Q99062 (CSF3R_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 130.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Granulocyte colony-stimulating factor receptor Short name=G-CSF receptor Short name=G-CSF-R Alternative name(s): CD_antigen=CD114 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 836 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Receptor for granulocyte colony-stimulating factor (CSF3), essential for granulocytic maturation. Plays a crucial role in the proliferation, differientation and survival of cells along the neutrophilic lineage. In addition it may function in some adhesion or recognition events at the cell surface. Ref.8 |
| Subunit structure | Homodimer. The dimeric receptor binds two CSF3 molecules. Ref.13 |
| Subcellular location | |
| Tissue specificity | One or several isoforms have been found in myelogenous leukemia cell line KG-1, leukemia U937 cell line, in bone marrow cells, placenta, and peripheral blood granulocytes. Isoform GCSFR-2 is found only in leukemia U937 cells. Isoform GSCFR-3 is highly expressed in placenta. |
| Domain | The WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding. Ref.7 The box 1 motif is required for JAK interaction and/or activation. Ref.7 |
| Involvement in disease | Defects in CSF3R are the cause of hereditary neutrophilia (NEUTROPHILIA) [MIM:162830]. A form of lifelong, persistent neutrophilia, a condition characterized by an increase in the number of neutrophils in the blood. Ref.15 |
| Miscellaneous | Mutations in CSF3R acquired in multipotent hematopoietic progenitor cells and resulting in truncated hyper-responsive forms of the receptor, have been identified in most cases of severe congenital neutropenia (SCN). Patients carrying these mutations are at risk for developing myelodysplastic syndromes and/or acute myeloid leukemia. Constitutive mutations leading to hyporesponsive forms of the receptor are responsible for the refractoriness to CSF3 treatement observed in some SCN patients. |
| Sequence similarities | Belongs to the type I cytokine receptor family. Type 2 subfamily. Contains 5 fibronectin type-III domains. Contains 1 Ig-like C2-type (immunoglobulin-like) domain. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Cell adhesion |
| Cellular component | Cell membrane Membrane Secreted |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Disease | Disease mutation |
| Domain | Immunoglobulin domain Repeat Signal Transmembrane Transmembrane helix |
| Molecular function | Receptor |
| PTM | Disulfide bond Glycoprotein |
| Technical term | 3D-structure Complete proteome Direct protein sequencing Reference proteome |
| Gene Ontology (GO) | |
| Biological process | cell adhesion Inferred from electronic annotation. Source: UniProtKB-KW defense responseTraceable author statement. Source: ProtInc |
| Cellular component | extracellular region Inferred from electronic annotation. Source: UniProtKB-SubCell integral to plasma membraneTraceable author statement. Source: ProtInc |
| Molecular function | cytokine receptor activity Inferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] Note: Additional isoforms seem to exist. Experimental confirmation may be lacking for some isoforms. | ||||||
| Isoform 1 (identifier: Q99062-1) Also known as: GCSFR-1; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q99062-2) Also known as: GCSFR-2; The sequence of this isoform differs from the canonical sequence as follows: 622-836: EGSELHIILG...VHGMEALGSF → APTGRIPSGQ...GSRPAPWGPW | ||||||
| Isoform 3 (identifier: Q99062-3) Also known as: GCSFR-3; The sequence of this isoform differs from the canonical sequence as follows: 680-680: E → ELPGPRQGQWLGQTSEMSRALTPHPCVQ | ||||||
| Isoform 4 (identifier: Q99062-4) Also known as: GCSFR-4; D7; The sequence of this isoform differs from the canonical sequence as follows: 750-783: VLYGQLLGSPTSPGPGHYLRCDSTQPLLAGLTPS → AGPPRRSAYFKDQIMLHPAPPNGLLCLFPITSVL 784-836: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 24 | 24 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Chain | 25 – 836 | 812 | Granulocyte colony-stimulating factor receptor | PRO_0000010874 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Topological domain | 25 – 627 | 603 | Extracellular Potential | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Transmembrane | 628 – 650 | 23 | Helical; Potential | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Topological domain | 651 – 836 | 186 | Cytoplasmic Potential | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 25 – 117 | 93 | Ig-like C2-type | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 122 – 222 | 101 | Fibronectin type-III 1 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 237 – 330 | 94 | Fibronectin type-III 2 