Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q99102 (MUC4_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 117. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Mucin-4

Short name=MUC-4
Alternative name(s):
Ascites sialoglycoprotein
Short name=ASGP
Pancreatic adenocarcinoma mucin
Testis mucin
Tracheobronchial mucin

Cleaved into the following 2 chains:

  1. Mucin-4 alpha chain
    Alternative name(s):
    Ascites sialoglycoprotein 1
    Short name=ASGP-1
  2. Mucin-4 beta chain
    Alternative name(s):
    Ascites sialoglycoprotein 2
    Short name=ASGP-2
Gene names
Name:MUC4
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length2169 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

May play a role in tumor progression. Ability to promote tumor growth may be mainly due to repression of apoptosis as opposed to proliferation. Has anti-adhesive properties. Seems to alter cellular behavior through both anti-adhesive effects on cell-cell and cell-extracellular matrix interactions and in its ability to act as an intramembrane ligand for ERBB2. Plays an important role in cell proliferation and differentiation of epithelial cells by inducing specific phosphorylation of ERBB2. The MUC4-ERBB2 complex causes site-specific phosphorylation of the ERBB2 'Tyr-1248'. In polarized epithelilal cells segragates ERBB2 and other ERBB receptors and prevents ERBB2 from acting as a coreceptor. The interaction with ERBB2 leads to enhanced expression of CDKN1B. The formation of a MUC4-ERBB2-ERBB3-NRG1 complex leads to down-regulation of CDKN1B, resulting in repression of apoptosis and stimulation of proliferation. Ref.8 Ref.9 Ref.10 Ref.11

Subunit structure

A heterodimeric complex, composed of a mucin-4 alpha chain and a cysteine-rich transmembrane mucin-4 beta chain. Mucin-4 beta chain interacts with ERBB2 via the EGF-like domain 1. In nonpolarized cells, associates with ERBB2 and ERBB3 By similarity.

Subcellular location

Membrane; Single-pass membrane protein Potential. Secreted. Note: Isoforms lacking the Cys-rich region, EGF-like domains and transmembrane region are secreted. Secretion occurs by splicing or proteolytic processing. Ref.8

Mucin-4 beta chain: Cell membrane; Single-pass membrane protein Ref.8.

Mucin-4 alpha chain: Secreted Ref.8.

Isoform 3: Cell membrane; Single-pass membrane protein Ref.8.

Isoform 11: Secreted Ref.8.

Isoform 15: Secreted Ref.8.

Isoform 17: Cell membrane; Single-pass membrane protein Ref.8.

Tissue specificity

Expressed in the thymus, thyroid, lung, trachea, esophagus, stomach, small intestine, colon, testis, prostate, ovary, uterus, placenta, and mammary and salivary glands. Expressed in carcinomas arising from some of these epithelia, such as lung cancers, squamous cell carcinomas of the upper aerodigestive tract, mammary carcinomas, biliary tract, colon, and cervix cancers. Minimally or not expressed in the normal pancreas or chronic pancreatitis, but is highly expressed in pancreatic tumors and pancreatic tumor cell lines. Ref.1 Ref.2 Ref.4 Ref.10

Developmental stage

Expressed early in the primitive gut before respiratory and digestive epithelial cells have acquired their tissue and cell specificity. Expressed at the basal surface of the epithelium from week 14 to 26 weeks and then predominantly localized in only parietal cells. Immediately before birth, found in the cytoplasm of the mucous columnar epithelial cells. In the embryo expressed in skin, then disappears late in gestation. Ref.11

Post-translational modification

Proteolytically cleaved into 2 chains, mucin-4 alpha chain and mucin-4 beta chain.

mucrnin-4 alpha chain is highly O-glycosylated.

mucin-4 beta chain is predominantly N-glycosylated.

Miscellaneous

Expression is a very useful predictor of poor prognosis in patients with invasive ductal carcinoma and intrahepatic cholangiocarcinoma, mass forming type (IDC,ICC-MF). Patients with IDC or ICC-MF who have high MUC4 expression had a worse survival rate than those with low MUC4 expression.

Sequence similarities

Contains 1 AMOP domain.

Contains 2 EGF-like domains.

Contains 1 NIDO domain.

Contains 1 VWFD domain.

Sequence caution

The sequence AAA63230.1 differs from that shown. Reason: May be derived from an intron translation.

The sequence CAC14139.1 differs from that shown. Reason: Frameshift at position 1171.

The sequence CAC14141.1 differs from that shown. Reason: Frameshift at position 1256.

