Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q99102

- MUC4_HUMAN

UniProt

Q99102 - MUC4_HUMAN

Protein

Mucin-4

Gene

MUC4

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 119 (01 Oct 2014)
      Sequence version 4 (28 Jun 2011)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    May play a role in tumor progression. Ability to promote tumor growth may be mainly due to repression of apoptosis as opposed to proliferation. Has anti-adhesive properties. Seems to alter cellular behavior through both anti-adhesive effects on cell-cell and cell-extracellular matrix interactions and in its ability to act as an intramembrane ligand for ERBB2. Plays an important role in cell proliferation and differentiation of epithelial cells by inducing specific phosphorylation of ERBB2. The MUC4-ERBB2 complex causes site-specific phosphorylation of the ERBB2 'Tyr-1248'. In polarized epithelilal cells segragates ERBB2 and other ERBB receptors and prevents ERBB2 from acting as a coreceptor. The interaction with ERBB2 leads to enhanced expression of CDKN1B. The formation of a MUC4-ERBB2-ERBB3-NRG1 complex leads to down-regulation of CDKN1B, resulting in repression of apoptosis and stimulation of proliferation.4 Publications

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sitei1444 – 14452Cleavage

    GO - Molecular functioni

    1. ErbB-2 class receptor binding Source: ProtInc
    2. extracellular matrix constituent, lubricant activity Source: UniProtKB

    GO - Biological processi

    1. cell-matrix adhesion Source: InterPro
    2. cellular protein metabolic process Source: Reactome
    3. maintenance of gastrointestinal epithelium Source: UniProt
    4. O-glycan processing Source: Reactome
    5. post-translational protein modification Source: Reactome

    Keywords - Biological processi

    Cell adhesion

    Enzyme and pathway databases

    ReactomeiREACT_115606. O-linked glycosylation of mucins.
    REACT_115835. Termination of O-glycan biosynthesis.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Mucin-4
    Short name:
    MUC-4
    Alternative name(s):
    Ascites sialoglycoprotein
    Short name:
    ASGP
    Pancreatic adenocarcinoma mucin
    Testis mucin
    Tracheobronchial mucin
    Cleaved into the following 2 chains:
    Alternative name(s):
    Ascites sialoglycoprotein 1
    Short name:
    ASGP-1
    Alternative name(s):
    Ascites sialoglycoprotein 2
    Short name:
    ASGP-2
    Gene namesi
    Name:MUC4
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 3

    Organism-specific databases

    HGNCiHGNC:7514. MUC4.

    Subcellular locationi

    Membrane Curated; Single-pass membrane protein Curated. Secreted 1 Publication
    Note: Isoforms lacking the Cys-rich region, EGF-like domains and transmembrane region are secreted. Secretion occurs by splicing or proteolytic processing.

    GO - Cellular componenti

    1. extracellular space Source: UniProt
    2. extracellular vesicular exosome Source: UniProt
    3. Golgi lumen Source: Reactome
    4. integral component of plasma membrane Source: ProtInc
    5. membrane Source: UniProtKB
    6. proteinaceous extracellular matrix Source: UniProtKB
    7. vesicle Source: UniProtKB

    Keywords - Cellular componenti

    Cell membrane, Membrane, Secreted

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA31319.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 2828Sequence AnalysisAdd
    BLAST
    Chaini29 – 21692141Mucin-4PRO_0000158956Add
    BLAST
    Chaini29 – 14441416Mucin-4 alpha chainPRO_0000274225Add
    BLAST
    Chaini1445 – 2169725Mucin-4 beta chainPRO_0000274226Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi161 – 1611O-linked (GalNAc...)Sequence Analysis
    Glycosylationi235 – 2351N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi260 – 2601N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi622 – 6221N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi1472 – 14721N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi1525 – 15251N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi1544 – 15441N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi1553 – 15531N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi1588 – 15881N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi1609 – 16091N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi1632 – 16321N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi1659 – 16591N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi1685 – 16851N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi1703 – 17031N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi1739 – 17391N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi1754 – 17541N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi1802 – 18021N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi1809 – 18091N-linked (GlcNAc...)1 Publication
    Glycosylationi1857 – 18571N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi1876 – 18761N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi1879 ↔ 1890By similarity
    Disulfide bondi1884 ↔ 1902By similarity
    Disulfide bondi1904 ↔ 1913By similarity
    Glycosylationi1942 – 19421N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi1949 – 19491N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi2049 – 20491N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi2081 ↔ 2092By similarity
    Disulfide bondi2086 ↔ 2101By similarity
    Disulfide bondi2103 ↔ 2116By similarity

    Post-translational modificationi

    Proteolytically cleaved into 2 chains, mucin-4 alpha chain and mucin-4 beta chain.
    mucrnin-4 alpha chain is highly O-glycosylated.1 Publication
    mucin-4 beta chain is predominantly N-glycosylated.1 Publication

    Keywords - PTMi

    Disulfide bond, Glycoprotein

    Proteomic databases

    MaxQBiQ99102.
    PaxDbiQ99102.
    PRIDEiQ99102.

    PTM databases

    PhosphoSiteiQ99102.
    UniCarbKBiQ99102.

