Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q96T55

- KCNKG_HUMAN

UniProt

Q96T55 - KCNKG_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Potassium channel subfamily K member 16

Gene

KCNK16

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at transcript leveli

Functioni

Outward rectifying potassium channel. Produces rapidly activating and non-inactivating outward rectifier K+ currents.

GO - Molecular functioni

  1. potassium channel activity Source: MGI
  2. voltage-gated ion channel activity Source: UniProtKB-KW

GO - Biological processi

  1. potassium ion transport Source: MGI
  2. synaptic transmission Source: Reactome
Complete GO annotation...

Keywords - Molecular functioni

Ion channel, Potassium channel, Voltage-gated channel

Keywords - Biological processi

Ion transport, Potassium transport, Transport

Keywords - Ligandi

Potassium

Enzyme and pathway databases

ReactomeiREACT_75850. TWIK-related alkaline pH activated K+ channel (TALK).

Protein family/group databases

TCDBi1.A.1.9.10. the voltage-gated ion channel (vic) superfamily.

Names & Taxonomyi

Protein namesi
Recommended name:
Potassium channel subfamily K member 16
Alternative name(s):
2P domain potassium channel Talk-1
TWIK-related alkaline pH-activated K(+) channel 1
Short name:
TALK-1
Gene namesi
Name:KCNK16
Synonyms:TALK1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 6

Organism-specific databases

HGNCiHGNC:14464. KCNK16.

Subcellular locationi

GO - Cellular componenti

  1. integral component of membrane Source: UniProtKB-KW
  2. plasma membrane Source: Reactome
Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA30057.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 309309Potassium channel subfamily K member 16PRO_0000101767Add
BLAST

Proteomic databases

PRIDEiQ96T55.

Expressioni

Tissue specificityi

Highly expressed in pancreas. Not detectable in the other tissues tested.1 Publication

Gene expression databases

BgeeiQ96T55.
CleanExiHS_KCNK16.
ExpressionAtlasiQ96T55. baseline.
GenevestigatoriQ96T55.

Organism-specific databases

HPAiHPA016567.

Interactioni

Subunit structurei

Homodimer.Curated

Protein-protein interaction databases

BioGridi123763. 23 interactions.
STRINGi9606.ENSP00000391498.

Structurei

3D structure databases

ProteinModelPortaliQ96T55.
SMRiQ96T55. Positions 24-253.
ModBaseiSearch...
MobiDBiSearch...

Topological domain

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 1313CytoplasmicSequence AnalysisAdd
BLAST
Topological domaini141 – 16525CytoplasmicSequence AnalysisAdd
BLAST
Topological domaini259 – 30951CytoplasmicSequence AnalysisAdd
BLAST

Intramembrane

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Intramembranei98 – 11619Pore-forming; Name=Pore-forming 1Sequence AnalysisAdd
BLAST
Intramembranei202 – 22120Pore-forming; Name=Pore-forming 2Sequence AnalysisAdd
BLAST

Transmembrane

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei14 – 3421HelicalSequence AnalysisAdd
BLAST
Transmembranei120 – 14021HelicalSequence AnalysisAdd
BLAST
Transmembranei166 – 18621HelicalSequence AnalysisAdd
BLAST
Transmembranei238 – 25821HelicalSequence AnalysisAdd
BLAST

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG245381.
GeneTreeiENSGT00760000118858.
HOVERGENiHBG104884.
InParanoidiQ96T55.
KOiK04924.
OMAiFATSKRE.
OrthoDBiEOG77M8NK.
PhylomeDBiQ96T55.
TreeFamiTF313947.

Family and domain databases

InterProiIPR003280. 2pore_dom_K_chnl.
IPR013099. 2pore_dom_K_chnl_dom.
IPR003092. 2pore_dom_K_chnl_TASK.
[Graphical view]
PfamiPF07885. Ion_trans_2. 2 hits.
[Graphical view]
PRINTSiPR01333. 2POREKCHANEL.
PR01095. TASKCHANNEL.