Alternative products

This entry describes 14 isoforms produced by alternative splicing. [Align] [Select]

Note: Additional isoforms exist.
Isoform 1 (identifier: Q99102-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q99102-2)

Also known as: Sv12; Sv13;

The sequence of this isoform differs from the canonical sequence as follows:
     1117-1157: FTDNGQIIFP...PVALVAPFWD → ASQAGTLWPW...TRRSMVNTAC
     1158-2169: Missing.
Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Isoform 3 (identifier: Q99102-3)

Also known as: Sv20;

The sequence of this isoform differs from the canonical sequence as follows:
     1814-1827: VAGCKCDGGTFGRY → LWGALSCVRTSPAL
     1828-2169: Missing.
Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Isoform 5 (identifier: Q99102-5)

Also known as: Sv18; Sv19;

The sequence of this isoform differs from the canonical sequence as follows:
     1172-1223: Missing.
     1258-1267: GNPVLMGFSS → VEMAFSKTAH
     1268-2169: Missing.
Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Isoform 7 (identifier: Q99102-7)

Also known as: Sv16;

The sequence of this isoform differs from the canonical sequence as follows:
     1117-1201: FTDNGQIIFP...RKMTNNGGYK → ASQAGTLWPW...VPASVGEVSP
     1202-2169: Missing.
Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Isoform 8 (identifier: Q99102-8)

Also known as: Sv15;

The sequence of this isoform differs from the canonical sequence as follows:
     1117-1199: FTDNGQIIFP...WIRKMTNNGG → ASQAGTLWPW...VEMAFSKTAH
     1200-2169: Missing.
Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Isoform 9 (identifier: Q99102-9)

Also known as: Sv11;

The sequence of this isoform differs from the canonical sequence as follows:
     1071-1107: RGVSLFPYGAGAGDLEFVRRTVDFTSPLFKPATGFPL → SPLWGRRRGPGVRQEDRGLHLPTLQAGDWLPP
     1108-2169: Missing.
Note: Dubious isoform produced through aberrant splice sites.
Isoform 10 (identifier: Q99102-10)

Also known as: Sv3; Sv17;

The sequence of this isoform differs from the canonical sequence as follows:
     1172-1223: Missing.
Isoform 11 (identifier: Q99102-11)

Also known as: Sv2;

The sequence of this isoform differs from the canonical sequence as follows:
     1073-1187: VSLFPYGAGA...GEHSLLVQQA → EAIQEFPSSP...TRRSMVNTAC
     1188-2169: Missing.
Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Isoform 12 (identifier: Q99102-12)

Also known as: SvX;

The sequence of this isoform differs from the canonical sequence as follows:
     29-1072: Missing.
Note: May be preferentially expressed in tumor tissues.
Isoform 13 (identifier: Q99102-13)

Also known as: SvY;

The sequence of this isoform differs from the canonical sequence as follows:
     29-1021: Missing.
Note: May be preferentially expressed in tumor tissues.
Isoform 15 (identifier: Q99102-15)

Also known as: Sv1;

The sequence of this isoform differs from the canonical sequence as follows:
     1073-1177: VSLFPYGAGA...TFYQEYETFY → AIQEFPSSPM...LVGGPHFIRL
     1178-2169: Missing.
Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Isoform 16 (identifier: Q99102-16)

Also known as: Sv6;

The sequence of this isoform differs from the canonical sequence as follows:
     1336-1384: VSCPCSWQQG...GVCCSYGPWG → AAPPRLAQPR...QSVSCWITRL
     1385-2169: Missing.
Note: Dubious isoform produced through aberrant splice sites.
Isoform 17 (identifier: Q99102-17)

Also known as: Sv8;

The sequence of this isoform differs from the canonical sequence as follows:
     1354-1579: Missing.
Note: Dubious isoform produced through aberrant splice sites.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Signal peptide1 – 2828 Potential
Chain29 – 21692141Mucin-4
PRO_0000158956
Chain29 – 14441416Mucin-4 alpha chain
PRO_0000274225
Chain1445 – 2169725Mucin-4 beta chain
PRO_0000274226

Regions

Transmembrane2126 – 214621Helical; Potential
Domain1154 – 1309156NIDO
Domain1310 – 1425116AMOP
Domain1438 – 1673236VWFD
Domain1875 – 191440EGF-like 1
Domain2078 – 211740EGF-like 2
Region1002 – 103837Repeat
Compositional bias793 – 1013221Ser-rich

