Q96SL1 (DIRC2_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 78.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Disrupted in renal carcinoma protein 2 Alternative name(s): Disrupted in renal cancer protein 2 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 478 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Electrogenic metabolite transporter. Ref.5 |
| Subcellular location | |
| Tissue specificity | Ubiquitous. Expressed in proximal tubular cells of the kidney. Ref.4 |
| Post-translational modification | Cleaved in lysosomes by cathepsin L between Leu-214 and Ala-261, generating a N-glycosylated N-terminal and a non-glycosylated C-terminal fragment. Ref.5 |
| Involvement in disease | A chromosomal aberration involving DIRC2 has been found in a family with renal carcinoma. Translocation t(2;3)(q35;q21). |
| Sequence similarities | Belongs to the major facilitator superfamily. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Transport |
| Cellular component | Lysosome Membrane |
| Coding sequence diversity | Alternative splicing Chromosomal rearrangement |
| Domain | Transmembrane Transmembrane helix |
| PTM | Glycoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | transport Inferred from electronic annotation. Source: UniProtKB-KW |
| Cellular_component | integral to membrane Inferred from electronic annotation. Source: UniProtKB-KW lysosomal membraneInferred from electronic annotation. Source: UniProtKB-SubCell |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q96SL1-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q96SL1-2) The sequence of this isoform differs from the canonical sequence as follows: 380-411: VTLYASCILLGVFLNSSVPIFFELFVETVYPV → EMGFRHVVQAGLELLSLSDSPTLASQNVGIAD 412-478: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 478 | 478 | Disrupted in renal carcinoma protein 2 | PRO_0000271338 | |||||
Regions | |||||||||
| Topological domain | 1 – 51 | 51 | Cytoplasmic Potential | ||||||
| Transmembrane | 52 – 72 | 21 | Helical; Potential | ||||||
| Topological domain | 73 – 89 | 17 | Lumenal Potential | ||||||
| Transmembrane | 90 – 110 | 21 | Helical; Potential | ||||||
| Topological domain | 111 – 117 | 7 | Cytoplasmic Potential | ||||||
| Transmembrane | 118 – 138 | 21 | Helical; Potential | ||||||
| Topological domain | 139 – 155 | 17 | Lumenal Potential | ||||||
| Transmembrane | 156 – 176 | 21 | Helical; Potential | ||||||
| Topological domain | 177 – 184 | 8 | Cytoplasmic Potential | ||||||
| Transmembrane | 185 – 205 | 21 | Helical; Potential | ||||||
| Topological domain | 206 – 229 | 24 | Lumenal Potential | ||||||
| Transmembrane | 230 – 250 | 21 | Helical; Potential | ||||||
| Topological domain | 251 – 281 | 31 | Cytoplasmic Potential | ||||||
| Transmembrane | 282 – 302 | 21 | Helical; Potential | ||||||
| Topological domain | 303 – 314 | 12 | Lumenal Potential | ||||||
| Transmembrane | 315 – 335 | 21 | Helical; Potential | ||||||
| Topological domain | 336 – 347 | 12 | Cytoplasmic Potential | ||||||
| Transmembrane | 348 – 368 | 21 | Helical; Potential | ||||||
| Topological domain | 369 – 384 | 16 | Lumenal Potential | ||||||
| Transmembrane | 385 – 405 | 21 | Helical; Potential | ||||||
| Topological domain | 406 – 414 | 9 | Cytoplasmic Potential | ||||||
| Transmembrane | 415 – 435 | 21 | Helical; Potential | ||||||
| Topological domain | 436 – 442 | 7 | Lumenal Potential | ||||||
| Transmembrane | 443 – 463 | 21 | Helical; Potential | ||||||
| Topological domain | 464 – 478 | 15 | Cytoplasmic Potential | ||||||
| Motif | 14 – 15 | 2 | Mediates lysosomal localization | ||||||
Amino acid modifications | |||||||||
| Glycosylation | 209 | 1 | N-linked (GlcNAc...) Ref.5 | ||||||
Natural variations | |||||||||
| Alternative sequence | 380 – 411 | 32 | VTLYA…TVYPV → EMGFRHVVQAGLELLSLSDS PTLASQNVGIAD in isoform 2. | VSP_022302 | |||||
| Alternative sequence | 412 – 478 | 67 | Missing in isoform 2. | VSP_022303 | |||||
Experimental info | |||||||||
| Mutagenesis | 14 – 15 | 2 | LL → AA: Abolishes lysosomal localization. Ref.5 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Tissue: Placenta. |
| [2] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Skin. |
| [4] | "Disruption of a novel MFS transporter gene, DIRC2, by a familial renal cell carcinoma-associated t(2;3)(q35;q21)." Bodmer D., Eleveld M., Kater-Baats E., Janssen I., Janssen B., Weterman M., Schoenmakers E., Nickerson M., Linehan M., Zbar B., van Kessel A.G. Hum. Mol. Genet. 11:641-649(2002) [PubMed] [Europe PMC] [Abstract] Cited for: CHROMOSOMAL TRANSLOCATION, TISSUE SPECIFICITY. |
| [5] | "Disrupted in renal carcinoma 2 (DIRC2), a novel transporter of the lysosomal membrane, is proteolytically processed by cathepsin L." Savalas L.R., Gasnier B., Damme M., Lubke T., Wrocklage C., Debacker C., Jezegou A., Reinheckel T., Hasilik A., Saftig P., Schroder B. Biochem. J. 439:113-128(2011) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, GLYCOSYLATION AT ASN-209, PROTEOLYTIC PROCESSING, MUTAGENESIS OF 14-LEU-LEU-15, SUBCELLULAR LOCATION. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AK027690 mRNA. Translation: BAB55300.1. AK075158 mRNA. Translation: BAC11440.1. AK291176 mRNA. Translation: BAF83865.1. CH471052 Genomic DNA. Translation: EAW79462.1. BC039821 mRNA. Translation: AAH39821.1. |
| IPI | IPI00045792. IPI00168349. |
| RefSeq | NP_116228.1. NM_032839.2. |
| UniGene | Hs.477346. |
3D structure databases | |
| ProteinModelPortal | Q96SL1. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000261038. |
PTM databases | |
| PhosphoSite | Q96SL1. |
Polymorphism databases | |
| DMDM | 74732717. |
Proteomic databases | |
| PaxDb | Q96SL1. |
| PRIDE | Q96SL1. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000261038; ENSP00000261038; ENSG00000138463. |
| GeneID | 84925. |
| KEGG | hsa:84925. |
| UCSC | uc003efw.4. human. |
Organism-specific databases | |
| CTD | 84925. |
| GeneCards | GC03P122513. |
| H-InvDB | HIX0030821. |
| HGNC | HGNC:16628. DIRC2. |
| MIM | 602773. gene. |
| neXtProt | NX_Q96SL1. |
| Orphanet | 151. Familial renal cell carcinoma. |
| PharmGKB | PA27341. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG298320. |
| HOGENOM | HOG000294083. |
| HOVERGEN | HBG060348. |
| InParanoid | Q96SL1. |
| KO | K15381. |
| OMA | VLYAEFG. |
| OrthoDB | EOG46T31W. |
| PhylomeDB | Q96SL1. |
Gene expression databases | |
| ArrayExpress | Q96SL1. |
| Bgee | Q96SL1. |
| CleanEx | HS_DIRC2. |
| Genevestigator | Q96SL1. |
Family and domain databases | |
| InterPro | IPR016196. MFS_dom_general_subst_transpt. [Graphical view] |
| SUPFAM | SSF103473. MFS_gen_substrate_transporter. 1 hit. |
| PROSITE | PS50850. MFS. False negative. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 84925. |
| NextBio | 75346. |
| SOURCE | Search... |
Entry information
| Entry name | DIRC2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q96SL1 Secondary accession number(s): A8K561, Q8NBX9 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 3 Human chromosome 3: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
