Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q96T55

- KCNKG_HUMAN

UniProt

Q96T55 - KCNKG_HUMAN

Protein

Potassium channel subfamily K member 16

Gene

KCNK16

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 107 (01 Oct 2014)
      Sequence version 1 (01 Dec 2001)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Outward rectifying potassium channel. Produces rapidly activating and non-inactivating outward rectifier K+ currents.

    GO - Molecular functioni

    1. potassium channel activity Source: MGI
    2. voltage-gated ion channel activity Source: UniProtKB-KW

    GO - Biological processi

    1. potassium ion transport Source: MGI
    2. synaptic transmission Source: Reactome

    Keywords - Molecular functioni

    Ion channel, Potassium channel, Voltage-gated channel

    Keywords - Biological processi

    Ion transport, Potassium transport, Transport

    Keywords - Ligandi

    Potassium

    Enzyme and pathway databases

    ReactomeiREACT_75850. TWIK-related alkaline pH activated K+ channel (TALK).

    Protein family/group databases

    TCDBi1.A.1.9.10. the voltage-gated ion channel (vic) superfamily.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Potassium channel subfamily K member 16
    Alternative name(s):
    2P domain potassium channel Talk-1
    TWIK-related alkaline pH-activated K(+) channel 1
    Short name:
    TALK-1
    Gene namesi
    Name:KCNK16
    Synonyms:TALK1
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 6

    Organism-specific databases

    HGNCiHGNC:14464. KCNK16.

    Subcellular locationi

    GO - Cellular componenti

    1. integral component of membrane Source: UniProtKB-KW
    2. plasma membrane Source: Reactome

    Keywords - Cellular componenti

    Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA30057.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 309309Potassium channel subfamily K member 16PRO_0000101767Add
    BLAST

    Proteomic databases

    PRIDEiQ96T55.

    Expressioni

    Tissue specificityi

    Highly expressed in pancreas. Not detectable in the other tissues tested.1 Publication

    Gene expression databases

    ArrayExpressiQ96T55.
    BgeeiQ96T55.
    CleanExiHS_KCNK16.
    GenevestigatoriQ96T55.

    Organism-specific databases

    HPAiHPA016567.

    Interactioni

    Subunit structurei

    Homodimer.Curated

    Protein-protein interaction databases

    STRINGi9606.ENSP00000391498.

    Structurei

    3D structure databases

    ProteinModelPortaliQ96T55.
    SMRiQ96T55. Positions 24-253.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini1 – 1313CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini141 – 16525CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini259 – 30951CytoplasmicSequence AnalysisAdd
    BLAST

    Intramembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Intramembranei98 – 11619Pore-forming; Name=Pore-forming 1Sequence AnalysisAdd
    BLAST
    Intramembranei202 – 22120Pore-forming; Name=Pore-forming 2Sequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei14 – 3421HelicalSequence AnalysisAdd
    BLAST
    Transmembranei120 – 14021HelicalSequence AnalysisAdd
    BLAST
    Transmembranei166 – 18621HelicalSequence AnalysisAdd
    BLAST
    Transmembranei238 – 25821HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Sequence similaritiesi

    Keywords - Domaini

    Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG245381.
    HOVERGENiHBG104884.
    InParanoidiQ96T55.
    KOiK04924.
    OMAiFATSKRE.
    OrthoDBiEOG77M8NK.
    PhylomeDBiQ96T55.
    TreeFamiTF313947.

    Family and domain databases

    InterProiIPR003280. 2pore_dom_K_chnl.
    IPR013099. 2pore_dom_K_chnl_dom.
    IPR003092. 2pore_dom_K_chnl_TASK.
    [Graphical view]
    PfamiPF07885. Ion_trans_2. 2 hits.
    [Graphical view]
    PRINTSiPR01333. 2POREKCHANEL.
    PR01095. TASKCHANNEL.