Sites

Site1444 – 14452Cleavage

Amino acid modifications

Glycosylation1611O-linked (GalNAc...) Potential
Glycosylation2351N-linked (GlcNAc...) Potential
Glycosylation2601N-linked (GlcNAc...) Potential
Glycosylation6221N-linked (GlcNAc...) Potential
Glycosylation14721N-linked (GlcNAc...) Potential
Glycosylation15251N-linked (GlcNAc...) Potential
Glycosylation15441N-linked (GlcNAc...) Potential
Glycosylation15531N-linked (GlcNAc...) Potential
Glycosylation15881N-linked (GlcNAc...) Potential
Glycosylation16091N-linked (GlcNAc...) Potential
Glycosylation16321N-linked (GlcNAc...) Potential
Glycosylation16591N-linked (GlcNAc...) Potential
Glycosylation16851N-linked (GlcNAc...) Potential
Glycosylation17031N-linked (GlcNAc...) Potential
Glycosylation17391N-linked (GlcNAc...) Potential
Glycosylation17541N-linked (GlcNAc...) Potential
Glycosylation18021N-linked (GlcNAc...) Potential
Glycosylation18091N-linked (GlcNAc...) Ref.12
Glycosylation18571N-linked (GlcNAc...) Potential
Glycosylation18761N-linked (GlcNAc...) Potential
Glycosylation19421N-linked (GlcNAc...) Potential
Glycosylation19491N-linked (GlcNAc...) Potential
Glycosylation20491N-linked (GlcNAc...) Potential
Disulfide bond1879 ↔ 1890 By similarity
Disulfide bond1884 ↔ 1902 By similarity
Disulfide bond1904 ↔ 1913 By similarity
Disulfide bond2081 ↔ 2092 By similarity
Disulfide bond2086 ↔ 2101 By similarity
Disulfide bond2103 ↔ 2116 By similarity

Natural variations

Alternative sequence29 – 10721044Missing in isoform 12.
VSP_022650
Alternative sequence29 – 1021993Missing in isoform 13.
VSP_022651
Alternative sequence1071 – 110737RGVSL…TGFPL → SPLWGRRRGPGVRQEDRGLH LPTLQAGDWLPP in isoform 9.
VSP_022652
Alternative sequence1073 – 1187115VSLFP…LVQQA → EAIQEFPSSPMGQTPGTWSS SGGPWTSPPHSSSRRLASPL APLSVIPSTSQTMARSSSQS QTTRFSPTPTHSQQASQAGT LWPWWLRSGTMLTSPLVGGP HFIRNTRRSMVNTAC in isoform 11.
VSP_022653
Alternative sequence1073 – 1177105VSLFP…YETFY → AIQEFPSSPMGQTPGTWSSS GGPWTSPPHSSSRRLASPLA PLSVIPSTSQTMARSSSQSQ TTRFSPTPTHSQQASQAGTL WPWWLRSGTMLTSPLVGGPH FIRL in isoform 15.
VSP_022654
Alternative sequence1108 – 21691062Missing in isoform 9.
VSP_022655
Alternative sequence1117 – 120185FTDNG…NGGYK → ASQAGTLWPWWLRSGTMLTS PLVGGPHFIRATPTKPSSPR TGAGPMPCFSTRAVGCSGTW PSAQWRWLFRKQPTDVPASV GEVSP in isoform 7.
VSP_022656
Alternative sequence1117 – 119983FTDNG…TNNGG → ASQAGTLWPWWLRSGTMLTS PLVGGPHFIRATPTKPSSPR TGAGPMPCFSTRAVGCSGTW PSAQASRCSWASLVEMAFSK TAH in isoform 8.
VSP_022657
Alternative sequence1117 – 115741FTDNG…APFWD → ASQAGTLWPWWLRSGTMLTS PLVGGPHFIRNTRRSMVNTA C in isoform 2.
VSP_022658
Alternative sequence1158 – 21691012Missing in isoform 2.
VSP_022659
Alternative sequence1172 – 122352Missing in isoform 5 and isoform 10.
VSP_022661
Alternative sequence1178 – 2169992Missing in isoform 15.
VSP_022662
Alternative sequence1188 – 2169982Missing in isoform 11.
VSP_022663
Alternative sequence1200 – 2169970Missing in isoform 8.
VSP_022664
Alternative sequence1202 – 2169968Missing in isoform 7.
VSP_022665
Alternative sequence1258 – 126710GNPVLMGFSS → VEMAFSKTAH in isoform 5.
VSP_022669
Alternative sequence1268 – 2169902Missing in isoform 5.
VSP_022670
Alternative sequence1336 – 138449VSCPC…YGPWG → AAPPRLAQPRPPTSSPLRLS TAPAAWAPSRSNGSLSLTTQ SVSCWITRL in isoform 16.
VSP_022671
Alternative sequence1354 – 1579226Missing in isoform 17.
VSP_022672
Alternative sequence1385 – 2169785Missing in isoform 16.
VSP_022673
Alternative sequence1814 – 182714VAGCK…TFGRY → LWGALSCVRTSPAL in isoform 3.
VSP_022674
Alternative sequence1828 – 2169342Missing in isoform 3.
VSP_022675
Natural variant371G → D.
Corresponds to variant rs2259292 [ dbSNP | Ensembl ].
VAR_030211
Natural variant411A → P. Ref.2 Ref.3
Corresponds to variant rs3107764 [ dbSNP | Ensembl ].
VAR_065261
Natural variant1611T → A.
Corresponds to variant rs2293232 [ dbSNP | Ensembl ].
VAR_030212
Natural variant5851S → A.
Corresponds to variant rs2246901 [ dbSNP | Ensembl ].
VAR_030213
Natural variant7211A → T.
Corresponds to variant rs3749331 [ dbSNP | Ensembl ].
VAR_056585
Natural variant10811G → D. Ref.1 Ref.2 Ref.3 Ref.4 Ref.5
Corresponds to variant rs2259292 [ dbSNP | Ensembl ].
VAR_065262
Natural variant12051A → T.
Corresponds to variant rs2293232 [ dbSNP | Ensembl ].
VAR_056586
Natural variant15781A → S. Ref.3
Corresponds to variant rs2246901 [ dbSNP | Ensembl ].
VAR_056587