    Expressioni

    Tissue specificityi

    Expressed in the thymus, thyroid, lung, trachea, esophagus, stomach, small intestine, colon, testis, prostate, ovary, uterus, placenta, and mammary and salivary glands. Expressed in carcinomas arising from some of these epithelia, such as lung cancers, squamous cell carcinomas of the upper aerodigestive tract, mammary carcinomas, biliary tract, colon, and cervix cancers. Minimally or not expressed in the normal pancreas or chronic pancreatitis, but is highly expressed in pancreatic tumors and pancreatic tumor cell lines.4 Publications

    Developmental stagei

    Expressed early in the primitive gut before respiratory and digestive epithelial cells have acquired their tissue and cell specificity. Expressed at the basal surface of the epithelium from week 14 to 26 weeks and then predominantly localized in only parietal cells. Immediately before birth, found in the cytoplasm of the mucous columnar epithelial cells. In the embryo expressed in skin, then disappears late in gestation.1 Publication

    Gene expression databases

    ArrayExpressiQ99102.
    BgeeiQ99102.
    GenevestigatoriQ99102.

    Organism-specific databases

    HPAiCAB013536.
    HPA005895.

    Interactioni

    Subunit structurei

    A heterodimeric complex, composed of a mucin-4 alpha chain and a cysteine-rich transmembrane mucin-4 beta chain. Mucin-4 beta chain interacts with ERBB2 via the EGF-like domain 1. In nonpolarized cells, associates with ERBB2 and ERBB3 By similarity.By similarity

    Protein-protein interaction databases

    BioGridi110672. 1 interaction.
    IntActiQ99102. 1 interaction.

    Structurei

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei2126 – 214621HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini1154 – 1309156NIDOPROSITE-ProRule annotationAdd
    BLAST
    Domaini1310 – 1425116AMOPPROSITE-ProRule annotationAdd
    BLAST
    Domaini1438 – 1673236VWFDPROSITE-ProRule annotationAdd
    BLAST
    Domaini1875 – 191440EGF-like 1PROSITE-ProRule annotationAdd
    BLAST
    Domaini2078 – 211740EGF-like 2PROSITE-ProRule annotationAdd
    BLAST

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni1002 – 103837RepeatAdd
    BLAST

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi793 – 1013221Ser-richAdd
    BLAST

    Sequence similaritiesi

    Contains 1 AMOP domain.PROSITE-ProRule annotation
    Contains 2 EGF-like domains.PROSITE-ProRule annotation
    Contains 1 NIDO domain.PROSITE-ProRule annotation
    Contains 1 VWFD domain.PROSITE-ProRule annotation

    Keywords - Domaini

    EGF-like domain, Repeat, Signal, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG12793.
    HOVERGENiHBG081997.

    Family and domain databases

    InterProiIPR005533. AMOP.
    IPR000742. EG-like_dom.
    IPR003886. Nidogen_extracell_dom.
    IPR001846. VWF_type-D.
    [Graphical view]
    PfamiPF03782. AMOP. 1 hit.
    PF06119. NIDO. 1 hit.
    PF00094. VWD. 1 hit.
    [Graphical view]
    SMARTiSM00181. EGF. 1 hit.
    SM00539. NIDO. 1 hit.
    SM00216. VWD. 1 hit.
    [Graphical view]
    PROSITEiPS50856. AMOP. 1 hit.
    PS00022. EGF_1. 1 hit.
    PS50026. EGF_3. 2 hits.
    PS51220. NIDO. 1 hit.
    PS51233. VWFD. 1 hit.
    [Graphical view]

    Sequences (14)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 14 isoformsi produced by alternative splicing. Align

    Note: Additional isoforms exist.