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 334 – 426 | 93 | Fibronectin type-III 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 430 – 522 | 93 | Fibronectin type-III 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 527 – 618 | 92 | Fibronectin type-III 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Motif | 318 – 322 | 5 | WSXWS motif | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Motif | 658 – 666 | 9 | Box 1 motif | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 51 | 1 | N-linked (GlcNAc...) Potential | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 93 | 1 | N-linked (GlcNAc...) Potential | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 128 | 1 | N-linked (GlcNAc...) Potential | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 134 | 1 | N-linked (GlcNAc...) Ref.13 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 389 | 1 | N-linked (GlcNAc...) Potential | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 474 | 1 | N-linked (GlcNAc...) Potential | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 579 | 1 | N-linked (GlcNAc...) Potential | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 610 | 1 | N-linked (GlcNAc...) Potential | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 26 ↔ 52 | Ref.13 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 46 ↔ 101 | Ref.13 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 131 ↔ 142 | Ref.13 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 167 ↔ 218 | Ref.13 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 177 ↔ 186 | Ref.13 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 248 ↔ 295 | Ref.13 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 266 ↔ 309 | Ref.13 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 622 – 836 | 215 | EGSEL…ALGSF → APTGRIPSGQVSQTQLTAAW APGCPQSWRRMPSSCPALAR HPSPSSQCWRRMKRSRCPGS PITAQRPVASPLWSRPMCSR GTQEQFPPSPNPSLAPAIRS FMGSCWAAPQAQGQGTISAV TPLSPSWRASPPAPSPMRTS GSRPAPWGPW in isoform 2. | VSP_001674 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 680 | 1 | E → ELPGPRQGQWLGQTSEMSRA LTPHPCVQ in isoform 3. | VSP_001673 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 750 – 783 | 34 | VLYGQ…GLTPS → AGPPRRSAYFKDQIMLHPAP PNGLLCLFPITSVL in isoform 4. | VSP_001671 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 784 – 836 | 53 | Missing in isoform 4. | VSP_001672 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 229 | 1 | P → H in a patient with severe congenital neutropenia hyporesponsive to CSF3 treatment; affects CSF3 mediated proliferation and survival of myeloid cells; abrogates receptor signaling by altering ligand binding. Ref.14 | VAR_062517 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 231 | 1 | M → T. Ref.4 Corresponds to variant rs3917973 [ dbSNP | Ensembl ]. | VAR_014325 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 320 | 1 | D → N. Ref.4 Corresponds to variant rs3918018 [ dbSNP | Ensembl ]. | VAR_014326 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 346 | 1 | Q → R. Ref.4 Corresponds to variant rs3917974 [ dbSNP | Ensembl ]. | VAR_014327 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 405 | 1 | E → K. Ref.4 Corresponds to variant rs3918019 [ dbSNP | Ensembl ]. | VAR_014328 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 440 | 1 | R → Q. Ref.4 Corresponds to variant rs3918020 [ dbSNP | Ensembl ]. | VAR_014329 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 510 | 1 | D → H. Ref.4 Corresponds to variant rs3917991 [ dbSNP | Ensembl ]. | VAR_014330 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 562 | 1 | Y → H. Ref.4 Corresponds to variant rs3917996 [ dbSNP | Ensembl ]. | VAR_014331 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 583 | 1 | R → C. Ref.4 Corresponds to variant rs3917997 [ dbSNP | Ensembl ]. | VAR_014332 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 640 | 1 | T → N in neutrophilia. Ref.15 | VAR_063065 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 29 – 32 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 34 – 36 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 42 – 46 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 62 – 67 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 79 – 81 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 85 – 90 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 94 – 119 | 26 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 127 – 134 | 8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 135 – 138 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 139 – 145 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 155 – 162 | 8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 174 – 177 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 184 – 189 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 