Experimental info

Sequence conflict11941M → I in CAB85602. Ref.1
Sequence conflict11941M → I in CAB85603. Ref.1
Sequence conflict11941M → I in CAB85604. Ref.1
Sequence conflict11941M → I in CAB85605. Ref.1
Sequence conflict11941M → I in CAB85606. Ref.1
Sequence conflict11941M → I in CAB81773. Ref.2
Sequence conflict11941M → I in CAC14141. Ref.2
Sequence conflict11941M → I in CAC14142. Ref.2
Sequence conflict11941M → I in CAC14143. Ref.2
Sequence conflict11941M → I in AAM66747. Ref.3
Sequence conflict11941M → I in CAD22550. Ref.4
Sequence conflict11941M → I in CAB38059. Ref.5
Sequence conflict12591N → K in CAB81773. Ref.2
Sequence conflict12591N → K in CAC14143. Ref.2
Sequence conflict12591N → K in CAC10061. Ref.2
Sequence conflict12591N → K in AAM66747. Ref.3
Sequence conflict12711Y → F in CAB81773. Ref.2
Sequence conflict12711Y → F in CAC14143. Ref.2
Sequence conflict12711Y → F in CAC10061. Ref.2
Sequence conflict12711Y → F in AAM66747. Ref.3
Sequence conflict13051R → G in CAB81773. Ref.2
Sequence conflict13051R → G in CAC14143. Ref.2
Sequence conflict13051R → G in CAC10061. Ref.2
Sequence conflict13051R → G in AAM66747. Ref.3
Sequence conflict15571V → A in CAB81773. Ref.2
Sequence conflict15571V → A in CAC14143. Ref.2
Sequence conflict15571V → A in CAC10061. Ref.2
Sequence conflict15571V → A in AAM66747. Ref.3
Sequence conflict1920 – 19212Missing in CAC14143. Ref.2
Sequence conflict20391G → E in CAB85604. Ref.1
Sequence conflict20391G → E in CAB85605. Ref.1
Sequence conflict20391G → E in CAB85606. Ref.1
Sequence conflict20391G → E in CAD22550. Ref.4
Sequence conflict20391G → E in CAB38059. Ref.5

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified June 28, 2011. Version 4.
Checksum: 53615AF8DD416957

FASTA2,169231,518
        10         20         30         40         50         60 
MKGARWRRVP WVSLSCLCLC LLPHVVPGTT EDTLITGSKT AAPVTSTGST TATLEGQSTA 

        70         80         90        100        110        120 
ASSRTSNQDI SASSQNHQTK STETTSKAQT DTLTQMMTST LFSSPSVHNV METVTQETAP 

       130        140        150        160        170        180 
PDEMTTSFPS SVTNTLMMTS KTITMTTSTD STLGNTEETS TAGTESSTPV TSAVSITAGQ 

       190        200        210        220        230        240 
EGQSRTTSWR TSIQDTSASS QNHWTRSTQT TRESQTSTLT HRTTSTPSFS PSVHNVTGTV 

       250        260        270        280        290        300 
SQKTSPSGET ATSSLCSVTN TSMMTSEKIT VTTSTGSTLG NPGETSSVPV TGSLMPVTSA 

       310        320        330        340        350        360 
ALVTVDPEGQ SPATFSRTST QDTTAFSKNH QTQSVETTRV SQINTLNTLT PVTTSTVLSS 