    Isoform 1 (identifier: Q99102-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MKGARWRRVP WVSLSCLCLC LLPHVVPGTT EDTLITGSKT AAPVTSTGST     50
    TATLEGQSTA ASSRTSNQDI SASSQNHQTK STETTSKAQT DTLTQMMTST 100
    LFSSPSVHNV METVTQETAP PDEMTTSFPS SVTNTLMMTS KTITMTTSTD 150
    STLGNTEETS TAGTESSTPV TSAVSITAGQ EGQSRTTSWR TSIQDTSASS 200
    QNHWTRSTQT TRESQTSTLT HRTTSTPSFS PSVHNVTGTV SQKTSPSGET 250
    ATSSLCSVTN TSMMTSEKIT VTTSTGSTLG NPGETSSVPV TGSLMPVTSA 300
    ALVTVDPEGQ SPATFSRTST QDTTAFSKNH QTQSVETTRV SQINTLNTLT 350
    PVTTSTVLSS PSGFNPSGTV SQETFPSGET TISSPSSVSN TFLVTSKVFR 400
    MPISRDSTLG NTEETSLSVS GTISAITSKV STIWWSDTLS TALSPSSLPP 450
    KISTAFHTQQ SEGAETTGRP HERSSFSPGV SQEIFTLHET TTWPSSFSSK 500
    GHTTWSQTEL PSTSTGAATR LVTGNPSTRA AGTIPRVPSK VSAIGEPGEP 550
    TTYSSHSTTL PKTTGAGAQT QWTQETGTTG EALLSSPSYS VIQMIKTATS 600
    PSSSPMLDRH TSQQITTAPS TNHSTIHSTS TSPQESPAVS QRGHTRAPQT 650
    TQESQTTRSV SPMTDTKTVT TPGSSFTASG HSPSEIVPQD APTISAATTF 700
    APAPTGNGHT TQAPTTALQA APSSHDATLG PSGGTSLSKT GALTLANSVV 750
    STPGGPEGQW TSASASTSPD TAAAMTHTHQ AESTEASGQT QTSEPASSGS 800
    RTTSAGTATP SSSGASGTTP SGSEGISTSG ETTRFSSNPS RDSHTTQSTT 850
    ELLSASASHG AIPVSTGMAS SIVPGTFHPT LSEASTAGRP TGQSSPTSPS 900
    ASPQETAAIS RMAQTQRTGT SRGSDTISLA SQATDTFSTV PPTPPSITSS 950
    GLTSPQTQTH TLSPSGSGKT FTTALISNAT PLPVTSTSSA STGHATPLAV 1000
    SSATSASTVS SDSPLKMETS GMTTPSLKTD GGRRTATSPP PTTSQTIIST 1050
    IPSTAMHTRS TAAPIPILPE RGVSLFPYGA GAGDLEFVRR TVDFTSPLFK 1100
    PATGFPLGSS LRDSLYFTDN GQIIFPESDY QIFSYPNPLP TGFTGRDPVA 1150
    LVAPFWDDAD FSTGRGTTFY QEYETFYGEH SLLVQQAESW IRKMTNNGGY 1200
    KARWALKVTW VNAHAYPAQW TLGSNTYQAI LSTDGSRSYA LFLYQSGGMQ 1250
    WDVAQRSGNP VLMGFSSGDG YFENSPLMSQ PVWERYRPDR FLNSNSGLQG 1300
    LQFYRLHREE RPNYRLECLQ WLKSQPRWPS WGWNQVSCPC SWQQGRRDLR 1350
    FQPVSIGRWG LGSRQLCSFT SWRGGVCCSY GPWGEFREGW HVQRPWQLAQ 1400
    ELEPQSWCCR WNDKPYLCAL YQQRRPHVGC ATYRPPQPAW MFGDPHITTL 1450
    DGVSYTFNGL GDFLLVGAQD GNSSFLLQGR TAQTGSAQAT NFIAFAAQYR 1500
    SSSLGPVTVQ WLLEPHDAIR VLLDNQTVTF QPDHEDGGGQ ETFNATGVLL 1550
    SRNGSEVSAS FDGWATVSVI ALSNILHASA SLPPEYQNRT EGLLGVWNNN 1600
    PEDDFRMPNG STIPPGSPEE MLFHFGMTWQ INGTGLLGKR NDQLPSNFTP 1650
    VFYSQLQKNS SWAEHLISNC DGDSSCIYDT LALRNASIGL HTREVSKNYE 1700
    QANATLNQYP PSINGGRVIE AYKGQTTLIQ YTSNAEDANF TLRDSCTDLE 1750
    LFENGTLLWT PKSLEPFTLE ILARSAKIGL ASALQPRTVV CHCNAESQCL 1800
    YNQTSRVGNS SLEVAGCKCD GGTFGRYCEG SEDACEEPCF PSVHCVPGKG 1850
    CEACPPNLTG DGRHCAALGS SFLCQNQSCP VNYCYNQGHC YISQTLGCQP 1900
    MCTCPPAFTD SRCFLAGNNF SPTVNLELPL RVIQLLLSEE ENASMAEVNA 1950
    SVAYRLGTLD MRAFLRNSQV ERIDSAAPAS GSPIQHWMVI SEFQYRPRGP 2000
    VIDFLNNQLL AAVVEAFLYH VPRRSEEPRN DVVFQPISGE DVRDVTALNV 2050
    STLKAYFRCD GYKGYDLVYS PQSGFTCVSP CSRGYCDHGG QCQHLPSGPR 2100
    CSCVSFSIYT AWGEHCEHLS MKLDAFFGIF FGALGGLLLL GVGTFVVLRF 2150
    WGCSGARFSY FLNSAEALP 2169
    Length:2,169
    Mass (Da):231,518
    Last modified:June 28, 2011 - v4
    Checksum:i53615AF8DD416957
    GO
    Isoform 2 (identifier: Q99102-2) [UniParc]FASTAAdd to Basket

    Also known as: Sv12, Sv13

    The sequence of this isoform differs from the canonical sequence as follows:
         1117-1157: FTDNGQIIFP...PVALVAPFWD → ASQAGTLWPW...TRRSMVNTAC
         1158-2169: Missing.

    Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.

    Show »
    Length:1,157
    Mass (Da):118,842
    Checksum:i563F538E94C8D17F
    GO
    Isoform 3 (identifier: Q99102-3) [UniParc]FASTAAdd to Basket

    Also known as: Sv20

    The sequence of this isoform differs from the canonical sequence as follows:
         1814-1827: VAGCKCDGGTFGRY → LWGALSCVRTSPAL
         1828-2169: Missing.

    Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.

    Show »
    Length:1,827
    Mass (Da):194,147
    Checksum:i7C0F057C7FFD9B61
    GO
    Isoform 5 (identifier: Q99102-5) [UniParc]FASTAAdd to Basket

    Also known as: Sv18, Sv19

    The sequence of this isoform differs from the canonical sequence as follows:
         1172-1223: Missing.
         1258-1267: GNPVLMGFSS → VEMAFSKTAH
         1268-2169: Missing.

    Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.

    Show »
    Length:1,215
    Mass (Da):125,352
    Checksum:i6394DD971A6AC6AA
    GO
    Isoform 7 (identifier: Q99102-7) [UniParc]FASTAAdd to Basket

    Also known as: Sv16

    The sequence of this isoform differs from the canonical sequence as follows:
         1117-1201: FTDNGQIIFP...RKMTNNGGYK → ASQAGTLWPW...VPASVGEVSP
         1202-2169: Missing.

    Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.

