Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Potassium channel subfamily K member 16

Gene

KCNK16

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Outward rectifying potassium channel. Produces rapidly activating and non-inactivating outward rectifier K+ currents.

GO - Molecular functioni

GO - Biological processi

  • potassium ion transport Source: MGI
  • stabilization of membrane potential Source: GO_Central
Complete GO annotation...

Keywords - Molecular functioni

Ion channel, Potassium channel, Voltage-gated channel

Keywords - Biological processi

Ion transport, Potassium transport, Transport

Keywords - Ligandi

Potassium

Enzyme and pathway databases

BioCyciZFISH:ENSG00000095981-MONOMER.
ReactomeiR-HSA-1299361. TWIK-related alkaline pH activated K+ channel (TALK).
R-HSA-5576886. Phase 4 - resting membrane potential.

Protein family/group databases

TCDBi1.A.1.9.10. the voltage-gated ion channel (vic) superfamily.

Names & Taxonomyi

Protein namesi
Recommended name:
Potassium channel subfamily K member 16
Alternative name(s):
2P domain potassium channel Talk-1
TWIK-related alkaline pH-activated K(+) channel 1
Short name:
TALK-1
Gene namesi
Name:KCNK16
Synonyms:TALK1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 6

Organism-specific databases

HGNCiHGNC:14464. KCNK16.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 13CytoplasmicSequence analysisAdd BLAST13
Transmembranei14 – 34HelicalSequence analysisAdd BLAST21
Intramembranei98 – 116Pore-forming; Name=Pore-forming 1Sequence analysisAdd BLAST19
Transmembranei120 – 140HelicalSequence analysisAdd BLAST21
Topological domaini141 – 165CytoplasmicSequence analysisAdd BLAST25
Transmembranei166 – 186HelicalSequence analysisAdd BLAST21
Intramembranei202 – 221Pore-forming; Name=Pore-forming 2Sequence analysisAdd BLAST20
Transmembranei238 – 258HelicalSequence analysisAdd BLAST21
Topological domaini259 – 309CytoplasmicSequence analysisAdd BLAST51

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi83795.
OpenTargetsiENSG00000095981.
PharmGKBiPA30057.

Polymorphism and mutation databases

BioMutaiKCNK16.
DMDMi24636281.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001017671 – 309Potassium channel subfamily K member 16Add BLAST309

Proteomic databases

PaxDbiQ96T55.
PRIDEiQ96T55.

PTM databases

iPTMnetiQ96T55.
PhosphoSitePlusiQ96T55.

Expressioni

Tissue specificityi

Highly expressed in pancreas. Not detectable in the other tissues tested.1 Publication

Gene expression databases

BgeeiENSG00000095981.
CleanExiHS_KCNK16.
ExpressionAtlasiQ96T55. baseline and differential.
GenevisibleiQ96T55. HS.

Organism-specific databases

HPAiHPA016567.

Interactioni

Subunit structurei

Homodimer.Curated

Binary interactionsi

WithEntry#Exp.IntActNotes
OTX1P322423EBI-10294109,EBI-740446

Protein-protein interaction databases

BioGridi123763. 24 interactors.
IntActiQ96T55. 2 interactors.
STRINGi9606.ENSP00000391498.

Structurei

3D structure databases

ProteinModelPortaliQ96T55.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG1418. Eukaryota.
COG1226. LUCA.
GeneTreeiENSGT00760000118858.
HOVERGENiHBG104884.
InParanoidiQ96T55.
KOiK04924.
OMAiLQNYTCL.
OrthoDBiEOG091G0E3R.
PhylomeDBiQ96T55.
TreeFamiTF313947.

Family and domain databases

InterProiIPR003280. 2pore_dom_K_chnl.
IPR003092. 2pore_dom_K_chnl_TASK.
IPR013099. K_chnl_dom.
[Graphical view]
PfamiPF07885. Ion_trans_2. 2 hits.
[Graphical view]
PRINTSiPR01333. 2POREKCHANEL.
PR01095. TASKCHANNEL.