       370        380        390        400        410        420 
PSGFNPSGTV SQETFPSGET TISSPSSVSN TFLVTSKVFR MPISRDSTLG NTEETSLSVS 

       430        440        450        460        470        480 
GTISAITSKV STIWWSDTLS TALSPSSLPP KISTAFHTQQ SEGAETTGRP HERSSFSPGV 

       490        500        510        520        530        540 
SQEIFTLHET TTWPSSFSSK GHTTWSQTEL PSTSTGAATR LVTGNPSTRA AGTIPRVPSK 

       550        560        570        580        590        600 
VSAIGEPGEP TTYSSHSTTL PKTTGAGAQT QWTQETGTTG EALLSSPSYS VIQMIKTATS 

       610        620        630        640        650        660 
PSSSPMLDRH TSQQITTAPS TNHSTIHSTS TSPQESPAVS QRGHTRAPQT TQESQTTRSV 

       670        680        690        700        710        720 
SPMTDTKTVT TPGSSFTASG HSPSEIVPQD APTISAATTF APAPTGNGHT TQAPTTALQA 

       730        740        750        760        770        780 
APSSHDATLG PSGGTSLSKT GALTLANSVV STPGGPEGQW TSASASTSPD TAAAMTHTHQ 

       790        800        810        820        830        840 
AESTEASGQT QTSEPASSGS RTTSAGTATP SSSGASGTTP SGSEGISTSG ETTRFSSNPS 

       850        860        870        880        890        900 
RDSHTTQSTT ELLSASASHG AIPVSTGMAS SIVPGTFHPT LSEASTAGRP TGQSSPTSPS 

       910        920        930        940        950        960 
ASPQETAAIS RMAQTQRTGT SRGSDTISLA SQATDTFSTV PPTPPSITSS GLTSPQTQTH 

       970        980        990       1000       1010       1020 
TLSPSGSGKT FTTALISNAT PLPVTSTSSA STGHATPLAV SSATSASTVS SDSPLKMETS 

      1030       1040       1050       1060       1070       1080 
GMTTPSLKTD GGRRTATSPP PTTSQTIIST IPSTAMHTRS TAAPIPILPE RGVSLFPYGA 

      1090       1100       1110       1120       1130       1140 
GAGDLEFVRR TVDFTSPLFK PATGFPLGSS LRDSLYFTDN GQIIFPESDY QIFSYPNPLP 

      1150       1160       1170       1180       1190       1200 
TGFTGRDPVA LVAPFWDDAD FSTGRGTTFY QEYETFYGEH SLLVQQAESW IRKMTNNGGY 

      1210       1220       1230       1240       1250       1260 
KARWALKVTW VNAHAYPAQW TLGSNTYQAI LSTDGSRSYA LFLYQSGGMQ WDVAQRSGNP 

      1270       1280       1290       1300       1310       1320 
VLMGFSSGDG YFENSPLMSQ PVWERYRPDR FLNSNSGLQG LQFYRLHREE RPNYRLECLQ 

      1330       1340       1350       1360       1370       1380 
WLKSQPRWPS WGWNQVSCPC SWQQGRRDLR FQPVSIGRWG LGSRQLCSFT SWRGGVCCSY 

      1390       1400       1410       1420       1430       1440 
GPWGEFREGW HVQRPWQLAQ ELEPQSWCCR WNDKPYLCAL YQQRRPHVGC ATYRPPQPAW 

      1450       1460       1470       1480       1490       1500 
MFGDPHITTL DGVSYTFNGL GDFLLVGAQD GNSSFLLQGR TAQTGSAQAT NFIAFAAQYR 

      1510       1520       1530       1540       1550       1560 
SSSLGPVTVQ WLLEPHDAIR VLLDNQTVTF QPDHEDGGGQ ETFNATGVLL SRNGSEVSAS 

      1570       1580       1590       1600       1610       1620 
FDGWATVSVI ALSNILHASA SLPPEYQNRT EGLLGVWNNN PEDDFRMPNG STIPPGSPEE 

      1630       1640       1650       1660       1670       1680 
MLFHFGMTWQ INGTGLLGKR NDQLPSNFTP VFYSQLQKNS SWAEHLISNC DGDSSCIYDT 

      1690       1700       1710       1720       1730       1740 
LALRNASIGL HTREVSKNYE QANATLNQYP PSINGGRVIE AYKGQTTLIQ YTSNAEDANF 

      1750       1760       1770       1780       1790       1800 
TLRDSCTDLE LFENGTLLWT PKSLEPFTLE ILARSAKIGL ASALQPRTVV CHCNAESQCL 