    Show »
    Length:1,201
    Mass (Da):123,420
    Checksum:i90CCFA911DF8A6DC
    GO
    Isoform 8 (identifier: Q99102-8) [UniParc]FASTAAdd to Basket

    Also known as: Sv15

    The sequence of this isoform differs from the canonical sequence as follows:
         1117-1199: FTDNGQIIFP...WIRKMTNNGG → ASQAGTLWPW...VEMAFSKTAH
         1200-2169: Missing.

    Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.

    Show »
    Length:1,199
    Mass (Da):123,047
    Checksum:iC297274BF47EE49E
    GO
    Isoform 9 (identifier: Q99102-9) [UniParc]FASTAAdd to Basket

    Also known as: Sv11

    The sequence of this isoform differs from the canonical sequence as follows:
         1071-1107: RGVSLFPYGAGAGDLEFVRRTVDFTSPLFKPATGFPL → SPLWGRRRGPGVRQEDRGLHLPTLQAGDWLPP
         1108-2169: Missing.

    Note: Dubious isoform produced through aberrant splice sites.

    Show »
    Length:1,102
    Mass (Da):112,954
    Checksum:iA533603C2182BFD7
    GO
    Isoform 10 (identifier: Q99102-10) [UniParc]FASTAAdd to Basket

    Also known as: Sv3, Sv17

    The sequence of this isoform differs from the canonical sequence as follows:
         1172-1223: Missing.

    Show »
    Length:2,117
    Mass (Da):225,434
    Checksum:i6A59FC9B7497C05F
    GO
    Isoform 11 (identifier: Q99102-11) [UniParc]FASTAAdd to Basket

    Also known as: Sv2

    The sequence of this isoform differs from the canonical sequence as follows:
         1073-1187: VSLFPYGAGA...GEHSLLVQQA → EAIQEFPSSP...TRRSMVNTAC
         1188-2169: Missing.

    Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.

    Show »
    Length:1,187
    Mass (Da):121,900
    Checksum:i79896412E450E46B
    GO
    Isoform 12 (identifier: Q99102-12) [UniParc]FASTAAdd to Basket

    Also known as: SvX

    The sequence of this isoform differs from the canonical sequence as follows:
         29-1072: Missing.

    Note: May be preferentially expressed in tumor tissues.

    Show »
    Length:1,125
    Mass (Da):125,130
    Checksum:iD1750D4908B75B6D
    GO
    Isoform 13 (identifier: Q99102-13) [UniParc]FASTAAdd to Basket

    Also known as: SvY

    The sequence of this isoform differs from the canonical sequence as follows:
         29-1021: Missing.

    Note: May be preferentially expressed in tumor tissues.

    Show »
    Length:1,176
    Mass (Da):130,415
    Checksum:i92B845E20A242187
    GO
    Isoform 15 (identifier: Q99102-15) [UniParc]FASTAAdd to Basket

    Also known as: Sv1

    The sequence of this isoform differs from the canonical sequence as follows:
         1073-1177: VSLFPYGAGA...TFYQEYETFY → AIQEFPSSPM...LVGGPHFIRL
         1178-2169: Missing.

    Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.

    Show »
    Length:1,176
    Mass (Da):120,650
    Checksum:i922532E6C031907A
    GO
    Isoform 16 (identifier: Q99102-16) [UniParc]FASTAAdd to Basket

    Also known as: Sv6

    The sequence of this isoform differs from the canonical sequence as follows:
         1336-1384: VSCPCSWQQG...GVCCSYGPWG → AAPPRLAQPR...QSVSCWITRL
         1385-2169: Missing.

    Note: Dubious isoform produced through aberrant splice sites.

    Show »
    Length:1,384
    Mass (Da):144,847
    Checksum:i24DAF864CC4008DD
    GO
    Isoform 17 (identifier: Q99102-17) [UniParc]FASTAAdd to Basket

    Also known as: Sv8

    The sequence of this isoform differs from the canonical sequence as follows:
         1354-1579: Missing.

    Note: Dubious isoform produced through aberrant splice sites.

    Show »
    Length:1,943
    Mass (Da):206,605
    Checksum:i8AB442BDDA613D41
    GO