    Sequences (4)i

    Sequence statusi: Complete.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Isoform a (identifier: Q96T55-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MPSAGLCSCW GGRVLPLLLA YVCYLLLGAT IFQLLERQAE AQSRDQFQLE    50
    KLRFLENYTC LDQWAMEQFV QVIMEAWVKG VNPKGNSTNP SNWDFGSSFF 100
    FAGTVVTTIG YGNLAPSTEA GQVFCVFYAL LGIPLNVIFL NHLGTGLRAH 150
    LAAIERWEDR PRRSQVLQVL GLALFLTLGT LVILIFPPMV FSHVEGWSFS 200
    EGFYFAFITL STIGFGDYVV GTDPSKHYIS VYRSLAAIWI LLGLAWLALI 250
    LPLGPLLLHR CCQLWLLSLR QGCGAKAAPG RRPRRGSTAA RGVQVTPQDF 300
    PISKKGLGS 309
    Length:309
    Mass (Da):34,153
    Last modified:December 1, 2001 - v1
    Checksum:i99C4B11EB26B0764
    GO
    Isoform b (identifier: Q96T55-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         269-309: LRQGCGAKAAPGRRPRRGSTAARGVQVTPQDFPISKKGLGS → RGLGVKDGAASDPSGLPRPQKIPISA

    Show »
    Length:294
    Mass (Da):32,507
    Checksum:iFCBA3B352F1F0952
    GO
    Isoform c (identifier: Q96T55-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         222-309: TDPSKHYISV...FPISKKGLGS → HPLNFITPSG...PMWLGSSAQV

    Show »
    Length:322
    Mass (Da):35,802
    Checksum:i58B8EA53875CD2F5
    GO
    Isoform d (identifier: Q96T55-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         222-268: Missing.

    Show »
    Length:262
    Mass (Da):28,828
    Checksum:i56C1DF119F5931F3
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti49 – 491L → S in AAP82866. (PubMed:12724142)Curated
    Sequence conflicti149 – 1491A → V in AAP82867. (PubMed:12724142)Curated
    Sequence conflicti200 – 2001S → G in AAP82866. (PubMed:12724142)Curated
    Sequence conflicti205 – 2073FAF → LLS in AAP82867. (PubMed:12724142)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti215 – 2151F → L.
    Corresponds to variant rs9462527 [ dbSNP | Ensembl ].
    VAR_063636
    Natural varianti275 – 2751A → G.
    Corresponds to variant rs1535500 [ dbSNP | Ensembl ].
    VAR_063637
    Natural varianti301 – 3011P → H.2 Publications
    Corresponds to variant rs11756091 [ dbSNP | Ensembl ].
    VAR_052430

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei222 – 30988TDPSK…KGLGS → HPLNFITPSGLLPSQEPFQT PHGKPESQQIPGSFQKVSSM NVWPLSGMHSPGLAFPLPDC NIPDQERFRPLHPGAWKFWP LPLPSSNSKWAPMWLGSSAQ V in isoform c. 2 PublicationsVSP_039863Add
    BLAST
    Alternative sequencei222 – 26847Missing in isoform d. 1 PublicationVSP_039864Add
    BLAST
    Alternative sequencei269 – 30941LRQGC…KGLGS → RGLGVKDGAASDPSGLPRPQ KIPISA in isoform b. 2 PublicationsVSP_039865Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF358909 mRNA. Translation: AAK49532.1.
    AY253145 mRNA. Translation: AAP82866.1.
    AY253146 mRNA. Translation: AAP82867.1.
    AY253147 mRNA. Translation: AAP82868.1.
    EU978943 mRNA. Translation: ACH86102.1.
    AL136087 Genomic DNA. Translation: CAI19537.1.
    CH471081 Genomic DNA. Translation: EAX03982.1.
    CH471081 Genomic DNA. Translation: EAX03984.1.
    CH471081 Genomic DNA. Translation: EAX03985.1.
    BC111860 mRNA. Translation: AAI11861.1.
    CCDSiCCDS47420.1. [Q96T55-5]
    CCDS47421.1. [Q96T55-4]
    CCDS47422.1. [Q96T55-3]
    CCDS4843.1. [Q96T55-1]
    RefSeqiNP_001128577.1. NM_001135105.1. [Q96T55-4]
    NP_001128578.1. NM_001135106.1. [Q96T55-3]
    NP_001128579.1. NM_001135107.1. [Q96T55-5]
    NP_115491.1. NM_032115.3. [Q96T55-1]
    UniGeneiHs.287765.

    Genome annotation databases

    EnsembliENST00000373227; ENSP00000362324; ENSG00000095981. [Q96T55-5]
    ENST00000373229; ENSP00000362326; ENSG00000095981. [Q96T55-1]
    ENST00000425054; ENSP00000391498; ENSG00000095981. [Q96T55-4]
    ENST00000437525; ENSP00000415375; ENSG00000095981. [Q96T55-3]
    GeneIDi83795.
    KEGGihsa:83795.
    UCSCiuc003ooq.3. human. [Q96T55-1]
    uc003oor.4. human. [Q96T55-4]
    uc010jwy.3. human. [Q96T55-5]
    uc011dtz.1. human. [Q96T55-3]

    Polymorphism databases

    DMDMi24636281.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF358909 mRNA. Translation: AAK49532.1 .
    AY253145 mRNA. Translation: AAP82866.1 .
    AY253146 mRNA. Translation: AAP82867.1 .
    AY253147 mRNA. Translation: AAP82868.1 .
    EU978943 mRNA. Translation: ACH86102.1 .
    AL136087 Genomic DNA. Translation: CAI19537.1 .
    CH471081 Genomic DNA. Translation: EAX03982.1 .
    CH471081 Genomic DNA. Translation: EAX03984.1 .
    CH471081 Genomic DNA. Translation: EAX03985.1 .
    BC111860 mRNA. Translation: AAI11861.1 .
    CCDSi CCDS47420.1. [Q96T55-5 ]
    CCDS47421.1. [Q96T55-4 ]
    CCDS47422.1. [Q96T55-3 ]
    CCDS4843.1. [Q96T55-1 ]
    RefSeqi NP_001128577.1. NM_001135105.1. [Q96T55-4 ]
    NP_001128578.1. NM_001135106.1. [Q96T55-3 ]
    NP_001128579.1. NM_001135107.1. [Q96T55-5 ]
    NP_115491.1. NM_032115.3. [Q96T55-1 ]
    UniGenei Hs.287765.

    3D structure databases

    ProteinModelPortali Q96T55.
    SMRi Q96T55. Positions 24-253.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    STRINGi 9606.ENSP00000391498.

    Protein family/group databases

    TCDBi 1.A.1.9.10. the voltage-gated ion channel (vic) superfamily.

    Polymorphism databases

    DMDMi 24636281.

    Proteomic databases

    PRIDEi Q96T55.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000373227 ; ENSP00000362324 ; ENSG00000095981 . [Q96T55-5 ]
    ENST00000373229 ; ENSP00000362326 ; ENSG00000095981 . [Q96T55-1 ]
    ENST00000425054 ; ENSP00000391498 ; ENSG00000095981 . [Q96T55-4 ]
    ENST00000437525 ; ENSP00000415375 ; ENSG00000095981 . [Q96T55-3 ]
    GeneIDi 83795.
    KEGGi hsa:83795.
    UCSCi uc003ooq.3. human. [Q96T55-1 ]
    uc003oor.4. human. [Q96T55-4 ]
    uc010jwy.3. human. [Q96T55-5 ]
    uc011dtz.1. human. [Q96T55-3 ]

    Organism-specific databases

    CTDi 83795.
    GeneCardsi GC06M039282.
    HGNCi HGNC:14464. KCNK16.
    HPAi HPA016567.
    MIMi 607369. gene.
    neXtProti NX_Q96T55.
    PharmGKBi PA30057.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG245381.
    HOVERGENi HBG104884.
    InParanoidi Q96T55.
    KOi K04924.
    OMAi FATSKRE.
    OrthoDBi EOG77M8NK.
    PhylomeDBi Q96T55.
    TreeFami TF313947.

    Enzyme and pathway databases

    Reactomei REACT_75850. TWIK-related alkaline pH activated K+ channel (TALK).

    Miscellaneous databases

    GeneWikii KCNK16.
    GenomeRNAii 83795.
    NextBioi 72807.
    PROi Q96T55.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q96T55.
    Bgeei Q96T55.
    CleanExi HS_KCNK16.
    Genevestigatori Q96T55.

    Family and domain databases

    InterProi IPR003280. 2pore_dom_K_chnl.
    IPR013099. 2pore_dom_K_chnl_dom.
    IPR003092. 2pore_dom_K_chnl_TASK.
    [Graphical view ]
    Pfami PF07885. Ion_trans_2. 2 hits.
    [Graphical view ]
    PRINTSi PR01333. 2POREKCHANEL.
    PR01095. TASKCHANNEL.
    ProtoNeti Search...

    Publicationsi

    1. "Genomic and functional characteristics of novel human pancreatic 2P domain K(+) channels."
      Girard C., Duprat F., Terrenoire C., Tinel N., Fosset M., Romey G., Lazdunski M., Lesage F.
      Biochem. Biophys. Res. Commun. 282:249-256(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM A).
      Tissue: Pancreas.
    2. "Functional properties of four splice variants of a human pancreatic tandem-pore K+ channel, TALK-1."
      Han J., Kang D., Kim D.
      Am. J. Physiol. 285:C529-C538(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS B; C AND D), TISSUE SPECIFICITY, ALTERNATIVE SPLICING, VARIANT HIS-301.
    3. "Regulation of two-pore-domain (K2P) potassium leak channels by the tyrosine kinase inhibitor genistein."
      Gierten J., Ficker E., Bloehs R., Schlomer K., Kathofer S., Scholz E., Zitron E., Kiesecker C., Bauer A., Becker R., Katus H.A., Karle C.A., Thomas D.
      Br. J. Pharmacol. 154:1680-1690(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM B).
      Tissue: Pancreas.
    4. "The DNA sequence and analysis of human chromosome 6."
      Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D.
      , Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beare D.M., Beasley H., Beasley O., Bird C.P., Blakey S.E., Bray-Allen S., Brook J., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Clark S.Y., Clark G., Clee C.M., Clegg S., Cobley V., Collier R.E., Collins J.E., Colman L.K., Corby N.R., Coville G.J., Culley K.M., Dhami P., Davies J., Dunn M., Earthrowl M.E., Ellington A.E., Evans K.A., Faulkner L., Francis M.D., Frankish A., Frankland J., French L., Garner P., Garnett J., Ghori M.J., Gilby L.M., Gillson C.J., Glithero R.J., Grafham D.V., Grant M., Gribble S., Griffiths C., Griffiths M.N.D., Hall R., Halls K.S., Hammond S., Harley J.L., Hart E.A., Heath P.D., Heathcott R., Holmes S.J., Howden P.J., Howe K.L., Howell G.R., Huckle E., Humphray S.J., Humphries M.D., Hunt A.R., Johnson C.M., Joy A.A., Kay M., Keenan S.J., Kimberley A.M., King A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C.R., Lloyd D.M., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., Maslen G.L., Matthews L., McCann O.T., McLaren S.J., McLay K., McMurray A., Moore M.J.F., Mullikin J.C., Niblett D., Nickerson T., Novik K.L., Oliver K., Overton-Larty E.K., Parker A., Patel R., Pearce A.V., Peck A.I., Phillimore B.J.C.T., Phillips S., Plumb R.W., Porter K.M., Ramsey Y., Ranby S.A., Rice C.M., Ross M.T., Searle S.M., Sehra H.K., Sheridan E., Skuce C.D., Smith S., Smith M., Spraggon L., Squares S.L., Steward C.A., Sycamore N., Tamlyn-Hall G., Tester J., Theaker A.J., Thomas D.W., Thorpe A., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., White S.S., Whitehead S.L., Whittaker H., Wild A., Willey D.J., Wilmer T.E., Wood J.M., Wray P.W., Wyatt J.C., Young L., Younger R.M., Bentley D.R., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Dunham I., Rogers J., Beck S.
      Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT HIS-301.
    6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM C).

    Entry informationi

    Entry nameiKCNKG_HUMAN
    AccessioniPrimary (citable) accession number: Q96T55
    Secondary accession number(s): B5TJL9
    , Q2M2N9, Q5TCF3, Q6X6Z3, Q6X6Z4, Q6X6Z5, Q9H591
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: November 1, 2002
    Last sequence update: December 1, 2001
    Last modified: October 1, 2014
    This is version 107 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Miscellaneous

    Inhibited by Ba2+, quinine, quinidine, chloroform and halothane. Activated at alkaline pH.

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 6
      Human chromosome 6: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3