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform a (identifier: Q96T55-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPSAGLCSCW GGRVLPLLLA YVCYLLLGAT IFQLLERQAE AQSRDQFQLE
60 70 80 90 100
KLRFLENYTC LDQWAMEQFV QVIMEAWVKG VNPKGNSTNP SNWDFGSSFF
110 120 130 140 150
FAGTVVTTIG YGNLAPSTEA GQVFCVFYAL LGIPLNVIFL NHLGTGLRAH
160 170 180 190 200
LAAIERWEDR PRRSQVLQVL GLALFLTLGT LVILIFPPMV FSHVEGWSFS
210 220 230 240 250
EGFYFAFITL STIGFGDYVV GTDPSKHYIS VYRSLAAIWI LLGLAWLALI
260 270 280 290 300
LPLGPLLLHR CCQLWLLSLR QGCGAKAAPG RRPRRGSTAA RGVQVTPQDF

PISKKGLGS
Length:309
Mass (Da):34,153
Last modified:December 1, 2001 - v1
Checksum:i99C4B11EB26B0764
GO
Isoform b (identifier: Q96T55-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     269-309: LRQGCGAKAAPGRRPRRGSTAARGVQVTPQDFPISKKGLGS → RGLGVKDGAASDPSGLPRPQKIPISA

Show »
Length:294
Mass (Da):32,507
Checksum:iFCBA3B352F1F0952
GO
Isoform c (identifier: Q96T55-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     222-309: TDPSKHYISV...FPISKKGLGS → HPLNFITPSG...PMWLGSSAQV

Show »
Length:322
Mass (Da):35,802
Checksum:i58B8EA53875CD2F5
GO
Isoform d (identifier: Q96T55-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     222-268: Missing.

Show »
Length:262
Mass (Da):28,828
Checksum:i56C1DF119F5931F3
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti49L → S in AAP82866 (PubMed:12724142).Curated1
Sequence conflicti149A → V in AAP82867 (PubMed:12724142).Curated1
Sequence conflicti200S → G in AAP82866 (PubMed:12724142).Curated1
Sequence conflicti205 – 207FAF → LLS in AAP82867 (PubMed:12724142).Curated3

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_063636215F → L.Corresponds to variant rs9462527dbSNPEnsembl.1
Natural variantiVAR_063637275A → G.Corresponds to variant rs1535500dbSNPEnsembl.1
Natural variantiVAR_052430301P → H.2 PublicationsCorresponds to variant rs11756091dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_039863222 – 309TDPSK…KGLGS → HPLNFITPSGLLPSQEPFQT PHGKPESQQIPGSFQKVSSM NVWPLSGMHSPGLAFPLPDC NIPDQERFRPLHPGAWKFWP LPLPSSNSKWAPMWLGSSAQ V in isoform c. 2 PublicationsAdd BLAST88
Alternative sequenceiVSP_039864222 – 268Missing in isoform d. 1 PublicationAdd BLAST47
Alternative sequenceiVSP_039865269 – 309LRQGC…KGLGS → RGLGVKDGAASDPSGLPRPQ KIPISA in isoform b. 2 PublicationsAdd BLAST41

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF358909 mRNA. Translation: AAK49532.1.
AY253145 mRNA. Translation: AAP82866.1.
AY253146 mRNA. Translation: AAP82867.1.
AY253147 mRNA. Translation: AAP82868.1.
EU978943 mRNA. Translation: ACH86102.1.
AL136087 Genomic DNA. Translation: CAI19537.1.
CH471081 Genomic DNA. Translation: EAX03982.1.
CH471081 Genomic DNA. Translation: EAX03984.1.
CH471081 Genomic DNA. Translation: EAX03985.1.
BC111860 mRNA. Translation: AAI11861.1.
CCDSiCCDS47420.1. [Q96T55-5]
CCDS47421.1. [Q96T55-4]
CCDS47422.1. [Q96T55-3]
CCDS4843.1. [Q96T55-1]
RefSeqiNP_001128577.1. NM_001135105.1. [Q96T55-4]
NP_001128578.1. NM_001135106.1. [Q96T55-3]
NP_001128579.1. NM_001135107.1. [Q96T55-5]
NP_115491.1. NM_032115.3. [Q96T55-1]
XP_016866835.1. XM_017011346.1. [Q96T55-5]
UniGeneiHs.287765.