    Sequence cautioni

    The sequence AAA63230.1 differs from that shown. Reason: May be derived from an intron translation.
    The sequence CAC14139.1 differs from that shown. Reason: Frameshift at position 1171.
    The sequence CAC14141.1 differs from that shown. Reason: Frameshift at position 1256.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti1194 – 11941M → I in CAB85602. (PubMed:10880978)Curated
    Sequence conflicti1194 – 11941M → I in CAB85603. (PubMed:10880978)Curated
    Sequence conflicti1194 – 11941M → I in CAB85604. (PubMed:10880978)Curated
    Sequence conflicti1194 – 11941M → I in CAB85605. (PubMed:10880978)Curated
    Sequence conflicti1194 – 11941M → I in CAB85606. (PubMed:10880978)Curated
    Sequence conflicti1194 – 11941M → I in CAB81773. (PubMed:10920259)Curated
    Sequence conflicti1194 – 11941M → I in CAC14141. (PubMed:10920259)Curated
    Sequence conflicti1194 – 11941M → I in CAC14142. (PubMed:10920259)Curated
    Sequence conflicti1194 – 11941M → I in CAC14143. (PubMed:10920259)Curated
    Sequence conflicti1194 – 11941M → I in AAM66747. (PubMed:12084055)Curated
    Sequence conflicti1194 – 11941M → I in CAD22550. (PubMed:10024507)Curated
    Sequence conflicti1194 – 11941M → I in CAB38059. (PubMed:12153560)Curated
    Sequence conflicti1259 – 12591N → K in CAB81773. (PubMed:10920259)Curated
    Sequence conflicti1259 – 12591N → K in CAC14143. (PubMed:10920259)Curated
    Sequence conflicti1259 – 12591N → K in CAC10061. (PubMed:10920259)Curated
    Sequence conflicti1259 – 12591N → K in AAM66747. (PubMed:12084055)Curated
    Sequence conflicti1271 – 12711Y → F in CAB81773. (PubMed:10920259)Curated
    Sequence conflicti1271 – 12711Y → F in CAC14143. (PubMed:10920259)Curated
    Sequence conflicti1271 – 12711Y → F in CAC10061. (PubMed:10920259)Curated
    Sequence conflicti1271 – 12711Y → F in AAM66747. (PubMed:12084055)Curated
    Sequence conflicti1305 – 13051R → G in CAB81773. (PubMed:10920259)Curated
    Sequence conflicti1305 – 13051R → G in CAC14143. (PubMed:10920259)Curated
    Sequence conflicti1305 – 13051R → G in CAC10061. (PubMed:10920259)Curated
    Sequence conflicti1305 – 13051R → G in AAM66747. (PubMed:12084055)Curated
    Sequence conflicti1557 – 15571V → A in CAB81773. (PubMed:10920259)Curated
    Sequence conflicti1557 – 15571V → A in CAC14143. (PubMed:10920259)Curated
    Sequence conflicti1557 – 15571V → A in CAC10061. (PubMed:10920259)Curated
    Sequence conflicti1557 – 15571V → A in AAM66747. (PubMed:12084055)Curated
    Sequence conflicti1920 – 19212Missing in CAC14143. (PubMed:10920259)Curated
    Sequence conflicti2039 – 20391G → E in CAB85604. (PubMed:10880978)Curated
    Sequence conflicti2039 – 20391G → E in CAB85605. (PubMed:10880978)Curated
    Sequence conflicti2039 – 20391G → E in CAB85606. (PubMed:10880978)Curated
    Sequence conflicti2039 – 20391G → E in CAD22550. (PubMed:10024507)Curated
    Sequence conflicti2039 – 20391G → E in CAB38059. (PubMed:12153560)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti37 – 371G → D.
    Corresponds to variant rs2259292 [ dbSNP | Ensembl ].
    VAR_030211
    Natural varianti41 – 411A → P.2 Publications
    Corresponds to variant rs3107764 [ dbSNP | Ensembl ].
    VAR_065261
    Natural varianti161 – 1611T → A.
    Corresponds to variant rs2293232 [ dbSNP | Ensembl ].
    VAR_030212
    Natural varianti585 – 5851S → A.
    Corresponds to variant rs2246901 [ dbSNP | Ensembl ].
    VAR_030213
    Natural varianti721 – 7211A → T.
    Corresponds to variant rs3749331 [ dbSNP | Ensembl ].
    VAR_056585
    Natural varianti1081 – 10811G → D.5 Publications
    Corresponds to variant rs2259292 [ dbSNP | Ensembl ].
    VAR_065262
    Natural varianti1205 – 12051A → T.
    Corresponds to variant rs2293232 [ dbSNP | Ensembl ].
    VAR_056586
    Natural varianti1578 – 15781A → S.1 Publication
    Corresponds to variant rs2246901 [ dbSNP | Ensembl ].
    VAR_056587