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform a (identifier: Q96T55-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPSAGLCSCW GGRVLPLLLA YVCYLLLGAT IFQLLERQAE AQSRDQFQLE
60 70 80 90 100
KLRFLENYTC LDQWAMEQFV QVIMEAWVKG VNPKGNSTNP SNWDFGSSFF
110 120 130 140 150
FAGTVVTTIG YGNLAPSTEA GQVFCVFYAL LGIPLNVIFL NHLGTGLRAH
160 170 180 190 200
LAAIERWEDR PRRSQVLQVL GLALFLTLGT LVILIFPPMV FSHVEGWSFS
210 220 230 240 250
EGFYFAFITL STIGFGDYVV GTDPSKHYIS VYRSLAAIWI LLGLAWLALI
260 270 280 290 300
LPLGPLLLHR CCQLWLLSLR QGCGAKAAPG RRPRRGSTAA RGVQVTPQDF

PISKKGLGS
Length:309
Mass (Da):34,153
Last modified:December 1, 2001 - v1
Checksum:i99C4B11EB26B0764
GO
Isoform b (identifier: Q96T55-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     269-309: LRQGCGAKAAPGRRPRRGSTAARGVQVTPQDFPISKKGLGS → RGLGVKDGAASDPSGLPRPQKIPISA

Show »
Length:294
Mass (Da):32,507
Checksum:iFCBA3B352F1F0952
GO
Isoform c (identifier: Q96T55-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     222-309: TDPSKHYISV...FPISKKGLGS → HPLNFITPSG...PMWLGSSAQV

Show »
Length:322
Mass (Da):35,802
Checksum:i58B8EA53875CD2F5
GO
Isoform d (identifier: Q96T55-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     222-268: Missing.

Show »
Length:262
Mass (Da):28,828
Checksum:i56C1DF119F5931F3
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti49 – 491L → S in AAP82866. (PubMed:12724142)Curated
Sequence conflicti149 – 1491A → V in AAP82867. (PubMed:12724142)Curated
Sequence conflicti200 – 2001S → G in AAP82866. (PubMed:12724142)Curated
Sequence conflicti205 – 2073FAF → LLS in AAP82867. (PubMed:12724142)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti215 – 2151F → L.
Corresponds to variant rs9462527 [ dbSNP | Ensembl ].
VAR_063636
Natural varianti275 – 2751A → G.
Corresponds to variant rs1535500 [ dbSNP | Ensembl ].
VAR_063637
Natural varianti301 – 3011P → H.2 Publications
Corresponds to variant rs11756091 [ dbSNP | Ensembl ].
VAR_052430

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei222 – 30988TDPSK…KGLGS → HPLNFITPSGLLPSQEPFQT PHGKPESQQIPGSFQKVSSM NVWPLSGMHSPGLAFPLPDC NIPDQERFRPLHPGAWKFWP LPLPSSNSKWAPMWLGSSAQ V in isoform c. 2 PublicationsVSP_039863Add
BLAST
Alternative sequencei222 – 26847Missing in isoform d. 1 PublicationVSP_039864Add
BLAST
Alternative sequencei269 – 30941LRQGC…KGLGS → RGLGVKDGAASDPSGLPRPQ KIPISA in isoform b. 2 PublicationsVSP_039865Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF358909 mRNA. Translation: AAK49532.1.
AY253145 mRNA. Translation: AAP82866.1.
AY253146 mRNA. Translation: AAP82867.1.
AY253147 mRNA. Translation: AAP82868.1.
EU978943 mRNA. Translation: ACH86102.1.
AL136087 Genomic DNA. Translation: CAI19537.1.
CH471081 Genomic DNA. Translation: EAX03982.1.
CH471081 Genomic DNA. Translation: EAX03984.1.
CH471081 Genomic DNA. Translation: EAX03985.1.
BC111860 mRNA. Translation: AAI11861.1.
CCDSiCCDS47420.1. [Q96T55-5]
CCDS47421.1. [Q96T55-4]
CCDS47422.1. [Q96T55-3]
CCDS4843.1. [Q96T55-1]
RefSeqiNP_001128577.1. NM_001135105.1. [Q96T55-4]
NP_001128578.1. NM_001135106.1. [Q96T55-3]
NP_001128579.1. NM_001135107.1. [Q96T55-5]
NP_115491.1. NM_032115.3. [Q96T55-1]
UniGeneiHs.287765.