      1810       1820       1830       1840       1850       1860 
YNQTSRVGNS SLEVAGCKCD GGTFGRYCEG SEDACEEPCF PSVHCVPGKG CEACPPNLTG 

      1870       1880       1890       1900       1910       1920 
DGRHCAALGS SFLCQNQSCP VNYCYNQGHC YISQTLGCQP MCTCPPAFTD SRCFLAGNNF 

      1930       1940       1950       1960       1970       1980 
SPTVNLELPL RVIQLLLSEE ENASMAEVNA SVAYRLGTLD MRAFLRNSQV ERIDSAAPAS 

      1990       2000       2010       2020       2030       2040 
GSPIQHWMVI SEFQYRPRGP VIDFLNNQLL AAVVEAFLYH VPRRSEEPRN DVVFQPISGE 

      2050       2060       2070       2080       2090       2100 
DVRDVTALNV STLKAYFRCD GYKGYDLVYS PQSGFTCVSP CSRGYCDHGG QCQHLPSGPR 

      2110       2120       2130       2140       2150       2160 
CSCVSFSIYT AWGEHCEHLS MKLDAFFGIF FGALGGLLLL GVGTFVVLRF WGCSGARFSY 


FLNSAEALP 

« Hide

Isoform 2 (Sv12) (Sv13) [UniParc].

Checksum: 563F538E94C8D17F
Show »

FASTA1,157118,842
Isoform 3 (Sv20) [UniParc].

Checksum: 7C0F057C7FFD9B61
Show »

FASTA1,827194,147
Isoform 5 (Sv18) (Sv19) [UniParc].

Checksum: 6394DD971A6AC6AA
Show »

FASTA1,215125,352
Isoform 7 (Sv16) [UniParc].

Checksum: 90CCFA911DF8A6DC
Show »

FASTA1,201123,420
Isoform 8 (Sv15) [UniParc].

Checksum: C297274BF47EE49E
Show »

FASTA1,199123,047
Isoform 9 (Sv11) [UniParc].

Checksum: A533603C2182BFD7
Show »

FASTA1,102112,954
Isoform 10 (Sv3) (Sv17) [UniParc].

Checksum: 6A59FC9B7497C05F
Show »

FASTA2,117225,434
Isoform 11 (Sv2) [UniParc].

Checksum: 79896412E450E46B
Show »

FASTA1,187121,900
Isoform 12 (SvX) [UniParc].

Checksum: D1750D4908B75B6D
Show »

FASTA1,125125,130
Isoform 13 (SvY) [UniParc].

Checksum: 92B845E20A242187
Show »

FASTA1,176130,415
Isoform 15 (Sv1) [UniParc].

Checksum: 922532E6C031907A
Show »

FASTA1,176120,650
Isoform 16 (Sv6) [UniParc].

Checksum: 24DAF864CC4008DD
Show »

FASTA1,384144,847
Isoform 17 (Sv8) [UniParc].

Checksum: 8AB442BDDA613D41
Show »

