Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q96T55 (KCNKG_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 105. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Potassium channel subfamily K member 16
Alternative name(s):
2P domain potassium channel Talk-1
TWIK-related alkaline pH-activated K(+) channel 1
Short name=TALK-1
Gene names
Name:KCNK16
Synonyms:TALK1
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length309 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Function

Outward rectifying potassium channel. Produces rapidly activating and non-inactivating outward rectifier K+ currents.

Subunit structure

Homodimer Potential.

Subcellular location

Membrane; Multi-pass membrane protein.

Tissue specificity

Highly expressed in pancreas. Not detectable in the other tissues tested. Ref.2

Miscellaneous

Inhibited by Ba2+, quinine, quinidine, chloroform and halothane. Activated at alkaline pH.

Sequence similarities

Belongs to the two pore domain potassium channel (TC 1.A.1.8) family. [View classification]

Alternative products

This entry describes 4 isoforms produced by alternative splicing. [Align] [Select]
Isoform a (identifier: Q96T55-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform b (identifier: Q96T55-3)

The sequence of this isoform differs from the canonical sequence as follows:
     269-309: LRQGCGAKAAPGRRPRRGSTAARGVQVTPQDFPISKKGLGS → RGLGVKDGAASDPSGLPRPQKIPISA
Isoform c (identifier: Q96T55-4)

The sequence of this isoform differs from the canonical sequence as follows:
     222-309: TDPSKHYISV...FPISKKGLGS → HPLNFITPSG...PMWLGSSAQV
Isoform d (identifier: Q96T55-5)

The sequence of this isoform differs from the canonical sequence as follows:
     222-268: Missing.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 309309Potassium channel subfamily K member 16
PRO_0000101767

Regions

Topological domain1 – 1313Cytoplasmic Potential
Transmembrane14 – 3421Helical; Potential
Intramembrane98 – 11619Pore-forming; Name=Pore-forming 1; Potential
Transmembrane120 – 14021Helical; Potential
Topological domain141 – 16525Cytoplasmic Potential
Transmembrane166 – 18621Helical; Potential
Intramembrane202 – 22120Pore-forming; Name=Pore-forming 2; Potential
Transmembrane238 – 25821Helical; Potential
Topological domain259 – 30951Cytoplasmic Potential

Natural variations

Alternative sequence222 – 30988TDPSK…KGLGS → HPLNFITPSGLLPSQEPFQT PHGKPESQQIPGSFQKVSSM NVWPLSGMHSPGLAFPLPDC NIPDQERFRPLHPGAWKFWP LPLPSSNSKWAPMWLGSSAQ V in isoform c.
VSP_039863
Alternative sequence222 – 26847Missing in isoform d.
VSP_039864
Alternative sequence269 – 30941LRQGC…KGLGS → RGLGVKDGAASDPSGLPRPQ KIPISA in isoform b.
VSP_039865
Natural variant2151F → L.
Corresponds to variant rs9462527 [ dbSNP | Ensembl ].
VAR_063636
Natural variant2751A → G.
Corresponds to variant rs1535500 [ dbSNP | Ensembl ].
VAR_063637
Natural variant3011P → H. Ref.2 Ref.5
Corresponds to variant rs11756091 [ dbSNP | Ensembl ].
VAR_052430

Experimental info

Sequence conflict491L → S in AAP82866. Ref.2
Sequence conflict1491A → V in AAP82867. Ref.2
Sequence conflict2001S → G in AAP82866. Ref.2
Sequence conflict205 – 2073FAF → LLS in AAP82867. Ref.2

Sequences

Sequence LengthMass (Da)Tools
Isoform a [UniParc].