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei29 – 10721044Missing in isoform 12. 1 PublicationVSP_022650Add
    BLAST
    Alternative sequencei29 – 1021993Missing in isoform 13. 1 PublicationVSP_022651Add
    BLAST
    Alternative sequencei1071 – 110737RGVSL…TGFPL → SPLWGRRRGPGVRQEDRGLH LPTLQAGDWLPP in isoform 9. 1 PublicationVSP_022652Add
    BLAST
    Alternative sequencei1073 – 1187115VSLFP…LVQQA → EAIQEFPSSPMGQTPGTWSS SGGPWTSPPHSSSRRLASPL APLSVIPSTSQTMARSSSQS QTTRFSPTPTHSQQASQAGT LWPWWLRSGTMLTSPLVGGP HFIRNTRRSMVNTAC in isoform 11. 1 PublicationVSP_022653Add
    BLAST
    Alternative sequencei1073 – 1177105VSLFP…YETFY → AIQEFPSSPMGQTPGTWSSS GGPWTSPPHSSSRRLASPLA PLSVIPSTSQTMARSSSQSQ TTRFSPTPTHSQQASQAGTL WPWWLRSGTMLTSPLVGGPH FIRL in isoform 15. CuratedVSP_022654Add
    BLAST
    Alternative sequencei1108 – 21691062Missing in isoform 9. 1 PublicationVSP_022655Add
    BLAST
    Alternative sequencei1117 – 120185FTDNG…NGGYK → ASQAGTLWPWWLRSGTMLTS PLVGGPHFIRATPTKPSSPR TGAGPMPCFSTRAVGCSGTW PSAQWRWLFRKQPTDVPASV GEVSP in isoform 7. 1 PublicationVSP_022656Add
    BLAST
    Alternative sequencei1117 – 119983FTDNG…TNNGG → ASQAGTLWPWWLRSGTMLTS PLVGGPHFIRATPTKPSSPR TGAGPMPCFSTRAVGCSGTW PSAQASRCSWASLVEMAFSK TAH in isoform 8. 1 PublicationVSP_022657Add
    BLAST
    Alternative sequencei1117 – 115741FTDNG…APFWD → ASQAGTLWPWWLRSGTMLTS PLVGGPHFIRNTRRSMVNTA C in isoform 2. 1 PublicationVSP_022658Add
    BLAST
    Alternative sequencei1158 – 21691012Missing in isoform 2. 1 PublicationVSP_022659Add
    BLAST
    Alternative sequencei1172 – 122352Missing in isoform 5 and isoform 10. 1 PublicationVSP_022661Add
    BLAST
    Alternative sequencei1178 – 2169992Missing in isoform 15. CuratedVSP_022662Add
    BLAST
    Alternative sequencei1188 – 2169982Missing in isoform 11. 1 PublicationVSP_022663Add
    BLAST
    Alternative sequencei1200 – 2169970Missing in isoform 8. 1 PublicationVSP_022664Add
    BLAST
    Alternative sequencei1202 – 2169968Missing in isoform 7. 1 PublicationVSP_022665Add
    BLAST
    Alternative sequencei1258 – 126710GNPVLMGFSS → VEMAFSKTAH in isoform 5. 1 PublicationVSP_022669
    Alternative sequencei1268 – 2169902Missing in isoform 5. 1 PublicationVSP_022670Add
    BLAST
    Alternative sequencei1336 – 138449VSCPC…YGPWG → AAPPRLAQPRPPTSSPLRLS TAPAAWAPSRSNGSLSLTTQ SVSCWITRL in isoform 16. CuratedVSP_022671Add
    BLAST
    Alternative sequencei1354 – 1579226Missing in isoform 17. CuratedVSP_022672Add
    BLAST
    Alternative sequencei1385 – 2169785Missing in isoform 16. CuratedVSP_022673Add
    BLAST
    Alternative sequencei1814 – 182714VAGCK…TFGRY → LWGALSCVRTSPAL in isoform 3. 1 PublicationVSP_022674Add
    BLAST
    Alternative sequencei1828 – 2169342Missing in isoform 3. 1 PublicationVSP_022675Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AJ242541 mRNA. Translation: CAB85597.1.
    AJ242542 mRNA. Translation: CAB85598.1.
    AJ242543 mRNA. Translation: CAB85599.1.
    AJ242544 mRNA. Translation: CAB85600.1.
    AJ242545 mRNA. Translation: CAB85601.1.
    AJ242546 mRNA. Translation: CAB85602.1.
    AJ242547 mRNA. Translation: CAB85603.1.
    AJ242548 mRNA. Translation: CAB85604.1.
    AJ242549 mRNA. Translation: CAB85605.1.
    AJ242550 mRNA. Translation: CAB85606.1.
    AJ276359 mRNA. Translation: CAB81773.1.
    AJ277412 mRNA. Translation: CAC10061.1.
    AJ277505 mRNA. Translation: CAC14585.1.
    AJ400633 mRNA. Translation: CAC10062.1.
    AJ400849 mRNA. Translation: CAC14134.1.
    AJ400850 mRNA. Translation: CAC14135.1.
    AJ400851 mRNA. Translation: CAC14136.1.
    AJ400852 mRNA. Translation: CAC14137.1.
    AJ400855 mRNA. Translation: CAC14140.1.
    AJ400853 mRNA. Translation: CAC14138.1.
    AJ400854 mRNA. Translation: CAC14139.1. Frameshift.
    AJ400856 mRNA. Translation: CAC14141.1. Frameshift.
    AJ400857 mRNA. Translation: CAC14142.1.
    AJ400858 mRNA. Translation: CAC14143.1.
    AF522055
    , AF522031, AF522032, AF522033, AF522034, AF522035, AF522036, AF522037, AF522038, AF522039, AF522040, AF522041, AF522042, AF522043, AF522044, AF522045, AF522046, AF522047, AF522048, AF522049, AF522050, AF522051, AF522052, AF522053, AF522054 Genomic DNA. Translation: AAM66747.1.
    AJ010901 mRNA. Translation: CAB38059.1.
    AJ430032, AJ430033, AJ430034 Genomic DNA. Translation: CAD22550.1.
    M64594 mRNA. Translation: AAA63230.1. Sequence problems.
    AC069513 Genomic DNA. No translation available.
    AC233280 Genomic DNA. No translation available.
    CCDSiCCDS3310.1. [Q99102-13]
    CCDS3311.1. [Q99102-12]
    PIRiPN0012.
    RefSeqiNP_004523.3. NM_004532.5. [Q99102-13]
    NP_060876.5. NM_018406.6.
    NP_612154.2. NM_138297.4. [Q99102-12]
    UniGeneiHs.369646.

    Genome annotation databases

    EnsembliENST00000346145; ENSP00000304207; ENSG00000145113. [Q99102-13]
    ENST00000349607; ENSP00000338109; ENSG00000145113. [Q99102-12]
    GeneIDi4585.
    KEGGihsa:4585.
    UCSCiuc003fuz.3. human. [Q99102-12]
    uc003fvo.3. human. [Q99102-13]
    uc021xjn.1. human. [Q99102-10]

    Polymorphism databases

    DMDMi338817990.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Web resourcesi

    Mucin database
    Atlas of Genetics and Cytogenetics in Oncology and Haematology