FASTA1,943206,605

References

« Hide 'large scale' references
[1]"Alternative splicing generates a family of putative secreted and membrane-associated MUC4 mucins."
Moniaux N., Escande F., Batra S.K., Porchet N., Laine A., Aubert J.-P.
Eur. J. Biochem. 267:4536-4544(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 12 AND 13), PARTIAL NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2; 3; 11; 15; 16 AND 17), TISSUE SPECIFICITY, VARIANT ASP-1081.
Tissue: Lung and Testis.
[2]"Human MUC4 mucin cDNA and its variants in pancreatic carcinoma."
Choudhury A., Moniaux N., Winpenny J.P., Hollingsworth M.A., Aubert J.-P., Batra S.K.
J. Biochem. 128:233-243(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3; 5; 7; 8; 9; 10 AND 11), TISSUE SPECIFICITY, VARIANTS PRO-41 AND ASP-1081.
Tissue: Pancreatic tumor.
[3]"Cloning, chromosomal localization and characterization of the murine mucin gene orthologous to human MUC4."
Desseyn J.-L., Clavereau I., Laine A.
Eur. J. Biochem. 269:3150-3159(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS PRO-41; ASP-1081 AND SER-1578.
[4]"Complete sequence of the human mucin MUC4: a putative cell membrane-associated mucin."
Moniaux N., Nollet S., Porchet N., Degand P., Laine A., Aubert J.-P.
Biochem. J. 338:325-333(1999) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1014-2169 (ISOFORM 1), TISSUE SPECIFICITY, VARIANT ASP-1081.
Tissue: Colon mucosa.
[5]"Genomic organization of MUC4 mucin gene: towards the characterization of splice variants."
Escande F., Lemaitre L., Moniaux N., Batra S.K., Aubert J.-P., Buisine M.P.
Eur. J. Biochem. 269:3637-3644(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1014-2169, VARIANT ASP-1081.
[6]"Molecular cloning and chromosomal localization of a novel human tracheo-bronchial mucin cDNA containing tandemly repeated sequences of 48 base pairs."
Porchet N., van Cong N., Dufosse J., Audie J.P., Guyonnet-Duperat V., Gross M.S., Denis C., Degand P., Bernheim A., Aubert J.-P.
Biochem. Biophys. Res. Commun. 175:414-422(1991) [PubMed] [Europe PMC] [Abstract]
Cited for: PRELIMINARY PARTIAL NUCLEOTIDE SEQUENCE [MRNA].
[7]"The DNA sequence, annotation and analysis of human chromosome 3."
Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J. expand/collapse author list , Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R., Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Wei S., Wheeler D.A., Wright M.W., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clendenning J., Clerc-Blankenburg K.P., Chen R., Chen Z., Davis C., Delgado O., Dinh H.H., Dong W., Draper H., Ernst S., Fu G., Gonzalez-Garay M.L., Garcia D.K., Gillett W., Gu J., Hao B., Haugen E., Havlak P., He X., Hennig S., Hu S., Huang W., Jackson L.R., Jacob L.S., Kelly S.H., Kube M., Levy R., Li Z., Liu B., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Palmeiri A., Pasternak S., Perez L.M., Phelps K.A., Plopper F.J., Qiang B., Raymond C., Rodriguez R., Saenphimmachak C., Santibanez J., Shen H., Shen Y., Subramanian S., Tabor P.E., Verduzco D., Waldron L., Wang J., Wang J., Wang Q., Williams G.A., Wong G.K.-S., Yao Z., Zhang J., Zhang X., Zhao G., Zhou J., Zhou Y., Nelson D., Lehrach H., Reinhardt R., Naylor S.L., Yang H., Olson M., Weinstock G., Gibbs R.A.
Nature 440:1194-1198(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[8]"Muc4/sialomucin complex, the intramembrane ErbB2 ligand, in cancer and epithelia: to protect and to survive."
Carraway K.L., Perez A., Idris N., Jepson S., Arango M.E., Komatsu M., Haq B., Price-Schiavi S.A., Zhang J., Carraway C.A.
Prog. Nucleic Acid Res. Mol. Biol. 71:149-185(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION, SUBCELLULAR LOCATION.
[9]"MUC4 expression is a novel prognostic factor in patients with invasive ductal carcinoma of the pancreas."
Saitou M., Goto M., Horinouchi M., Tamada S., Nagata K., Hamada T., Osako M., Takao S., Batra S.K., Aikou T., Imai K., Yonezawa S.
J. Clin. Pathol. 58:845-852(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION.
[10]"MUC4 expression and its relation to ErbB2 expression, apoptosis, proliferation, differentiation, and tumor stage in non-small cell lung cancer (NSCLC)."
Karg A., Dinc Z.A., Basok O., Ucvet A.
Pathol. Res. Pract. 202:577-583(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: TISSUE SPECIFICITY, FUNCTION.
[11]"MUC4 expression and localization in gastrointestinal tract and skin of human embryos."
Zhang J., Yasin M., Carraway C.A., Carraway K.L.
Tissue Cell 38:271-275(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: DEVELOPMENTAL STAGE, FUNCTION.
[12]"Identification of N-linked glycoproteins in human milk by hydrophilic interaction liquid chromatography and mass spectrometry."
Picariello G., Ferranti P., Mamone G., Roepstorff P., Addeo F.
Proteomics 8:3833-3847(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-1809.
Tissue: Milk.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AJ242541 mRNA. Translation: CAB85597.1.
AJ242542 mRNA. Translation: CAB85598.1.
AJ242543 mRNA. Translation: CAB85599.1.
AJ242544 mRNA. Translation: CAB85600.1.
AJ242545 mRNA. Translation: CAB85601.1.
AJ242546 mRNA. Translation: CAB85602.1.
AJ242547 mRNA. Translation: CAB85603.1.
AJ242548 mRNA. Translation: CAB85604.1.
AJ242549 mRNA. Translation: CAB85605.1.
AJ242550 mRNA. Translation: CAB85606.1.
AJ276359 mRNA. Translation: CAB81773.1.
AJ277412 mRNA. Translation: CAC10061.1.
AJ277505 mRNA. Translation: CAC14585.1.
AJ400633 mRNA. Translation: CAC10062.1.
AJ400849 mRNA. Translation: CAC14134.1.
AJ400850 mRNA. Translation: CAC14135.1.
AJ400851 mRNA. Translation: CAC14136.1.
AJ400852 mRNA. Translation: CAC14137.1.
AJ400855 mRNA. Translation: CAC14140.1.
AJ400853 mRNA. Translation: CAC14138.1.
AJ400854 mRNA. Translation: CAC14139.1. Frameshift.
AJ400856 mRNA. Translation: CAC14141.1. Frameshift.
AJ400857 mRNA. Translation: CAC14142.1.
AJ400858 mRNA. Translation: CAC14143.1.
AF522055 expand/collapse EMBL AC list , AF522031, AF522032, AF522033, AF522034, AF522035, AF522036, AF522037, AF522038, AF522039, AF522040, AF522041, AF522042, AF522043, AF522044, AF522045, AF522046, AF522047, AF522048, AF522049, AF522050, AF522051, AF522052, AF522053, AF522054 Genomic DNA. Translation: AAM66747.1.
AJ010901 mRNA. Translation: CAB38059.1.
AJ430032, AJ430033, AJ430034 Genomic DNA. Translation: CAD22550.1.
M64594 mRNA. Translation: AAA63230.1. Sequence problems.
AC069513 Genomic DNA. No translation available.
AC233280 Genomic DNA. No translation available.
CCDSCCDS3310.1. [Q99102-13]
CCDS3311.1. [Q99102-12]
PIRPN0012.
RefSeqNP_004523.3. NM_004532.5. [Q99102-13]
NP_060876.5. NM_018406.6.
NP_612154.2. NM_138297.4. [Q99102-12]
UniGeneHs.369646.