Genome annotation databases

EnsembliENST00000373227; ENSP00000362324; ENSG00000095981. [Q96T55-5]
ENST00000373229; ENSP00000362326; ENSG00000095981. [Q96T55-1]
ENST00000425054; ENSP00000391498; ENSG00000095981. [Q96T55-4]
ENST00000437525; ENSP00000415375; ENSG00000095981. [Q96T55-3]
GeneIDi83795.
KEGGihsa:83795.
UCSCiuc003ooq.3. human. [Q96T55-1]
uc003oor.4. human. [Q96T55-4]
uc010jwy.3. human. [Q96T55-5]
uc011dtz.1. human. [Q96T55-3]

Polymorphism databases

DMDMi24636281.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF358909 mRNA. Translation: AAK49532.1 .
AY253145 mRNA. Translation: AAP82866.1 .
AY253146 mRNA. Translation: AAP82867.1 .
AY253147 mRNA. Translation: AAP82868.1 .
EU978943 mRNA. Translation: ACH86102.1 .
AL136087 Genomic DNA. Translation: CAI19537.1 .
CH471081 Genomic DNA. Translation: EAX03982.1 .
CH471081 Genomic DNA. Translation: EAX03984.1 .
CH471081 Genomic DNA. Translation: EAX03985.1 .
BC111860 mRNA. Translation: AAI11861.1 .
CCDSi CCDS47420.1. [Q96T55-5 ]
CCDS47421.1. [Q96T55-4 ]
CCDS47422.1. [Q96T55-3 ]
CCDS4843.1. [Q96T55-1 ]
RefSeqi NP_001128577.1. NM_001135105.1. [Q96T55-4 ]
NP_001128578.1. NM_001135106.1. [Q96T55-3 ]
NP_001128579.1. NM_001135107.1. [Q96T55-5 ]
NP_115491.1. NM_032115.3. [Q96T55-1 ]
UniGenei Hs.287765.

3D structure databases

ProteinModelPortali Q96T55.
SMRi Q96T55. Positions 24-253.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 123763. 23 interactions.
STRINGi 9606.ENSP00000391498.

Protein family/group databases

TCDBi 1.A.1.9.10. the voltage-gated ion channel (vic) superfamily.

Polymorphism databases

DMDMi 24636281.

Proteomic databases

PRIDEi Q96T55.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000373227 ; ENSP00000362324 ; ENSG00000095981 . [Q96T55-5 ]
ENST00000373229 ; ENSP00000362326 ; ENSG00000095981 . [Q96T55-1 ]
ENST00000425054 ; ENSP00000391498 ; ENSG00000095981 . [Q96T55-4 ]
ENST00000437525 ; ENSP00000415375 ; ENSG00000095981 . [Q96T55-3 ]
GeneIDi 83795.
KEGGi hsa:83795.
UCSCi uc003ooq.3. human. [Q96T55-1 ]
uc003oor.4. human. [Q96T55-4 ]
uc010jwy.3. human. [Q96T55-5 ]
uc011dtz.1. human. [Q96T55-3 ]

Organism-specific databases

CTDi 83795.
GeneCardsi GC06M039282.
HGNCi HGNC:14464. KCNK16.
HPAi HPA016567.
MIMi 607369. gene.
neXtProti NX_Q96T55.
PharmGKBi PA30057.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG245381.
GeneTreei ENSGT00760000118858.
HOVERGENi HBG104884.
InParanoidi Q96T55.
KOi K04924.
OMAi FATSKRE.
OrthoDBi EOG77M8NK.
PhylomeDBi Q96T55.
TreeFami TF313947.

Enzyme and pathway databases

Reactomei REACT_75850. TWIK-related alkaline pH activated K+ channel (TALK).

Miscellaneous databases

GeneWikii KCNK16.
GenomeRNAii 83795.
NextBioi 72807.
PROi Q96T55.
SOURCEi Search...

Gene expression databases

Bgeei Q96T55.
CleanExi HS_KCNK16.
ExpressionAtlasi Q96T55. baseline.
Genevestigatori Q96T55.

Family and domain databases

InterProi IPR003280. 2pore_dom_K_chnl.
IPR013099. 2pore_dom_K_chnl_dom.
IPR003092. 2pore_dom_K_chnl_TASK.
[Graphical view ]
Pfami PF07885. Ion_trans_2. 2 hits.
[Graphical view ]
PRINTSi PR01333. 2POREKCHANEL.
PR01095. TASKCHANNEL.
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Genomic and functional characteristics of novel human pancreatic 2P domain K(+) channels."
    Girard C., Duprat F., Terrenoire C., Tinel N., Fosset M., Romey G., Lazdunski M., Lesage F.
    Biochem. Biophys. Res. Commun. 282:249-256(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM A).
    Tissue: Pancreas.
  2. "Functional properties of four splice variants of a human pancreatic tandem-pore K+ channel, TALK-1."
    Han J., Kang D., Kim D.
    Am. J. Physiol. 285:C529-C538(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS B; C AND D), TISSUE SPECIFICITY, ALTERNATIVE SPLICING, VARIANT HIS-301.
  3. "Regulation of two-pore-domain (K2P) potassium leak channels by the tyrosine kinase inhibitor genistein."
    Gierten J., Ficker E., Bloehs R., Schlomer K., Kathofer S., Scholz E., Zitron E., Kiesecker C., Bauer A., Becker R., Katus H.A., Karle C.A., Thomas D.
    Br. J. Pharmacol. 154:1680-1690(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM B).
    Tissue: Pancreas.
  4. "The DNA sequence and analysis of human chromosome 6."
    Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D.
    , Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beare D.M., Beasley H., Beasley O., Bird C.P., Blakey S.E., Bray-Allen S., Brook J., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Clark S.Y., Clark G., Clee C.M., Clegg S., Cobley V., Collier R.E., Collins J.E., Colman L.K., Corby N.R., Coville G.J., Culley K.M., Dhami P., Davies J., Dunn M., Earthrowl M.E., Ellington A.E., Evans K.A., Faulkner L., Francis M.D., Frankish A., Frankland J., French L., Garner P., Garnett J., Ghori M.J., Gilby L.M., Gillson C.J., Glithero R.J., Grafham D.V., Grant M., Gribble S., Griffiths C., Griffiths M.N.D., Hall R., Halls K.S., Hammond S., Harley J.L., Hart E.A., Heath P.D., Heathcott R., Holmes S.J., Howden P.J., Howe K.L., Howell G.R., Huckle E., Humphray S.J., Humphries M.D., Hunt A.R., Johnson C.M., Joy A.A., Kay M., Keenan S.J., Kimberley A.M., King A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C.R., Lloyd D.M., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., Maslen G.L., Matthews L., McCann O.T., McLaren S.J., McLay K., McMurray A., Moore M.J.F., Mullikin J.C., Niblett D., Nickerson T., Novik K.L., Oliver K., Overton-Larty E.K., Parker A., Patel R., Pearce A.V., Peck A.I., Phillimore B.J.C.T., Phillips S., Plumb R.W., Porter K.M., Ramsey Y., Ranby S.A., Rice C.M., Ross M.T., Searle S.M., Sehra H.K., Sheridan E., Skuce C.D., Smith S., Smith M., Spraggon L., Squares S.L., Steward C.A., Sycamore N., Tamlyn-Hall G., Tester J., Theaker A.J., Thomas D.W., Thorpe A., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., White S.S., Whitehead S.L., Whittaker H., Wild A., Willey D.J., Wilmer T.E., Wood J.M., Wray P.W., Wyatt J.C., Young L., Younger R.M., Bentley D.R., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Dunham I., Rogers J., Beck S.
    Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT HIS-301.
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM C).

Entry informationi

Entry nameiKCNKG_HUMAN
AccessioniPrimary (citable) accession number: Q96T55
Secondary accession number(s): B5TJL9
, Q2M2N9, Q5TCF3, Q6X6Z3, Q6X6Z4, Q6X6Z5, Q9H591
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 2002
Last sequence update: December 1, 2001
Last modified: October 29, 2014
This is version 108 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Miscellaneous

Inhibited by Ba2+, quinine, quinidine, chloroform and halothane. Activated at alkaline pH.

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3