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AJ242541 mRNA. Translation: CAB85597.1 .
    AJ242542 mRNA. Translation: CAB85598.1 .
    AJ242543 mRNA. Translation: CAB85599.1 .
    AJ242544 mRNA. Translation: CAB85600.1 .
    AJ242545 mRNA. Translation: CAB85601.1 .
    AJ242546 mRNA. Translation: CAB85602.1 .
    AJ242547 mRNA. Translation: CAB85603.1 .
    AJ242548 mRNA. Translation: CAB85604.1 .
    AJ242549 mRNA. Translation: CAB85605.1 .
    AJ242550 mRNA. Translation: CAB85606.1 .
    AJ276359 mRNA. Translation: CAB81773.1 .
    AJ277412 mRNA. Translation: CAC10061.1 .
    AJ277505 mRNA. Translation: CAC14585.1 .
    AJ400633 mRNA. Translation: CAC10062.1 .
    AJ400849 mRNA. Translation: CAC14134.1 .
    AJ400850 mRNA. Translation: CAC14135.1 .
    AJ400851 mRNA. Translation: CAC14136.1 .
    AJ400852 mRNA. Translation: CAC14137.1 .
    AJ400855 mRNA. Translation: CAC14140.1 .
    AJ400853 mRNA. Translation: CAC14138.1 .
    AJ400854 mRNA. Translation: CAC14139.1 . Frameshift.
    AJ400856 mRNA. Translation: CAC14141.1 . Frameshift.
    AJ400857 mRNA. Translation: CAC14142.1 .
    AJ400858 mRNA. Translation: CAC14143.1 .
    AF522055
    , AF522031 , AF522032 , AF522033 , AF522034 , AF522035 , AF522036 , AF522037 , AF522038 , AF522039 , AF522040 , AF522041 , AF522042 , AF522043 , AF522044 , AF522045 , AF522046 , AF522047 , AF522048 , AF522049 , AF522050 , AF522051 , AF522052 , AF522053 , AF522054 Genomic DNA. Translation: AAM66747.1 .
    AJ010901 mRNA. Translation: CAB38059.1 .
    AJ430032 , AJ430033 , AJ430034 Genomic DNA. Translation: CAD22550.1 .
    M64594 mRNA. Translation: AAA63230.1 . Sequence problems.
    AC069513 Genomic DNA. No translation available.
    AC233280 Genomic DNA. No translation available.
    CCDSi CCDS3310.1. [Q99102-13 ]
    CCDS3311.1. [Q99102-12 ]
    PIRi PN0012.
    RefSeqi NP_004523.3. NM_004532.5. [Q99102-13 ]
    NP_060876.5. NM_018406.6.
    NP_612154.2. NM_138297.4. [Q99102-12 ]
    UniGenei Hs.369646.

    3D structure databases

    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 110672. 1 interaction.
    IntActi Q99102. 1 interaction.

    PTM databases

    PhosphoSitei Q99102.
    UniCarbKBi Q99102.

    Polymorphism databases

    DMDMi 338817990.

    Proteomic databases

    MaxQBi Q99102.
    PaxDbi Q99102.
    PRIDEi Q99102.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000346145 ; ENSP00000304207 ; ENSG00000145113 . [Q99102-13 ]
    ENST00000349607 ; ENSP00000338109 ; ENSG00000145113 . [Q99102-12 ]
    GeneIDi 4585.
    KEGGi hsa:4585.
    UCSCi uc003fuz.3. human. [Q99102-12 ]
    uc003fvo.3. human. [Q99102-13 ]
    uc021xjn.1. human. [Q99102-10 ]

    Organism-specific databases

    CTDi 4585.
    GeneCardsi GC03M195473.
    H-InvDB HIX0003957.
    HIX0163449.
    HGNCi HGNC:7514. MUC4.
    HPAi CAB013536.
    HPA005895.
    MIMi 158372. gene.
    neXtProti NX_Q99102.
    PharmGKBi PA31319.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG12793.
    HOVERGENi HBG081997.

    Enzyme and pathway databases

    Reactomei REACT_115606. O-linked glycosylation of mucins.
    REACT_115835. Termination of O-glycan biosynthesis.

    Miscellaneous databases

    ChiTaRSi MUC4. human.
    GeneWikii MUC4.
    GenomeRNAii 4585.
    NextBioi 17619.
    PROi Q99102.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q99102.
    Bgeei Q99102.
    Genevestigatori Q99102.

