of repeat I; Potential | ||||||
| Topological domain | 145 – 162 | 18 | Extracellular Potential | ||||||
| Transmembrane | 163 – 182 | 20 | Helical; Name=S2 of repeat I; Potential | ||||||
| Topological domain | 183 – 194 | 12 | Cytoplasmic Potential | ||||||
| Transmembrane | 195 – 213 | 19 | Helical; Name=S3 of repeat I; Potential | ||||||
| Topological domain | 214 – 234 | 21 | Extracellular Potential | ||||||
| Transmembrane | 235 – 253 | 19 | Helical; Name=S4 of repeat I; Potential | ||||||
| Topological domain | 254 – 272 | 19 | Cytoplasmic Potential | ||||||
| Transmembrane | 273 – 292 | 20 | Helical; Name=S5 of repeat I; Potential | ||||||
| Topological domain | 293 – 380 | 88 | Extracellular Potential | ||||||
| Transmembrane | 381 – 405 | 25 | Helical; Name=S6 of repeat I; Potential | ||||||
| Topological domain | 406 – 522 | 117 | Cytoplasmic Potential | ||||||
| Transmembrane | 523 – 542 | 20 | Helical; Name=S1 of repeat II; Potential | ||||||
| Topological domain | 543 – 557 | 15 | Extracellular Potential | ||||||
| Transmembrane | 558 – 576 | 19 | Helical; Name=S2 of repeat II; Potential | ||||||
| Topological domain | 577 – 584 | 8 | Cytoplasmic Potential | ||||||
| Transmembrane | 585 – 603 | 19 | Helical; Name=S3 of repeat II; Potential | ||||||
| Topological domain | 604 – 613 | 10 | Extracellular Potential | ||||||
| Transmembrane | 614 – 632 | 19 | Helical; Name=S4 of repeat II; Potential | ||||||
| Topological domain | 633 – 651 | 19 | Cytoplasmic Potential | ||||||
| Transmembrane | 652 – 672 | 21 | Helical; Name=S5 of repeat II; Potential | ||||||
| Topological domain | 673 – 726 | 54 | Extracellular Potential | ||||||
| Transmembrane | 727 – 751 | 25 | Helical; Name=S6 of repeat II; Potential | ||||||
| Topological domain | 752 – 884 | 133 | Cytoplasmic Potential | ||||||
| Transmembrane | 885 – 903 | 19 | Helical; Name=S1 of repeat III; Potential | ||||||
| Topological domain | 904 – 919 | 16 | Extracellular Potential | ||||||
| Transmembrane | 920 – 939 | 20 | Helical; Name=S2 of repeat III; Potential | ||||||
| Topological domain | 940 – 951 | 12 | Cytoplasmic Potential | ||||||
| Transmembrane | 952 – 970 | 19 | Helical; Name=S3 of repeat III; Potential | ||||||
| Topological domain | 971 – 976 | 6 | Extracellular Potential | ||||||
| Transmembrane | 977 – 996 | 20 | Helical; Name=S4 of repeat III; Potential | ||||||
| Topological domain | 997 – 1015 | 19 | Cytoplasmic Potential | ||||||
| Transmembrane | 1016 – 1035 | 20 | Helical; Name=S5 of repeat III; Potential | ||||||
| Topological domain | 1036 – 1125 | 90 | Extracellular Potential | ||||||
| Transmembrane | 1126 – 1146 | 21 | Helical; Name=S6 of repeat III; Potential | ||||||
| Topological domain | 1147 – 1203 | 57 | Cytoplasmic Potential | ||||||
| Transmembrane | 1204 – 1222 | 19 | Helical; Name=S1 of repeat IV; Potential | ||||||
| Topological domain | 1223 – 1237 | 15 | Extracellular Potential | ||||||
| Transmembrane | 1238 – 1257 | 20 | Helical; Name=S2 of repeat IV; Potential | ||||||
| Topological domain | 1258 – 1264 | 7 | Cytoplasmic Potential | ||||||
| Transmembrane | 1265 – 1286 | 22 | Helical; Name=S3 of repeat IV; Potential | ||||||
| Topological domain | 1287 – 1311 | 25 | Extracellular Potential | ||||||
| Transmembrane | 1312 – 1331 | 20 | Helical; Name=S4 of repeat IV; Potential | ||||||
| Topological domain | 1332 – 1350 | 19 | Cytoplasmic Potential | ||||||
