Q96T55 (KCNKG_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 93.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Potassium channel subfamily K member 16 Alternative name(s): 2P domain potassium channel Talk-1 TWIK-related alkaline pH-activated K(+) channel 1 Short name=TALK-1 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 309 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | Outward rectifying potassium channel. Produces rapidly activating and non-inactivating outward rectifier K+ currents. |
| Subunit structure | Homodimer Potential. |
| Subcellular location | |
| Tissue specificity | Highly expressed in pancreas. Not detectable in the other tissues tested. Ref.2 |
| Miscellaneous | Inhibited by Ba2+, quinine, quinidine, chloroform and halothane. Activated at alkaline pH. |
| Sequence similarities | Belongs to the two pore domain potassium channel (TC 1.A.1.8) family. [View classification] |
Ontologies
| Keywords | |
|---|---|
| Biological process | Ion transport Potassium transport Transport |
| Cellular component | Membrane |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Transmembrane Transmembrane helix |
| Ligand | Potassium |
| Molecular function | Ion channel Potassium channel Voltage-gated channel |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | synaptic transmission Traceable author statement. Source: Reactome |
| Cellular_component | integral to membrane Inferred from electronic annotation. Source: UniProtKB-KW plasma membraneTraceable author statement. Source: Reactome |
| Molecular_function | potassium channel activity Inferred from direct assay Ref.1Ref.2. Source: MGI voltage-gated ion channel activityInferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform a (identifier: Q96T55-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform b (identifier: Q96T55-3) The sequence of this isoform differs from the canonical sequence as follows: 269-309: LRQGCGAKAAPGRRPRRGSTAARGVQVTPQDFPISKKGLGS → RGLGVKDGAASDPSGLPRPQKIPISA | ||||||
| Isoform c (identifier: Q96T55-4) The sequence of this isoform differs from the canonical sequence as follows: 222-309: TDPSKHYISV...FPISKKGLGS → HPLNFITPSG...PMWLGSSAQV | ||||||
| Isoform d (identifier: Q96T55-5) The sequence of this isoform differs from the canonical sequence as follows: 222-268: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 309 | 309 | Potassium channel subfamily K member 16 | PRO_0000101767 | |||||
Regions | |||||||||
| Topological domain | 1 – 13 | 13 | Cytoplasmic Potential | ||||||
| Transmembrane | 14 – 34 | 21 | Helical; Potential | ||||||
| Intramembrane | 98 – 116 | 19 | Pore-forming; Name=Pore-forming 1; Potential | ||||||
| Transmembrane | 120 – 140 | 21 | Helical; Potential | ||||||
| Topological domain | 141 – 165 | 25 | Cytoplasmic Potential | ||||||
| Transmembrane | 166 – 186 | 21 | Helical; Potential | ||||||
| Intramembrane | 202 – 221 | 20 | Pore-forming; Name=Pore-forming 2; Potential | ||||||
| Transmembrane | 238 – 258 | 21 | Helical; Potential | ||||||
| Topological domain | 259 – 309 | 51 | Cytoplasmic Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 222 – 309 | 88 | TDPSK…KGLGS → HPLNFITPSGLLPSQEPFQT PHGKPESQQIPGSFQKVSSM NVWPLSGMHSPGLAFPLPDC NIPDQERFRPLHPGAWKFWP LPLPSSNSKWAPMWLGSSAQ V in isoform c. | VSP_039863 | |||||
| Alternative sequence | 222 – 268 | 47 | Missing in isoform d. | VSP_039864 | |||||
| Alternative sequence | 269 – 309 | 41 | LRQGC…KGLGS → RGLGVKDGAASDPSGLPRPQ KIPISA in isoform b. | VSP_039865 | |||||
| Natural variant | 215 | 1 | F → L. Corresponds to variant rs9462527 [ dbSNP | Ensembl ]. | VAR_063636 | |||||
| Natural variant | 275 | 1 | A → G. Corresponds to variant rs1535500 [ dbSNP | Ensembl ]. | VAR_063637 | |||||
| Natural variant | 301 | 1 | P → H. Ref.2 Ref.5 Corresponds to variant rs11756091 [ dbSNP | Ensembl ]. | VAR_052430 | |||||
Experimental info | |||||||||
| Sequence conflict | 49 | 1 | L → S in AAP82866. Ref.2 | ||||||
| Sequence conflict | 149 | 1 | A → V in AAP82867. Ref.2 | ||||||