    Family and domain databases

    InterProi IPR005533. AMOP.
    IPR000742. EG-like_dom.
    IPR003886. Nidogen_extracell_dom.
    IPR001846. VWF_type-D.
    [Graphical view ]
    Pfami PF03782. AMOP. 1 hit.
    PF06119. NIDO. 1 hit.
    PF00094. VWD. 1 hit.
    [Graphical view ]
    SMARTi SM00181. EGF. 1 hit.
    SM00539. NIDO. 1 hit.
    SM00216. VWD. 1 hit.
    [Graphical view ]
    PROSITEi PS50856. AMOP. 1 hit.
    PS00022. EGF_1. 1 hit.
    PS50026. EGF_3. 2 hits.
    PS51220. NIDO. 1 hit.
    PS51233. VWFD. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Alternative splicing generates a family of putative secreted and membrane-associated MUC4 mucins."
      Moniaux N., Escande F., Batra S.K., Porchet N., Laine A., Aubert J.-P.
      Eur. J. Biochem. 267:4536-4544(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 12 AND 13), PARTIAL NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2; 3; 11; 15; 16 AND 17), TISSUE SPECIFICITY, VARIANT ASP-1081.
      Tissue: Lung and Testis.
    2. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3; 5; 7; 8; 9; 10 AND 11), TISSUE SPECIFICITY, VARIANTS PRO-41 AND ASP-1081.
      Tissue: Pancreatic tumor.
    3. "Cloning, chromosomal localization and characterization of the murine mucin gene orthologous to human MUC4."
      Desseyn J.-L., Clavereau I., Laine A.
      Eur. J. Biochem. 269:3150-3159(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS PRO-41; ASP-1081 AND SER-1578.
    4. "Complete sequence of the human mucin MUC4: a putative cell membrane-associated mucin."
      Moniaux N., Nollet S., Porchet N., Degand P., Laine A., Aubert J.-P.
      Biochem. J. 338:325-333(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1014-2169 (ISOFORM 1), TISSUE SPECIFICITY, VARIANT ASP-1081.
      Tissue: Colon mucosa.
    5. "Genomic organization of MUC4 mucin gene: towards the characterization of splice variants."
      Escande F., Lemaitre L., Moniaux N., Batra S.K., Aubert J.-P., Buisine M.P.
      Eur. J. Biochem. 269:3637-3644(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1014-2169, VARIANT ASP-1081.
    6. "Molecular cloning and chromosomal localization of a novel human tracheo-bronchial mucin cDNA containing tandemly repeated sequences of 48 base pairs."
      Porchet N., van Cong N., Dufosse J., Audie J.P., Guyonnet-Duperat V., Gross M.S., Denis C., Degand P., Bernheim A., Aubert J.-P.
      Biochem. Biophys. Res. Commun. 175:414-422(1991) [PubMed] [Europe PMC] [Abstract]
      Cited for: PRELIMINARY PARTIAL NUCLEOTIDE SEQUENCE [MRNA].
    7. "The DNA sequence, annotation and analysis of human chromosome 3."
      Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J.
      , Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R., Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Wei S., Wheeler D.A., Wright M.W., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clendenning J., Clerc-Blankenburg K.P., Chen R., Chen Z., Davis C., Delgado O., Dinh H.H., Dong W., Draper H., Ernst S., Fu G., Gonzalez-Garay M.L., Garcia D.K., Gillett W., Gu J., Hao B., Haugen E., Havlak P., He X., Hennig S., Hu S., Huang W., Jackson L.R., Jacob L.S., Kelly S.H., Kube M., Levy R., Li Z., Liu B., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Palmeiri A., Pasternak S., Perez L.M., Phelps K.A., Plopper F.J., Qiang B., Raymond C., Rodriguez R., Saenphimmachak C., Santibanez J., Shen H., Shen Y., Subramanian S., Tabor P.E., Verduzco D., Waldron L., Wang J., Wang J., Wang Q., Williams G.A., Wong G.K.-S., Yao Z., Zhang J., Zhang X., Zhao G., Zhou J., Zhou Y., Nelson D., Lehrach H., Reinhardt R., Naylor S.L., Yang H., Olson M., Weinstock G., Gibbs R.A.
      Nature 440:1194-1198(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    8. "Muc4/sialomucin complex, the intramembrane ErbB2 ligand, in cancer and epithelia: to protect and to survive."
      Carraway K.L., Perez A., Idris N., Jepson S., Arango M.E., Komatsu M., Haq B., Price-Schiavi S.A., Zhang J., Carraway C.A.
      Prog. Nucleic Acid Res. Mol. Biol. 71:149-185(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, SUBCELLULAR LOCATION.
    9. "MUC4 expression is a novel prognostic factor in patients with invasive ductal carcinoma of the pancreas."
      Saitou M., Goto M., Horinouchi M., Tamada S., Nagata K., Hamada T., Osako M., Takao S., Batra S.K., Aikou T., Imai K., Yonezawa S.
      J. Clin. Pathol. 58:845-852(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION.
    10. "MUC4 expression and its relation to ErbB2 expression, apoptosis, proliferation, differentiation, and tumor stage in non-small cell lung cancer (NSCLC)."
      Karg A., Dinc Z.A., Basok O., Ucvet A.
      Pathol. Res. Pract. 202:577-583(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: TISSUE SPECIFICITY, FUNCTION.
    11. "MUC4 expression and localization in gastrointestinal tract and skin of human embryos."
      Zhang J., Yasin M., Carraway C.A., Carraway K.L.
      Tissue Cell 38:271-275(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: DEVELOPMENTAL STAGE, FUNCTION.
    12. "Identification of N-linked glycoproteins in human milk by hydrophilic interaction liquid chromatography and mass spectrometry."
      Picariello G., Ferranti P., Mamone G., Roepstorff P., Addeo F.
      Proteomics 8:3833-3847(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-1809.
      Tissue: Milk.

    Entry informationi

    Entry nameiMUC4_HUMAN
    AccessioniPrimary (citable) accession number: Q99102
    Secondary accession number(s): O95938
    , Q9GZM2, Q9GZV6, Q9H481, Q9H482, Q9H483, Q9H484, Q9H485, Q9H486, Q9H487, Q9H4D6, Q9H4D8, Q9NPJ0, Q9NY09, Q9NY75, Q9NY76, Q9NY77, Q9NY78, Q9NY79, Q9NY80, Q9NY81
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: June 1, 1994
    Last sequence update: June 28, 2011
    Last modified: October 1, 2014
    This is version 119 of the entry and version 4 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Miscellaneous

    Expression is a very useful predictor of poor prognosis in patients with invasive ductal carcinoma and intrahepatic cholangiocarcinoma, mass forming type (IDC,ICC-MF). Patients with IDC or ICC-MF who have high MUC4 expression had a worse survival rate than those with low MUC4 expression.

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 3
      Human chromosome 3: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3