Genome annotation databases

EnsembliENST00000373227; ENSP00000362324; ENSG00000095981. [Q96T55-5]
ENST00000373229; ENSP00000362326; ENSG00000095981. [Q96T55-1]
ENST00000425054; ENSP00000391498; ENSG00000095981. [Q96T55-4]
ENST00000437525; ENSP00000415375; ENSG00000095981. [Q96T55-3]
GeneIDi83795.
KEGGihsa:83795.
UCSCiuc003ooq.3. human. [Q96T55-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF358909 mRNA. Translation: AAK49532.1.
AY253145 mRNA. Translation: AAP82866.1.
AY253146 mRNA. Translation: AAP82867.1.
AY253147 mRNA. Translation: AAP82868.1.
EU978943 mRNA. Translation: ACH86102.1.
AL136087 Genomic DNA. Translation: CAI19537.1.
CH471081 Genomic DNA. Translation: EAX03982.1.
CH471081 Genomic DNA. Translation: EAX03984.1.
CH471081 Genomic DNA. Translation: EAX03985.1.
BC111860 mRNA. Translation: AAI11861.1.
CCDSiCCDS47420.1. [Q96T55-5]
CCDS47421.1. [Q96T55-4]
CCDS47422.1. [Q96T55-3]
CCDS4843.1. [Q96T55-1]
RefSeqiNP_001128577.1. NM_001135105.1. [Q96T55-4]
NP_001128578.1. NM_001135106.1. [Q96T55-3]
NP_001128579.1. NM_001135107.1. [Q96T55-5]
NP_115491.1. NM_032115.3. [Q96T55-1]
XP_016866835.1. XM_017011346.1. [Q96T55-5]
UniGeneiHs.287765.

3D structure databases

ProteinModelPortaliQ96T55.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi123763. 24 interactors.
IntActiQ96T55. 2 interactors.
STRINGi9606.ENSP00000391498.

Protein family/group databases

TCDBi1.A.1.9.10. the voltage-gated ion channel (vic) superfamily.

PTM databases

iPTMnetiQ96T55.
PhosphoSitePlusiQ96T55.

Polymorphism and mutation databases

BioMutaiKCNK16.
DMDMi24636281.

Proteomic databases

PaxDbiQ96T55.
PRIDEiQ96T55.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000373227; ENSP00000362324; ENSG00000095981. [Q96T55-5]
ENST00000373229; ENSP00000362326; ENSG00000095981. [Q96T55-1]
ENST00000425054; ENSP00000391498; ENSG00000095981. [Q96T55-4]
ENST00000437525; ENSP00000415375; ENSG00000095981. [Q96T55-3]
GeneIDi83795.
KEGGihsa:83795.
UCSCiuc003ooq.3. human. [Q96T55-1]

Organism-specific databases

CTDi83795.
DisGeNETi83795.
GeneCardsiKCNK16.
HGNCiHGNC:14464. KCNK16.
HPAiHPA016567.
MIMi607369. gene.
neXtProtiNX_Q96T55.
OpenTargetsiENSG00000095981.
PharmGKBiPA30057.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1418. Eukaryota.
COG1226. LUCA.
GeneTreeiENSGT00760000118858.
HOVERGENiHBG104884.
InParanoidiQ96T55.
KOiK04924.
OMAiLQNYTCL.
OrthoDBiEOG091G0E3R.
PhylomeDBiQ96T55.
TreeFamiTF313947.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000095981-MONOMER.
ReactomeiR-HSA-1299361. TWIK-related alkaline pH activated K+ channel (TALK).
R-HSA-5576886. Phase 4 - resting membrane potential.

Miscellaneous databases

GeneWikiiKCNK16.
GenomeRNAii83795.
PROiQ96T55.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000095981.
CleanExiHS_KCNK16.
ExpressionAtlasiQ96T55. baseline and differential.
GenevisibleiQ96T55. HS.

Family and domain databases

InterProiIPR003280. 2pore_dom_K_chnl.
IPR003092. 2pore_dom_K_chnl_TASK.
IPR013099. K_chnl_dom.
[Graphical view]
PfamiPF07885. Ion_trans_2. 2 hits.
[Graphical view]
PRINTSiPR01333. 2POREKCHANEL.
PR01095. TASKCHANNEL.
ProtoNetiSearch...

Entry informationi

Entry nameiKCNKG_HUMAN
AccessioniPrimary (citable) accession number: Q96T55
Secondary accession number(s): B5TJL9
, Q2M2N9, Q5TCF3, Q6X6Z3, Q6X6Z4, Q6X6Z5, Q9H591
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 2002
Last sequence update: December 1, 2001
Last modified: November 30, 2016
This is version 123 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Miscellaneous

Inhibited by Ba2+, quinine, quinidine, chloroform and halothane. Activated at alkaline pH.

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.