| Transmembrane | 1351 – 1370 | 20 | Helical; Name=S5 of repeat IV; Potential | ||||||
| Topological domain | 1371 – 1437 | 67 | Extracellular Potential | ||||||
| Transmembrane | 1438 – 1462 | 25 | Helical; Name=S6 of repeat IV; Potential | ||||||
| Topological domain | 1463 – 1610 | 148 | Cytoplasmic Potential | ||||||
| Repeat | 112 – 408 | 297 | I | ||||||
| Repeat | 508 – 754 | 247 | II | ||||||
| Repeat | 871 – 1153 | 283 | III | ||||||
| Repeat | 1190 – 1465 | 276 | IV | ||||||
| Calcium binding | 1491 – 1502 | 12 | Potential | ||||||
| Region | 428 – 445 | 18 | Binding to the beta subunit By similarity | ||||||
| Region | 1073 – 1163 | 91 | Dihydropyridine binding By similarity | ||||||
| Region | 1418 – 1484 | 67 | Dihydropyridine binding By similarity | ||||||
| Region | 1430 – 1473 | 44 | Phenylalkylamine binding By similarity | ||||||
| Compositional bias | 1 – 6 | 6 | Poly-Met | ||||||
| Compositional bias | 652 – 658 | 7 | Poly-Leu | ||||||
| Compositional bias | 826 – 836 | 11 | Poly-Glu | ||||||
Sites | |||||||||
| Site | 363 | 1 | Calcium ion selectivity and permeability By similarity | ||||||
| Site | 704 | 1 | Calcium ion selectivity and permeability By similarity | ||||||
| Site | 1099 | 1 | Calcium ion selectivity and permeability By similarity | ||||||
| Site | 1404 | 1 | Calcium ion selectivity and permeability By similarity | ||||||
Amino acid modifications | |||||||||
| Modified residue | 1473 | 1 | Phosphoserine; by PKA Potential | ||||||
| Glycosylation | 154 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 224 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 328 | 1 | N-linked (GlcNAc...) Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 1261 – 1303 | 43 | GYFSD…TATPG → HYFTDAWNTFDALIVVGSVV DIAITEVN in isoform CACH3D. | VSP_000915 | |||||
Sequences
| ||||||||||||||||||||||||||||||
References
| [1] | "Cloning of a novel alpha 1-subunit of the voltage-dependent calcium channel from the beta-cell." Yaney G.C., Wheeler M.B., Wei X., Perez-Reyes E., Birnbaumer L., Boyd A.E. III, Moss L.G. Mol. Endocrinol. 6:2143-2152(1992) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM HCA3A). Tissue: Insulinoma. |
| [2] | "Molecular diversity of L-type calcium channels. Evidence for alternative splicing of the transcripts of three non-allelic genes." Perez-Reyes E., Wei X., Castellano A., Birnbaumer L. J. Biol. Chem. 265:20430-20436(1990) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1146-1441 (ISOFORMS CACH3B AND CACH3D). Tissue: Heart. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | M57969 mRNA. Translation: AAB59702.1. M57970 mRNA. Translation: AAA62807.1. |
| PIR | A46227. |
3D structure databases | |
| ProteinModelPortal | Q99244. |
| ModBase | Search... |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Phylogenomic databases | |
| HOVERGEN | HBG050763. |
Family and domain databases | |
| InterPro | IPR005821. Ion_trans_dom. IPR005452. LVDCC_a1dsu. IPR005446. VDCC_L_a1su. IPR002077. VDCCAlpha1. [Graphical view] |
| Pfam | PF00520. Ion_trans. 4 hits. [Graphical view] |
| PRINTS | PR00167. CACHANNEL. PR01630. LVDCCALPHA1. PR01636. LVDCCALPHA1D. |
| ProtoNet | Search... |
Entry information
| Entry name | CAC1D_MESAU | ||||||||
| Accession | Primary (citable) accession number: Q99244 Secondary accession number(s): Q99245 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| SIMILARITY comments Index of protein domains and families |

Clusters with