Last modified December 1, 2001. Version 1.
Checksum: 99C4B11EB26B0764

FASTA30934,153
        10         20         30         40         50         60 
MPSAGLCSCW GGRVLPLLLA YVCYLLLGAT IFQLLERQAE AQSRDQFQLE KLRFLENYTC 

        70         80         90        100        110        120 
LDQWAMEQFV QVIMEAWVKG VNPKGNSTNP SNWDFGSSFF FAGTVVTTIG YGNLAPSTEA 

       130        140        150        160        170        180 
GQVFCVFYAL LGIPLNVIFL NHLGTGLRAH LAAIERWEDR PRRSQVLQVL GLALFLTLGT 

       190        200        210        220        230        240 
LVILIFPPMV FSHVEGWSFS EGFYFAFITL STIGFGDYVV GTDPSKHYIS VYRSLAAIWI 

       250        260        270        280        290        300 
LLGLAWLALI LPLGPLLLHR CCQLWLLSLR QGCGAKAAPG RRPRRGSTAA RGVQVTPQDF 


PISKKGLGS 

« Hide

Isoform b [UniParc].

Checksum: FCBA3B352F1F0952
Show »

FASTA29432,507
Isoform c [UniParc].

Checksum: 58B8EA53875CD2F5
Show »

FASTA32235,802
Isoform d [UniParc].

Checksum: 56C1DF119F5931F3
Show »

FASTA26228,828

References

« Hide 'large scale' references
[1]"Genomic and functional characteristics of novel human pancreatic 2P domain K(+) channels."
Girard C., Duprat F., Terrenoire C., Tinel N., Fosset M., Romey G., Lazdunski M., Lesage F.
Biochem. Biophys. Res. Commun. 282:249-256(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM A).
Tissue: Pancreas.
[2]"Functional properties of four splice variants of a human pancreatic tandem-pore K+ channel, TALK-1."
Han J., Kang D., Kim D.
Am. J. Physiol. 285:C529-C538(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS B; C AND D), TISSUE SPECIFICITY, ALTERNATIVE SPLICING, VARIANT HIS-301.
[3]"Regulation of two-pore-domain (K2P) potassium leak channels by the tyrosine kinase inhibitor genistein."
Gierten J., Ficker E., Bloehs R., Schlomer K., Kathofer S., Scholz E., Zitron E., Kiesecker C., Bauer A., Becker R., Katus H.A., Karle C.A., Thomas D.
Br. J. Pharmacol. 154:1680-1690(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM B).
Tissue: Pancreas.
[4]"The DNA sequence and analysis of human chromosome 6."
Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D. expand/collapse author list , Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beare D.M., Beasley H., Beasley O., Bird C.P., Blakey S.E., Bray-Allen S., Brook J., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Clark S.Y., Clark G., Clee C.M., Clegg S., Cobley V., Collier R.E., Collins J.E., Colman L.K., Corby N.R., Coville G.J., Culley K.M., Dhami P., Davies J., Dunn M., Earthrowl M.E., Ellington A.E., Evans K.A., Faulkner L., Francis M.D., Frankish A., Frankland J., French L., Garner P., Garnett J., Ghori M.J., Gilby L.M., Gillson C.J., Glithero R.J., Grafham D.V., Grant M., Gribble S., Griffiths C., Griffiths M.N.D., Hall R., Halls K.S., Hammond S., Harley J.L., Hart E.A., Heath P.D., Heathcott R., Holmes S.J., Howden P.J., Howe K.L., Howell G.R., Huckle E., Humphray S.J., Humphries M.D., Hunt A.R., Johnson C.M., Joy A.A., Kay M., Keenan S.J., Kimberley A.M., King A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C.R., Lloyd D.M., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., Maslen G.L., Matthews L., McCann O.T., McLaren S.J., McLay K., McMurray A., Moore M.J.F., Mullikin J.C., Niblett D., Nickerson T., Novik K.L., Oliver K., Overton-Larty E.K., Parker A., Patel R., Pearce A.V., Peck A.I., Phillimore B.J.C.T., Phillips S., Plumb R.W., Porter K.M., Ramsey Y., Ranby S.A., Rice C.M., Ross M.T., Searle S.M., Sehra H.K., Sheridan E., Skuce C.D., Smith S., Smith M., Spraggon L., Squares S.L., Steward C.A., Sycamore N., Tamlyn-Hall G., Tester J., Theaker A.J., Thomas D.W., Thorpe A., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., White S.S., Whitehead S.L., Whittaker H., Wild A., Willey D.J., Wilmer T.E., Wood J.M., Wray P.W., Wyatt J.C., Young L., Younger R.M., Bentley D.R., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Dunham I., Rogers J., Beck S.
Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[5]Mural R.J., Istrail S., Sutton G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT HIS-301.
[6]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM C).

