Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

LysM and putative peptidoglycan-binding domain-containing protein 1

Gene

LYSMD1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Names & Taxonomyi

Protein namesi
Recommended name:
LysM and putative peptidoglycan-binding domain-containing protein 1
Gene namesi
Name:LYSMD1
ORF Names:SB145
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

EuPathDBiHostDB:ENSG00000163155.11
HGNCiHGNC:32070 LYSMD1
neXtProtiNX_Q96S90

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000163155
PharmGKBiPA142671493

Polymorphism and mutation databases

BioMutaiLYSMD1
DMDMi74752122

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002479961 – 227LysM and putative peptidoglycan-binding domain-containing protein 1Add BLAST227

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei23PhosphoserineCombined sources1
Modified residuei33PhosphoserineCombined sources1
Modified residuei99PhosphoserineCombined sources1
Modified residuei166PhosphoserineCombined sources1
Modified residuei194PhosphoserineBy similarity1
Modified residuei212PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ96S90
MaxQBiQ96S90
PaxDbiQ96S90
PeptideAtlasiQ96S90
PRIDEiQ96S90

PTM databases

iPTMnetiQ96S90
PhosphoSitePlusiQ96S90

Expressioni

Gene expression databases

BgeeiENSG00000163155
CleanExiHS_LYSMD1
GenevisibleiQ96S90 HS

Organism-specific databases

HPAiHPA028055
HPA064537

Interactioni

Binary interactionsi

Show more details

Protein-protein interaction databases

BioGridi1328134 interactors.
IntActiQ96S90 11 interactors.
STRINGi9606.ENSP00000357904

Structurei

Secondary structure

1227
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi37 – 42Combined sources6
Helixi50 – 57Combined sources8
Helixi61 – 67Combined sources7
Helixi76 – 78Combined sources3
Beta strandi82 – 87Combined sources6

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2DJPNMR-A32-95[»]
ProteinModelPortaliQ96S90
SMRiQ96S90
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ96S90

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini40 – 84LysMPROSITE-ProRule annotationAdd BLAST45

Phylogenomic databases

eggNOGiENOG410J1FK Eukaryota
ENOG4111TII LUCA
GeneTreeiENSGT00520000055632
HOGENOMiHOG000290644
HOVERGENiHBG079723
InParanoidiQ96S90
OMAiHLSSPRM
OrthoDBiEOG091G14H3
PhylomeDBiQ96S90
TreeFamiTF318444

Family and domain databases

CDDicd00118 LysM, 1 hit
Gene3Di3.10.350.101 hit
InterProiView protein in InterPro
IPR018392 LysM_dom
IPR036779 LysM_dom_sf
PfamiView protein in Pfam
PF01476 LysM, 1 hit
SMARTiView protein in SMART
SM00257 LysM, 1 hit
PROSITEiView protein in PROSITE
PS51782 LYSM, 1 hit

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q96S90-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MASPSRQPPP GGSGLLQGSR ARSYGSLVQS ACSPVRERRL EHQLEPGDTL
60 70 80 90 100
AGLALKYGVT MEQIKRANRL YTNDSIFLKK TLYIPILTEP RDLFNGLDSE
110 120 130 140 150
EEKDGEEKVH PSNSEVWPHS TERKKQETGA GRANGEVLPT PGQETPTPIH
160 170 180 190 200
DLSASDFLKK LDSQISLSKK AAAQKLKKGE NGVPGEDAGL HLSSPWMQQR
210 220
AVLGPVPLTR TSRTRTLRDQ EDEIFKL
Length:227
Mass (Da):25,003
Last modified:December 1, 2001 - v1
Checksum:i3F119652D42F224F
GO
Isoform 2 (identifier: Q96S90-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-60: MASPSRQPPPGGSGLLQGSRARSYGSLVQSACSPVRERRLEHQLEPGDTLAGLALKYGVT → MRSGPLRISEWK

Show »
Length:179
Mass (Da):20,171
Checksum:i3490AA3ACB0F1AE9
GO

Sequence cautioni

The sequence CAH10716 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti128T → G in CAH10716 (PubMed:17974005).Curated1
Sequence conflicti164Q → R in BAG60863 (PubMed:14702039).Curated1
Sequence conflicti198Q → R in CAH10716 (PubMed:17974005).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0410831 – 60MASPS…KYGVT → MRSGPLRISEWK in isoform 2. 1 PublicationAdd BLAST60

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY037156 mRNA Translation: AAK67635.1
AK298706 mRNA Translation: BAG60863.1
AL122088 mRNA Translation: CAH10716.1 Different initiation.
BX647911 mRNA Translation: CAH10574.1
AL592424 Genomic DNA No translation available.
BC031649 mRNA Translation: AAH31649.1
CCDSiCCDS44218.1 [Q96S90-2]
CCDS986.1 [Q96S90-1]
RefSeqiNP_001130015.1, NM_001136543.1 [Q96S90-2]
NP_997716.1, NM_212551.4 [Q96S90-1]
UniGeneiHs.591482

Genome annotation databases

EnsembliENST00000368908; ENSP00000357904; ENSG00000163155 [Q96S90-1]
ENST00000440902; ENSP00000404059; ENSG00000163155 [Q96S90-2]
GeneIDi388695
KEGGihsa:388695
UCSCiuc001ewy.4 human [Q96S90-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiLYSM1_HUMAN
AccessioniPrimary (citable) accession number: Q96S90
Secondary accession number(s): B4DQA1, Q69YX9
Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 5, 2006
Last sequence update: December 1, 2001
Last modified: February 28, 2018
This is version 127 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome