Q99102 (MUC4_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 98.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Mucin-4 Short name=MUC-4 Alternative name(s): Ascites sialoglycoprotein Short name=ASGP Pancreatic adenocarcinoma mucin Testis mucin Tracheobronchial mucin Cleaved into the following 2 chains:
| ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 2169 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | May play a role in tumor progression. Ability to promote tumor growth may be mainly due to repression of apoptosis as opposed to proliferation. Has anti-adhesive properties. Seems to alter cellular behavior through both anti-adhesive effects on cell-cell and cell-extracellular matrix interactions and in its ability to act as an intramembrane ligand for ERBB2. Plays an important role in cell proliferation and differentiation of epithelial cells by inducing specific phosphorylation of ERBB2. The MUC4-ERBB2 complex causes site-specific phosphorylation of the ERBB2 'Tyr-1248'. In polarized epithelilal cells segragates ERBB2 and other ERBB receptors and prevents ERBB2 from acting as a coreceptor. The interaction with ERBB2 leads to enhanced expression of CDKN1B. The formation of a MUC4-ERBB2-ERBB3-NRG1 complex leads to down-regulation of CDKN1B, resulting in repression of apoptosis and stimulation of proliferation. Ref.8 Ref.9 Ref.10 Ref.11 |
| Subunit structure | A heterodimeric complex, composed of a mucin-4 alpha chain and a cysteine-rich transmembrane mucin-4 beta chain. Mucin-4 beta chain interacts with ERBB2 via the EGF-like domain 1. In nonpolarized cells, associates with ERBB2 and ERBB3 By similarity. |
| Subcellular location | Membrane; Single-pass membrane protein Potential. Secreted. Note: Isoforms lacking the Cys-rich region, EGF-like domains and transmembrane region are secreted. Secretion occurs by splicing or proteolytic processing. Ref.8 Mucin-4 beta chain: Cell membrane; Single-pass membrane protein Ref.8. Mucin-4 alpha chain: Secreted Ref.8. Isoform 3: Cell membrane; Single-pass membrane protein Ref.8. Isoform 17: Cell membrane; Single-pass membrane protein Ref.8. |
| Tissue specificity | Expressed in the thymus, thyroid, lung, trachea, esophagus, stomach, small intestine, colon, testis, prostate, ovary, uterus, placenta, and mammary and salivary glands. Expressed in carcinomas arising from some of these epithelia, such as lung cancers, squamous cell carcinomas of the upper aerodigestive tract, mammary carcinomas, biliary tract, colon, and cervix cancers. Minimally or not expressed in the normal pancreas or chronic pancreatitis, but is highly expressed in pancreatic tumors and pancreatic tumor cell lines. Ref.1 Ref.2 Ref.4 Ref.10 |
| Developmental stage | Expressed early in the primitive gut before respiratory and digestive epithelial cells have acquired their tissue and cell specificity. Expressed at the basal surface of the epithelium from week 14 to 26 weeks and then predominantly localized in only parietal cells. Immediately before birth, found in the cytoplasm of the mucous columnar epithelial cells. In the embryo expressed in skin, then disappears late in gestation. Ref.11 |
| Post-translational modification | Proteolytically cleaved into 2 chains, mucin-4 alpha chain and mucin-4 beta chain. mucrnin-4 alpha chain is highly O-glycosylated. Ref.12 mucin-4 beta chain is predominantly N-glycosylated. Ref.12 |
| Miscellaneous | Expression is a very useful predictor of poor prognosis in patients with invasive ductal carcinoma and intrahepatic cholangiocarcinoma, mass forming type (IDC,ICC-MF). Patients with IDC or ICC-MF who have high MUC4 expression had a worse survival rate than those with low MUC4 expression. |
| Sequence similarities | Contains 1 AMOP domain. Contains 2 EGF-like domains. Contains 1 NIDO domain. Contains 1 VWFD domain. |
| Sequence caution | The sequence AAA63230.1 differs from that shown. Reason: May be derived from an intron translation. The sequence CAC14139.1 differs from that shown. Reason: Frameshift at position 1171. The sequence CAC14141.1 differs from that shown. Reason: Frameshift at position 1256. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Cell adhesion |
| Cellular component | Cell membrane Membrane Secreted |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | EGF-like domain Repeat Signal Transmembrane Transmembrane helix |
| PTM | Disulfide bond Glycoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological process | cell-matrix adhesion Inferred from electronic annotation. Source: InterPro |
| Cellular component | integral to plasma membrane Traceable author statement. Source: ProtInc proteinaceous extracellular matrixNon-traceable author statement Ref.2. Source: UniProtKB |
| Molecular function | ErbB-2 class receptor binding Traceable author statement. Source: ProtInc extracellular matrix constituent, lubricant activityNon-traceable author statement Ref.2. Source: UniProtKB |
| Complete GO annotation... | |
Alternative products
| This entry describes 14 isoforms produced by alternative splicing. [Align] [Select] Note: Additional isoforms exist. | ||||||
| Isoform 1 (identifier: Q99102-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q99102-2) Also known as: Sv12; Sv13; The sequence of this isoform differs from the canonical sequence as follows: 1117-1157: FTDNGQIIFP...PVALVAPFWD → ASQAGTLWPW...TRRSMVNTAC 1158-2169: Missing. | ||||||
| Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. | ||||||
| Isoform 3 (identifier: Q99102-3) Also known as: Sv20; The sequence of this isoform differs from the canonical sequence as follows: 1814-1827: VAGCKCDGGTFGRY → LWGALSCVRTSPAL 1828-2169: Missing. | ||||||
| Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. | ||||||
| Isoform 5 (identifier: Q99102-5) Also known as: Sv18; Sv19; The sequence of this isoform differs from the canonical sequence as follows: 1172-1223: Missing. 1258-1267: GNPVLMGFSS → VEMAFSKTAH 1268-2169: Missing. | ||||||
| Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. | ||||||
| Isoform 7 (identifier: Q99102-7) Also known as: Sv16; The sequence of this isoform differs from the canonical sequence as follows: 1117-1201: FTDNGQIIFP...RKMTNNGGYK → ASQAGTLWPW...VPASVGEVSP 1202-2169: Missing. | ||||||
| Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. | ||||||
| Isoform 8 (identifier: Q99102-8) Also known as: Sv15; The sequence of this isoform differs from the canonical sequence as follows: 1117-1199: FTDNGQIIFP...WIRKMTNNGG → ASQAGTLWPW...VEMAFSKTAH 1200-2169: Missing. | ||||||
| Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. | ||||||
| Isoform 9 (identifier: Q99102-9) Also known as: Sv11; The sequence of this isoform differs from the canonical sequence as follows: 1071-1107: RGVSLFPYGAGAGDLEFVRRTVDFTSPLFKPATGFPL → SPLWGRRRGPGVRQEDRGLHLPTLQAGDWLPP 1108-2169: Missing. | ||||||
| Note: Dubious isoform produced through aberrant splice sites. | ||||||
| Isoform 10 (identifier: Q99102-10) Also known as: Sv3; Sv17; The sequence of this isoform differs from the canonical sequence as follows: 1172-1223: Missing. | ||||||
| Isoform 11 (identifier: Q99102-11) Also known as: Sv2; The sequence of this isoform differs from the canonical sequence as follows: 1073-1187: VSLFPYGAGA...GEHSLLVQQA → EAIQEFPSSP...TRRSMVNTAC 1188-2169: Missing. | ||||||
| Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. | ||||||
| Isoform 12 (identifier: Q99102-12) Also known as: SvX; The sequence of this isoform differs from the canonical sequence as follows: 29-1072: Missing. | ||||||
| Note: May be preferentially expressed in tumor tissues. | ||||||
| Isoform 13 (identifier: Q99102-13) Also known as: SvY; The sequence of this isoform differs from the canonical sequence as follows: 29-1021: Missing. | ||||||
| Note: May be preferentially expressed in tumor tissues. | ||||||
| Isoform 15 (identifier: Q99102-15) Also known as: Sv1; The sequence of this isoform differs from the canonical sequence as follows: 1073-1177: VSLFPYGAGA...TFYQEYETFY → AIQEFPSSPM...LVGGPHFIRL 1178-2169: Missing. | ||||||
| Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. | ||||||
| Isoform 16 (identifier: Q99102-16) Also known as: Sv6; The sequence of this isoform differs from the canonical sequence as follows: 1336-1384: VSCPCSWQQG...GVCCSYGPWG → AAPPRLAQPR...QSVSCWITRL 1385-2169: Missing. | ||||||
| Note: Dubious isoform produced through aberrant splice sites. | ||||||
| Isoform 17 (identifier: Q99102-17) Also known as: Sv8; The sequence of this isoform differs from the canonical sequence as follows: 1354-1579: Missing. | ||||||
| Note: Dubious isoform produced through aberrant splice sites. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 28 | 28 | Potential | ||||||||
| Chain | 29 – 2169 | 2141 | Mucin-4 | PRO_0000158956 | |||||||
| Chain | 29 – 1444 | 1416 | Mucin-4 alpha chain | PRO_0000274225 | |||||||
| Chain | 1445 – 2169 | 725 | Mucin-4 beta chain | PRO_0000274226 | |||||||
Regions | |||||||||||
| Transmembrane | 2126 – 2146 | 21 | Helical; Potential | ||||||||
| Domain | 1154 – 1309 | 156 | NIDO | ||||||||
| Domain | 1310 – 1425 | 116 | AMOP | ||||||||
| Domain | 1438 – 1673 | 236 | VWFD | ||||||||
| Domain | 1875 – 1914 | 40 | EGF-like 1 | ||||||||
| Domain | 2078 – 2117 | 40 | EGF-like 2 | ||||||||
| Region | 1002 – 1038 | 37 | Repeat | ||||||||
| Compositional bias | 793 – 1013 | 221 | Ser-rich | ||||||||
Sites | |||||||||||
| Site | 1444 – 1445 | 2 | Cleavage | ||||||||
Amino acid modifications | |||||||||||
| Glycosylation | 161 | 1 | O-linked (GalNAc...) Potential | ||||||||
| Glycosylation | 235 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 260 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 622 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 1472 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 1525 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 1544 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 1553 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 1588 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 1609 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 1632 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 1659 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 1685 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 1703 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 1739 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 1754 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 1802 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 1809 | 1 | N-linked (GlcNAc...) Ref.12 | ||||||||
| Glycosylation | 1857 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 1876 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 1942 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 1949 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 2049 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 1879 ↔ 1890 | By similarity | |||||||||
| Disulfide bond | 1884 ↔ 1902 | By similarity | |||||||||
| Disulfide bond | 1904 ↔ 1913 | By similarity | |||||||||
| Disulfide bond | 2081 ↔ 2092 | By similarity | |||||||||
| Disulfide bond | 2086 ↔ 2101 | By similarity | |||||||||
| Disulfide bond | 2103 ↔ 2116 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 29 – 1072 | 1044 | Missing in isoform 12. | VSP_022650 | |||||||
| Alternative sequence | 29 – 1021 | 993 | Missing in isoform 13. | VSP_022651 | |||||||
| Alternative sequence | 1071 – 1107 | 37 | RGVSL…TGFPL → SPLWGRRRGPGVRQEDRGLH LPTLQAGDWLPP in isoform 9. | VSP_022652 | |||||||
| Alternative sequence | 1073 – 1187 | 115 | VSLFP…LVQQA → EAIQEFPSSPMGQTPGTWSS SGGPWTSPPHSSSRRLASPL APLSVIPSTSQTMARSSSQS QTTRFSPTPTHSQQASQAGT LWPWWLRSGTMLTSPLVGGP HFIRNTRRSMVNTAC in isoform 11. | VSP_022653 | |||||||
| Alternative sequence | 1073 – 1177 | 105 | VSLFP…YETFY → AIQEFPSSPMGQTPGTWSSS GGPWTSPPHSSSRRLASPLA PLSVIPSTSQTMARSSSQSQ TTRFSPTPTHSQQASQAGTL WPWWLRSGTMLTSPLVGGPH FIRL in isoform 15. | VSP_022654 | |||||||
| Alternative sequence | 1108 – 2169 | 1062 | Missing in isoform 9. | VSP_022655 | |||||||
| Alternative sequence | 1117 – 1201 | 85 | FTDNG…NGGYK → ASQAGTLWPWWLRSGTMLTS PLVGGPHFIRATPTKPSSPR TGAGPMPCFSTRAVGCSGTW PSAQWRWLFRKQPTDVPASV GEVSP in isoform 7. | VSP_022656 | |||||||
| Alternative sequence | 1117 – 1199 | 83 | FTDNG…TNNGG → ASQAGTLWPWWLRSGTMLTS PLVGGPHFIRATPTKPSSPR TGAGPMPCFSTRAVGCSGTW PSAQASRCSWASLVEMAFSK TAH in isoform 8. | VSP_022657 | |||||||
| Alternative sequence | 1117 – 1157 | 41 | FTDNG…APFWD → ASQAGTLWPWWLRSGTMLTS PLVGGPHFIRNTRRSMVNTA C in isoform 2. | VSP_022658 | |||||||
| Alternative sequence | 1158 – 2169 | 1012 | Missing in isoform 2. | VSP_022659 | |||||||
| Alternative sequence | 1172 – 1223 | 52 | Missing in isoform 5 and isoform 10. | VSP_022661 | |||||||
| Alternative sequence | 1178 – 2169 | 992 | Missing in isoform 15. | VSP_022662 | |||||||
| Alternative sequence | 1188 – 2169 | 982 | Missing in isoform 11. | VSP_022663 | |||||||
| Alternative sequence | 1200 – 2169 | 970 | Missing in isoform 8. | VSP_022664 | |||||||
| Alternative sequence | 1202 – 2169 | 968 | Missing in isoform 7. | VSP_022665 | |||||||
| Alternative sequence | 1258 – 1267 | 10 | GNPVLMGFSS → VEMAFSKTAH in isoform 5. | VSP_022669 | |||||||
| Alternative sequence | 1268 – 2169 | 902 | Missing in isoform 5. | VSP_022670 | |||||||
| Alternative sequence | 1336 – 1384 | 49 | VSCPC…YGPWG → AAPPRLAQPRPPTSSPLRLS TAPAAWAPSRSNGSLSLTTQ SVSCWITRL in isoform 16. | VSP_022671 | |||||||
| Alternative sequence | 1354 – 1579 | 226 | Missing in isoform 17. | VSP_022672 | |||||||
| Alternative sequence | 1385 – 2169 | 785 | Missing in isoform 16. | VSP_022673 | |||||||
| Alternative sequence | 1814 – 1827 | 14 | VAGCK…TFGRY → LWGALSCVRTSPAL in isoform 3. | VSP_022674 | |||||||
| Alternative sequence | 1828 – 2169 | 342 | Missing in isoform 3. | VSP_022675 | |||||||
| Natural variant | 37 | 1 | G → D. Corresponds to variant rs2259292 [ dbSNP | Ensembl ]. | VAR_030211 | |||||||
| Natural variant | 41 | 1 | A → P. Ref.2 Ref.3 Corresponds to variant rs3107764 [ dbSNP | Ensembl ]. | VAR_065261 | |||||||
| Natural variant | 161 | 1 | T → A. Corresponds to variant rs2293232 [ dbSNP | Ensembl ]. | VAR_030212 | |||||||
| Natural variant | 585 | 1 | S → A. Corresponds to variant rs2246901 [ dbSNP | Ensembl ]. | VAR_030213 | |||||||
| Natural variant | 721 | 1 | A → T. Corresponds to variant rs3749331 [ dbSNP | Ensembl ]. | VAR_056585 | |||||||
| Natural variant | 1081 | 1 | G → D. Ref.1 Ref.2 Ref.3 Ref.4 Ref.5 Corresponds to variant rs2259292 [ dbSNP | Ensembl ]. | VAR_065262 | |||||||
| Natural variant | 1205 | 1 | A → T. Corresponds to variant rs2293232 [ dbSNP | Ensembl ]. | VAR_056586 | |||||||
| Natural variant | 1578 | 1 | A → S. Ref.3 Corresponds to variant rs2246901 [ dbSNP | Ensembl ]. | VAR_056587 | |||||||
Experimental info | |||||||||||
| Sequence conflict | 1194 | 1 | M → I in CAB85602. Ref.1 | ||||||||
| Sequence conflict | 1194 | 1 | M → I in CAB85603. Ref.1 | ||||||||
| Sequence conflict | 1194 | 1 | M → I in CAB85604. Ref.1 | ||||||||
| Sequence conflict | 1194 | 1 | M → I in CAB85605. Ref.1 | ||||||||
| Sequence conflict | 1194 | 1 | M → I in CAB85606. Ref.1 | ||||||||
| Sequence conflict | 1194 | 1 | M → I in CAB81773. Ref.2 | ||||||||
| Sequence conflict | 1194 | 1 | M → I in CAC14141. Ref.2 | ||||||||
| Sequence conflict | 1194 | 1 | M → I in CAC14142. Ref.2 | ||||||||
| Sequence conflict | 1194 | 1 | M → I in CAC14143. Ref.2 | ||||||||
| Sequence conflict | 1194 | 1 | M → I in AAM66747. Ref.3 | ||||||||
| Sequence conflict | 1194 | 1 | M → I in CAD22550. Ref.4 | ||||||||
| Sequence conflict | 1194 | 1 | M → I in CAB38059. Ref.5 | ||||||||
| Sequence conflict | 1259 | 1 | N → K in CAB81773. Ref.2 | ||||||||
| Sequence conflict | 1259 | 1 | N → K in CAC14143. Ref.2 | ||||||||
| Sequence conflict | 1259 | 1 | N → K in CAC10061. Ref.2 | ||||||||
| Sequence conflict | 1259 | 1 | N → K in AAM66747. Ref.3 | ||||||||
| Sequence conflict | 1271 | 1 | Y → F in CAB81773. Ref.2 | ||||||||
| Sequence conflict | 1271 | 1 | Y → F in CAC14143. Ref.2 | ||||||||
| Sequence conflict | 1271 | 1 | Y → F in CAC10061. Ref.2 | ||||||||
| Sequence conflict | 1271 | 1 | Y → F in AAM66747. Ref.3 | ||||||||
| Sequence conflict | 1305 | 1 | R → G in CAB81773. Ref.2 | ||||||||
| Sequence conflict | 1305 | 1 | R → G in CAC14143. Ref.2 | ||||||||
| Sequence conflict | 1305 | 1 | R → G in CAC10061. Ref.2 | ||||||||
| Sequence conflict | 1305 | 1 | R → G in AAM66747. Ref.3 | ||||||||
| Sequence conflict | 1557 | 1 | V → A in CAB81773. Ref.2 | ||||||||
| Sequence conflict | 1557 | 1 | V → A in CAC14143. Ref.2 | ||||||||
| Sequence conflict | 1557 | 1 | V → A in CAC10061. Ref.2 | ||||||||
| Sequence conflict | 1557 | 1 | V → A in AAM66747. Ref.3 | ||||||||
| Sequence conflict | 1920 – 1921 | 2 | Missing in CAC14143. Ref.2 | ||||||||
| Sequence conflict | 2039 | 1 | G → E in CAB85604. Ref.1 | ||||||||
| Sequence conflict | 2039 | 1 | G → E in CAB85605. Ref.1 | ||||||||
| Sequence conflict | 2039 | 1 | G → E in CAB85606. Ref.1 | ||||||||
| Sequence conflict | 2039 | 1 | G → E in CAD22550. Ref.4 | ||||||||
| Sequence conflict | 2039 | 1 | G → E in CAB38059. Ref.5 | ||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Alternative splicing generates a family of putative secreted and membrane-associated MUC4 mucins." Moniaux N., Escande F., Batra S.K., Porchet N., Laine A., Aubert J.-P. Eur. J. Biochem. 267:4536-4544(2000) [PubMed: 10880978] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 12 AND 13), PARTIAL NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2; 3; 11; 15; 16 AND 17), TISSUE SPECIFICITY, VARIANT ASP-1081. Tissue: Lung and Testis. |
| [2] | "Human MUC4 mucin cDNA and its variants in pancreatic carcinoma." Choudhury A., Moniaux N., Winpenny J.P., Hollingsworth M.A., Aubert J.-P., Batra S.K. J. Biochem. 128:233-243(2000) [PubMed: 10920259] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3; 5; 7; 8; 9; 10 AND 11), TISSUE SPECIFICITY, VARIANTS PRO-41 AND ASP-1081. Tissue: Pancreatic tumor. |
| [3] | "Cloning, chromosomal localization and characterization of the murine mucin gene orthologous to human MUC4." Desseyn J.-L., Clavereau I., Laine A. Eur. J. Biochem. 269:3150-3159(2002) [PubMed: 12084055] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS PRO-41; ASP-1081 AND SER-1578. |
| [4] | "Complete sequence of the human mucin MUC4: a putative cell membrane-associated mucin." Moniaux N., Nollet S., Porchet N., Degand P., Laine A., Aubert J.-P. Biochem. J. 338:325-333(1999) [PubMed: 10024507] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1014-2169 (ISOFORM 1), TISSUE SPECIFICITY, VARIANT ASP-1081. Tissue: Colon mucosa. |
| [5] | "Genomic organization of MUC4 mucin gene: towards the characterization of splice variants." Escande F., Lemaitre L., Moniaux N., Batra S.K., Aubert J.-P., Buisine M.P. Eur. J. Biochem. 269:3637-3644(2002) [PubMed: 12153560] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1014-2169, VARIANT ASP-1081. |
| [6] | "Molecular cloning and chromosomal localization of a novel human tracheo-bronchial mucin cDNA containing tandemly repeated sequences of 48 base pairs." Porchet N., van Cong N., Dufosse J., Audie J.P., Guyonnet-Duperat V., Gross M.S., Denis C., Degand P., Bernheim A., Aubert J.-P. Biochem. Biophys. Res. Commun. 175:414-422(1991) [PubMed: 1673336] [Abstract] Cited for: PRELIMINARY PARTIAL NUCLEOTIDE SEQUENCE [MRNA]. |
| [7] | "The DNA sequence, annotation and analysis of human chromosome 3." Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J. Gibbs R.A.Nature 440:1194-1198(2006) [PubMed: 16641997] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [8] | "Muc4/sialomucin complex, the intramembrane ErbB2 ligand, in cancer and epithelia: to protect and to survive." Carraway K.L., Perez A., Idris N., Jepson S., Arango M.E., Komatsu M., Haq B., Price-Schiavi S.A., Zhang J., Carraway C.A. Prog. Nucleic Acid Res. Mol. Biol. 71:149-185(2002) [PubMed: 12102554] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION. |
| [9] | "MUC4 expression is a novel prognostic factor in patients with invasive ductal carcinoma of the pancreas." Saitou M., Goto M., Horinouchi M., Tamada S., Nagata K., Hamada T., Osako M., Takao S., Batra S.K., Aikou T., Imai K., Yonezawa S. J. Clin. Pathol. 58:845-852(2005) [PubMed: 16049287] [Abstract] Cited for: FUNCTION. |
| [10] | "MUC4 expression and its relation to ErbB2 expression, apoptosis, proliferation, differentiation, and tumor stage in non-small cell lung cancer (NSCLC)." Karg A., Dinc Z.A., Basok O., Ucvet A. Pathol. Res. Pract. 202:577-583(2006) [PubMed: 16814944] [Abstract] Cited for: TISSUE SPECIFICITY, FUNCTION. |
| [11] | "MUC4 expression and localization in gastrointestinal tract and skin of human embryos." Zhang J., Yasin M., Carraway C.A., Carraway K.L. Tissue Cell 38:271-275(2006) [PubMed: 16914178] [Abstract] Cited for: DEVELOPMENTAL STAGE, FUNCTION. |
| [12] | "Identification of N-linked glycoproteins in human milk by hydrophilic interaction liquid chromatography and mass spectrometry." Picariello G., Ferranti P., Mamone G., Roepstorff P., Addeo F. Proteomics 8:3833-3847(2008) [PubMed: 18780401] [Abstract] Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-1809, MASS SPECTROMETRY. Tissue: Milk. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AJ242541 mRNA. Translation: CAB85597.1. AJ242542 mRNA. Translation: CAB85598.1. AJ242543 mRNA. Translation: CAB85599.1. AJ242544 mRNA. Translation: CAB85600.1. AJ242545 mRNA. Translation: CAB85601.1. AJ242546 mRNA. Translation: CAB85602.1. AJ242547 mRNA. Translation: CAB85603.1. AJ242548 mRNA. Translation: CAB85604.1. AJ242549 mRNA. Translation: CAB85605.1. AJ242550 mRNA. Translation: CAB85606.1. AJ276359 mRNA. Translation: CAB81773.1. AJ277412 mRNA. Translation: CAC10061.1. AJ277505 mRNA. Translation: CAC14585.1. AJ400633 mRNA. Translation: CAC10062.1. AJ400849 mRNA. Translation: CAC14134.1. AJ400850 mRNA. Translation: CAC14135.1. AJ400851 mRNA. Translation: CAC14136.1. AJ400852 mRNA. Translation: CAC14137.1. AJ400855 mRNA. Translation: CAC14140.1. AJ400853 mRNA. Translation: CAC14138.1. AJ400854 mRNA. Translation: CAC14139.1. Frameshift. AJ400856 mRNA. Translation: CAC14141.1. Frameshift. AJ400857 mRNA. Translation: CAC14142.1. AJ400858 mRNA. Translation: CAC14143.1. AF522055 AF522054 Genomic DNA. Translation: AAM66747.1.AJ010901 mRNA. Translation: CAB38059.1. AJ430032, AJ430033, AJ430034 Genomic DNA. Translation: CAD22550.1. M64594 mRNA. Translation: AAA63230.1. Sequence problems. AC069513 Genomic DNA. No translation available. AC233280 Genomic DNA. No translation available. |
| IPI | IPI00178316. IPI00302162. IPI00302258. IPI00479285. IPI00789419. IPI00790855. IPI00795577. IPI00797458. IPI00827725. IPI00827732. IPI00827758. IPI00827768. IPI00828047. IPI00828180. |
| PIR | PN0012. |
| RefSeq | NP_004523.3. NM_004532.5. NP_060876.5. NM_018406.6. NP_612154.2. NM_138297.4. |
| UniGene | Hs.369646. |
3D structure databases | |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q99102. 1 interaction. |
| STRING | Q99102. |
PTM databases | |
| GlycoSuiteDB | Q99102. |
| PhosphoSite | Q99102. |
Polymorphism databases | |
| DMDM | 300669685. |
Proteomic databases | |
| PRIDE | Q99102. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000346145; ENSP00000304207; ENSG00000145113. ENST00000349607; ENSP00000338109; ENSG00000145113. |
| GeneID | 4585. |
| KEGG | hsa:4585. |
| UCSC | uc003fvg.1. human. uc003fvk.1. human. uc010hzt.1. human. |
Organism-specific databases | |
| CTD | 4585. |
| GeneCards | GC03M195473. |
| H-InvDB | HIX0003957. |
| HGNC | HGNC:7514. MUC4. |
| HPA | CAB013536. HPA005895. |
| MIM | 158372. gene. |
| neXtProt | NX_Q99102. |
| GenAtlas | Search... |
Phylogenomic databases | |
| GeneTree | ENSGT00560000077082. |
| HOVERGEN | HBG081997. |
Gene expression databases | |
| Bgee | Q99102. |
| Genevestigator | Q99102. |
Family and domain databases | |
| InterPro | IPR005533. AMOP. IPR006210. EGF-like. IPR000742. EGF_3. IPR003886. Nidogen_extracell_dom. IPR001846. VWF_type-D. [Graphical view] |
| Pfam | PF03782. AMOP. 1 hit. PF06119. NIDO. 1 hit. PF00094. VWD. 1 hit. [Graphical view] |
| SMART | SM00181. EGF. 1 hit. SM00539. NIDO. 1 hit. SM00216. VWD. 1 hit. [Graphical view] |
| PROSITE | PS50856. AMOP. 1 hit. PS00022. EGF_1. 1 hit. PS01186. EGF_2. False negative. PS50026. EGF_3. 2 hits. PS51220. NIDO. 1 hit. PS51233. VWFD. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 17619. |
| SOURCE | Search... |
Entry information
| Entry name | MUC4_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q99102 Secondary accession number(s): O95938 Q9NY81 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 3 Human chromosome 3: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with