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF358909 mRNA. Translation: AAK49532.1.
AY253145 mRNA. Translation: AAP82866.1.
AY253146 mRNA. Translation: AAP82867.1.
AY253147 mRNA. Translation: AAP82868.1.
EU978943 mRNA. Translation: ACH86102.1.
AL136087 Genomic DNA. Translation: CAI19537.1.
CH471081 Genomic DNA. Translation: EAX03982.1.
CH471081 Genomic DNA. Translation: EAX03984.1.
CH471081 Genomic DNA. Translation: EAX03985.1.
BC111860 mRNA. Translation: AAI11861.1.
CCDSCCDS47420.1. [Q96T55-5]
CCDS47421.1. [Q96T55-4]
CCDS47422.1. [Q96T55-3]
CCDS4843.1. [Q96T55-1]
RefSeqNP_001128577.1. NM_001135105.1. [Q96T55-4]
NP_001128578.1. NM_001135106.1. [Q96T55-3]
NP_001128579.1. NM_001135107.1. [Q96T55-5]
NP_115491.1. NM_032115.3. [Q96T55-1]
UniGeneHs.287765.

3D structure databases

ProteinModelPortalQ96T55.
SMRQ96T55. Positions 24-253.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

STRING9606.ENSP00000391498.

Protein family/group databases

TCDB1.A.1.9.10. the voltage-gated ion channel (vic) superfamily.

Polymorphism databases

DMDM24636281.

Proteomic databases

PRIDEQ96T55.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000373227; ENSP00000362324; ENSG00000095981. [Q96T55-5]
ENST00000373229; ENSP00000362326; ENSG00000095981. [Q96T55-1]
ENST00000425054; ENSP00000391498; ENSG00000095981. [Q96T55-4]
ENST00000437525; ENSP00000415375; ENSG00000095981. [Q96T55-3]
GeneID83795.
KEGGhsa:83795.
UCSCuc003ooq.3. human. [Q96T55-1]
uc003oor.4. human. [Q96T55-4]
uc010jwy.3. human. [Q96T55-5]
uc011dtz.1. human. [Q96T55-3]

Organism-specific databases

CTD83795.
GeneCardsGC06M039282.
HGNCHGNC:14464. KCNK16.
HPAHPA016567.
MIM607369. gene.
neXtProtNX_Q96T55.
PharmGKBPA30057.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG245381.
HOVERGENHBG104884.
InParanoidQ96T55.
KOK04924.
OMAFATSKRE.
OrthoDBEOG77M8NK.
PhylomeDBQ96T55.
TreeFamTF313947.

Enzyme and pathway databases

ReactomeREACT_13685. Neuronal System.

Gene expression databases

ArrayExpressQ96T55.
BgeeQ96T55.
CleanExHS_KCNK16.
GenevestigatorQ96T55.

Family and domain databases

InterProIPR003280. 2pore_dom_K_chnl.
IPR013099. 2pore_dom_K_chnl_dom.
IPR003092. 2pore_dom_K_chnl_TASK.
[Graphical view]
PfamPF07885. Ion_trans_2. 2 hits.
[Graphical view]
PRINTSPR01333. 2POREKCHANEL.
PR01095. TASKCHANNEL.
ProtoNetSearch...

Other

GeneWikiKCNK16.
GenomeRNAi83795.
NextBio72807.
PROQ96T55.
SOURCESearch...

Entry information

Entry nameKCNKG_HUMAN
AccessionPrimary (citable) accession number: Q96T55
Secondary accession number(s): B5TJL9 expand/collapse secondary AC list , Q2M2N9, Q5TCF3, Q6X6Z3, Q6X6Z4, Q6X6Z5, Q9H591
Entry history
Integrated into UniProtKB/Swiss-Prot: November 1, 2002
Last sequence update: December 1, 2001
Last modified: July 9, 2014
This is version 105 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 6

Human chromosome 6: entries, gene names and cross-references to MIM