3D structure databases

ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid110672. 1 interaction.
IntActQ99102. 1 interaction.

PTM databases

PhosphoSiteQ99102.
UniCarbKBQ99102.

Polymorphism databases

DMDM338817990.

Proteomic databases

MaxQBQ99102.
PaxDbQ99102.
PRIDEQ99102.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000346145; ENSP00000304207; ENSG00000145113. [Q99102-13]
ENST00000349607; ENSP00000338109; ENSG00000145113. [Q99102-12]
GeneID4585.
KEGGhsa:4585.
UCSCuc003fuz.3. human. [Q99102-12]
uc003fvo.3. human. [Q99102-13]
uc021xjn.1. human. [Q99102-10]

Organism-specific databases

CTD4585.
GeneCardsGC03M195473.
H-InvDBHIX0003957.
HIX0163449.
HGNCHGNC:7514. MUC4.
HPACAB013536.
HPA005895.
MIM158372. gene.
neXtProtNX_Q99102.
PharmGKBPA31319.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG12793.
HOVERGENHBG081997.

Enzyme and pathway databases

ReactomeREACT_17015. Metabolism of proteins.

Gene expression databases

ArrayExpressQ99102.
BgeeQ99102.
GenevestigatorQ99102.

Family and domain databases

InterProIPR005533. AMOP.
IPR000742. EG-like_dom.
IPR003886. Nidogen_extracell_dom.
IPR001846. VWF_type-D.
[Graphical view]
PfamPF03782. AMOP. 1 hit.
PF06119. NIDO. 1 hit.
PF00094. VWD. 1 hit.
[Graphical view]
SMARTSM00181. EGF. 1 hit.
SM00539. NIDO. 1 hit.
SM00216. VWD. 1 hit.
[Graphical view]
PROSITEPS50856. AMOP. 1 hit.
PS00022. EGF_1. 1 hit.
PS50026. EGF_3. 2 hits.
PS51220. NIDO. 1 hit.
PS51233. VWFD. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSMUC4. human.
GeneWikiMUC4.
GenomeRNAi4585.
NextBio17619.
PROQ99102.
SOURCESearch...

Entry information

Entry nameMUC4_HUMAN
AccessionPrimary (citable) accession number: Q99102
Secondary accession number(s): O95938 expand/collapse secondary AC list , Q9GZM2, Q9GZV6, Q9H481, Q9H482, Q9H483, Q9H484, Q9H485, Q9H486, Q9H487, Q9H4D6, Q9H4D8, Q9NPJ0, Q9NY09, Q9NY75, Q9NY76, Q9NY77, Q9NY78, Q9NY79, Q9NY80, Q9NY81
Entry history
Integrated into UniProtKB/Swiss-Prot: June 1, 1994
Last sequence update: June 28, 2011
Last modified: July 9, 2014
This is version 117 of the entry and version 4 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 3

Human chromosome 3: entries, gene names and cross-references to MIM