190 – 192 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 195 – 197 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 199 – 207 | 9 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 210 – 213 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 217 – 219 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 221 – 224 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 231 – 234 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 249 – 254 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 257 – 259 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 264 – 275 | 12 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 280 – 285 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 289 – 294 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 303 – 311 | 9 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 325 – 327 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Expression cloning of a human granulocyte colony-stimulating factor receptor: a structural mosaic of hematopoietin receptor, immunoglobulin, and fibronectin domains." Larsen A., Davis T., Curtis B.M., Gimpel S., Sims J.E., Cosman D., Park L., Sorensen E., March C.J., Smith C.A. J. Exp. Med. 172:1559-1570(1990) [PubMed: 2147944] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 4). Tissue: Placenta. |
| [2] | "Three different mRNAs encoding human granulocyte colony-stimulating factor receptor." Fukunaga R., Seto Y., Mizushima S., Nagata S. Proc. Natl. Acad. Sci. U.S.A. 87:8702-8706(1990) [PubMed: 1701053] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2 AND 3). Tissue: Placenta. |
| [3] | "Chromosomal gene organization of the human granulocyte colony-stimulating factor receptor." Seto Y., Fukunaga R., Nagata S. J. Immunol. 148:259-266(1992) [PubMed: 1530796] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. |
| [4] | SeattleSNPs variation discovery resource Submitted (SEP-2002) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS THR-231; ASN-320; ARG-346; LYS-405; GLN-440; HIS-510; HIS-562 AND CYS-583. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Blood. |
| [6] | "Extracellular domain of granulocyte-colony stimulating factor receptor. Interaction with its ligand and identification of a domain in close proximity of ligand-binding region." Haniu M., Horan T., Arakawa T., Le J., Katta V., Rohde M.F. Arch. Biochem. Biophys. 324:344-356(1995) [PubMed: 8554326] [Abstract] Cited for: PROTEIN SEQUENCE OF 234-269. |
| [7] | "Functional domains of the granulocyte colony-stimulating factor receptor." Fukunaga R., Ishizaka-Ikeda E., Pan C.-X., Seto Y., Nagata S. EMBO J. 10:2855-2865(1991) [PubMed: 1717255] [Abstract] Cited for: DOMAINS. |
| [8] | "Identification of a nonsense mutation in the granulocyte-colony-stimulating factor receptor in severe congenital neutropenia." Dong F., Hoefsloot L.H., Schelen A.M., Broeders C.A., Meijer Y., Veerman A.J., Touw I.P., Lowenberg B. Proc. Natl. Acad. Sci. U.S.A. 91:4480-4484(1994) [PubMed: 7514305] [Abstract] Cited for: FUNCTION, POSSIBLE ASSOCIATION WITH SCN. |
| [9] | "Granulocyte colony-stimulating factor and its receptor in normal myeloid cell development, leukemia and related blood cell disorders." Touw I.P., van de Geijn G.J. Front. Biosci. 12:800-815(2007) [PubMed: 17127321] [Abstract] Cited for: REVIEW. |
| [10] | "Clinical implications of ELA2-, HAX1-, and G-CSF-receptor (CSF3R) mutations in severe congenital neutropenia." Zeidler C., Germeshausen M., Klein C., Welte K. Br. J. Haematol. 144:459-467(2009) [PubMed: 19120359] [Abstract] Cited for: POSSIBLE ASSOCIATION WITH SCN. |
| [11] | "Solution structure of an extracellular domain containing the WSxWS motif of the granulocyte colony-stimulating factor receptor and its interaction with ligand." Yamasaki K., Naito S., Anaguchi H., Ohkubo T., Ota Y. Nat. Struct. Biol. 4:498-504(1997) [PubMed: 9187659] [Abstract] Cited for: STRUCTURE BY NMR OF 227-334. |
| [12] | "Identification of a ligand-binding site on the granulocyte colony-stimulating factor receptor by molecular modeling and mutagenesis." Layton J.E., Iaria J., Smith D.K., Treutlein H.R. J. Biol. Chem. 272:29735-29741(1997) [PubMed: 9368043] [Abstract] Cited for: 3D-STRUCTURE MODELING OF 125-331. |
| [13] | "Homodimeric cross-over structure of the human granulocyte colony-stimulating factor (GCSF) receptor signaling complex." Tamada T., Honjo E., Maeda Y., Okamoto T., Ishibashi M., Tokunaga M., Kuroki R. Proc. Natl. Acad. Sci. U.S.A. 103:3135-3140(2006) [PubMed: 16492764] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.8 ANGSTROMS) OF 25-333 IN COMPLEX WITH CSF3, GLYCOSYLATION AT ASN-134, DISULFIDE BONDS, SUBUNIT. |
| [14] | "Novel point mutation in the extracellular domain of the granulocyte colony-stimulating factor (G-CSF) receptor in a case of severe congenital neutropenia hyporesponsive to G-CSF treatment." Ward A.C., van Aesch Y.M., Gits J., Schelen A.M., de Koning J.P., van Leeuwen D., Freedman M.H., Touw I.P. J. Exp. Med. 190:497-507(1999) [PubMed: 10449521] [Abstract] Cited for: VARIANT HIS-229, CHARACTERIZATION OF VARIANT HIS-229, POSSIBLE ASSOCIATION WITH SCN. |
| [15] | "An activating mutation in the CSF3R gene induces a hereditary chronic neutrophilia." Plo I., Zhang Y., Le Couedic J.P., Nakatake M., Boulet J.M., Itaya M., Smith S.O., Debili N., Constantinescu S.N., Vainchenker W., Louache F., de Botton S. J. Exp. Med. 206:1701-1707(2009) [PubMed: 19620628] [Abstract] Cited for: VARIANT NEUTROPHILIA ASN-640. |
| + | Additional computationally mapped references. |
Web resources
Cross-references
Sequence databases | |||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | X55721 mRNA. Translation: CAA39253.1. X55720 mRNA. Translation: CAA39252.1. M59818 mRNA. Translation: AAA63176.1. M59819 mRNA. Translation: AAA63177.1. M59820 mRNA. Translation: AAA63178.1. S71484 Genomic DNA. Translation: AAB20660.1. AY148100 Genomic DNA. Translation: AAN05790.1. BC053585 mRNA. Translation: AAH53585.1. | ||||||||||||||||||
| IPI | IPI00012936. IPI00216363. IPI00216365. IPI00216367. | ||||||||||||||||||
| PIR | B38252. C38252. JH0329. | ||||||||||||||||||
| RefSeq | NP_000751.1. NM_000760.3. NP_724781.1. NM_156039.3. NP_758519.1. NM_172313.2. | ||||||||||||||||||
| UniGene | Hs.524517. | ||||||||||||||||||
3D structure databases | |||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||
| ProteinModelPortal | Q99062. | ||||||||||||||||||
| SMR | Q99062. Positions 23-620. | ||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||
| DIP | DIP-5788N. | ||||||||||||||||||
| MINT | MINT-4787360. | ||||||||||||||||||
| STRING | Q99062. | ||||||||||||||||||
PTM databases | |||||||||||||||||||
| PhosphoSite | Q99062. | ||||||||||||||||||
Polymorphism databases | |||||||||||||||||||
| DMDM | 729564. | ||||||||||||||||||
Proteomic databases | |||||||||||||||||||
| PRIDE | Q99062. | ||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||
Genome annotation databases | |||||||||||||||||||
| Ensembl | ENST00000361632; ENSP00000355406; ENSG00000119535. ENST00000373106; ENSP00000362198; ENSG00000119535. ENST00000418048; ENSP00000401588; ENSG00000119535. | ||||||||||||||||||
| GeneID | 1441. | ||||||||||||||||||
| KEGG | hsa:1441. | ||||||||||||||||||
| UCSC | uc001cav.1. human. uc001caw.1. human. uc001cax.1. human. uc001cay.1. human. | ||||||||||||||||||
Organism-specific databases | |||||||||||||||||||
| CTD | 1441. | ||||||||||||||||||
| GeneCards | GC01M036931. | ||||||||||||||||||
| HGNC | HGNC:2439. CSF3R. | ||||||||||||||||||
| HPA | CAB017116. | ||||||||||||||||||
| MIM | 138971. gene. 162830. phenotype. | ||||||||||||||||||
| neXtProt | NX_Q99062. | ||||||||||||||||||
| Orphanet | 42738. Severe congenital neutropenia. | ||||||||||||||||||
| PharmGKB | PA26942. | ||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||
| GeneTree | ENSGT00550000074436. | ||||||||||||||||||
| HOVERGEN | HBG051130. | ||||||||||||||||||
| OMA | DDCVFGP. | ||||||||||||||||||
| OrthoDB | EOG495ZRM. | ||||||||||||||||||
Gene expression databases | |||||||||||||||||||
| ArrayExpress | Q99062. | ||||||||||||||||||
| Bgee | Q99062. | ||||||||||||||||||
| CleanEx | HS_CSF3R. | ||||||||||||||||||
| Genevestigator | Q99062. | ||||||||||||||||||
| GermOnline | ENSG00000119535. Homo sapiens. | ||||||||||||||||||
Family and domain databases | |||||||||||||||||||
| InterPro | IPR003961. Fibronectin_type3. IPR003529. Hematopoietin_rcpt_Gp130_CS. IPR013783. Ig-like_fold. IPR010457. IgC2-like_lig-bd. [Graphical view] | ||||||||||||||||||
| Gene3D | G3DSA:2.60.40.10. Ig-like_fold. 6 hits. | ||||||||||||||||||
| KO | K05061. | ||||||||||||||||||
| Pfam | PF00041. fn3. 1 hit. PF06328. Lep_receptor_Ig. 1 hit. [Graphical view] | ||||||||||||||||||
| SMART | SM00060. FN3. 5 hits. [Graphical view] | ||||||||||||||||||
| SUPFAM | SSF49265. FN_III-like. 5 hits. | ||||||||||||||||||
| PROSITE | PS50853. FN3. 5 hits. PS01353. HEMATOPO_REC_L_F2. 1 hit. [Graphical view] | ||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||
Other | |||||||||||||||||||
| DrugBank | DB00099. Filgrastim. DB00019. Pegfilgrastim. | ||||||||||||||||||
| NextBio | 5901. | ||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||
Entry information
| Entry name | CSF3R_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q99062 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human cell differentiation molecules CD nomenclature of surface proteins of human leucocytes and list of entries |
| Human chromosome 1 Human chromosome 1: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with