| Sequence conflict | 200 | 1 | S → G in AAP82866. Ref.2 | ||||||
| Sequence conflict | 205 – 207 | 3 | FAF → LLS in AAP82867. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Genomic and functional characteristics of novel human pancreatic 2P domain K(+) channels." Girard C., Duprat F., Terrenoire C., Tinel N., Fosset M., Romey G., Lazdunski M., Lesage F. Biochem. Biophys. Res. Commun. 282:249-256(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM A). Tissue: Pancreas. |
| [2] | "Functional properties of four splice variants of a human pancreatic tandem-pore K+ channel, TALK-1." Han J., Kang D., Kim D. Am. J. Physiol. 285:C529-C538(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS B; C AND D), TISSUE SPECIFICITY, ALTERNATIVE SPLICING, VARIANT HIS-301. |
| [3] | "Regulation of two-pore-domain (K2P) potassium leak channels by the tyrosine kinase inhibitor genistein." Gierten J., Ficker E., Bloehs R., Schlomer K., Kathofer S., Scholz E., Zitron E., Kiesecker C., Bauer A., Becker R., Katus H.A., Karle C.A., Thomas D. Br. J. Pharmacol. 154:1680-1690(2008) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM B). Tissue: Pancreas. |
| [4] | "The DNA sequence and analysis of human chromosome 6." Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D. Beck S.Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | Mural R.J., Istrail S., Sutton G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT HIS-301. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM C). |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF358909 mRNA. Translation: AAK49532.1. AY253145 mRNA. Translation: AAP82866.1. AY253146 mRNA. Translation: AAP82867.1. AY253147 mRNA. Translation: AAP82868.1. EU978943 mRNA. Translation: ACH86102.1. AL136087 Genomic DNA. Translation: CAI19537.1. CH471081 Genomic DNA. Translation: EAX03982.1. CH471081 Genomic DNA. Translation: EAX03984.1. CH471081 Genomic DNA. Translation: EAX03985.1. BC111860 mRNA. Translation: AAI11861.1. |
| IPI | IPI00045912. IPI00451446. IPI00451448. IPI00844272. |
| RefSeq | NP_001128577.1. NM_001135105.1. NP_001128578.1. NM_001135106.1. NP_001128579.1. NM_001135107.1. NP_115491.1. NM_032115.3. |
| UniGene | Hs.287765. |
3D structure databases | |
| ProteinModelPortal | Q96T55. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000391498. |
Polymorphism databases | |
| DMDM | 24636281. |
Proteomic databases | |
| PRIDE | Q96T55. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000373227; ENSP00000362324; ENSG00000095981. ENST00000373229; ENSP00000362326; ENSG00000095981. ENST00000425054; ENSP00000391498; ENSG00000095981. ENST00000437525; ENSP00000415375; ENSG00000095981. |
| GeneID | 83795. |
| KEGG | hsa:83795. |
| UCSC | uc003ooq.3. human. uc003oor.4. human. uc010jwy.3. human. |
Organism-specific databases | |
| CTD | 83795. |
| GeneCards | GC06M039282. |
| HGNC | HGNC:14464. KCNK16. |
| HPA | HPA016567. |
| MIM | 607369. gene. |
| neXtProt | NX_Q96T55. |
| PharmGKB | PA30057. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG245381. |
| HOVERGEN | HBG104884. |
| InParanoid | Q96T55. |
| KO | K04924. |
| OMA | QPRIHIP. |
| OrthoDB | EOG4N04G4. |
| PhylomeDB | Q96T55. |
Enzyme and pathway databases | |
| Reactome | REACT_13685. Neuronal System. |
Gene expression databases | |
| ArrayExpress | Q96T55. |
| Bgee | Q96T55. |
| CleanEx | HS_KCNK16. |
| Genevestigator | Q96T55. |
| GermOnline | ENSG00000095981. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR003280. 2pore_dom_K_chnl. IPR003092. 2pore_dom_K_chnl_TASK. IPR013099. Ion_trans_2. [Graphical view] |
| Pfam | PF07885. Ion_trans_2. 2 hits. [Graphical view] |
| PRINTS | PR01333. 2POREKCHANEL. PR01095. TASKCHANNEL. |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 83795. |
| NextBio | 72807. |
| SOURCE | Search... |
Entry information
| Entry name | KCNKG_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q96T55 Secondary accession number(s): B5TJL9 Q9H591 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 6 Human chromosome 6: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
