Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

LysM and putative peptidoglycan-binding domain-containing protein 1

Gene

LYSMD1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 2 out of 5-Experimental evidence at protein leveli

Functioni

Enzyme and pathway databases

BioCyciZFISH:ENSG00000163155-MONOMER.

Names & Taxonomyi

Protein namesi
Recommended name:
LysM and putative peptidoglycan-binding domain-containing protein 1
Gene namesi
Name:LYSMD1
ORF Names:SB145
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

HGNCiHGNC:32070. LYSMD1.

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000163155.
PharmGKBiPA142671493.

Polymorphism and mutation databases

BioMutaiLYSMD1.
DMDMi74752122.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002479961 – 227LysM and putative peptidoglycan-binding domain-containing protein 1Add BLAST227

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei23PhosphoserineCombined sources1
Modified residuei33PhosphoserineCombined sources1
Modified residuei99PhosphoserineCombined sources1
Modified residuei166PhosphoserineCombined sources1
Modified residuei194PhosphoserineBy similarity1
Modified residuei212PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ96S90.
MaxQBiQ96S90.
PaxDbiQ96S90.
PeptideAtlasiQ96S90.
PRIDEiQ96S90.

PTM databases

iPTMnetiQ96S90.
PhosphoSitePlusiQ96S90.

Expressioni

Gene expression databases

BgeeiENSG00000163155.
CleanExiHS_LYSMD1.
GenevisibleiQ96S90. HS.

Organism-specific databases

HPAiHPA028055.
HPA064537.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
GOLGA2Q083793EBI-10293291,EBI-618309
MTUS2Q5JR593EBI-10293291,EBI-742948
TCF12Q990813EBI-10293291,EBI-722877

Protein-protein interaction databases

BioGridi132813. 4 interactors.
IntActiQ96S90. 8 interactors.
STRINGi9606.ENSP00000357904.

Structurei

Secondary structure

1227
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi37 – 42Combined sources6
Helixi50 – 57Combined sources8
Helixi61 – 67Combined sources7
Helixi76 – 78Combined sources3
Beta strandi82 – 87Combined sources6

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2DJPNMR-A32-95[»]
ProteinModelPortaliQ96S90.
SMRiQ96S90.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ96S90.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini40 – 84LysMPROSITE-ProRule annotationAdd BLAST45

Sequence similaritiesi

Contains 1 LysM domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiENOG410J1FK. Eukaryota.
ENOG4111TII. LUCA.
GeneTreeiENSGT00520000055632.
HOGENOMiHOG000290644.
HOVERGENiHBG079723.
InParanoidiQ96S90.
OMAiHLSSPRM.
OrthoDBiEOG091G14H3.
PhylomeDBiQ96S90.
TreeFamiTF318444.

Family and domain databases

CDDicd00118. LysM. 1 hit.
Gene3Di3.10.350.10. 1 hit.
InterProiIPR018392. LysM_dom.
[Graphical view]
PfamiPF01476. LysM. 1 hit.
[Graphical view]
SMARTiSM00257. LysM. 1 hit.
[Graphical view]
SUPFAMiSSF54106. SSF54106. 1 hit.
PROSITEiPS51782. LYSM. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q96S90-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MASPSRQPPP GGSGLLQGSR ARSYGSLVQS ACSPVRERRL EHQLEPGDTL
60 70 80 90 100
AGLALKYGVT MEQIKRANRL YTNDSIFLKK TLYIPILTEP RDLFNGLDSE
110 120 130 140 150
EEKDGEEKVH PSNSEVWPHS TERKKQETGA GRANGEVLPT PGQETPTPIH
160 170 180 190 200
DLSASDFLKK LDSQISLSKK AAAQKLKKGE NGVPGEDAGL HLSSPWMQQR
210 220
AVLGPVPLTR TSRTRTLRDQ EDEIFKL
Length:227
Mass (Da):25,003
Last modified:December 1, 2001 - v1
Checksum:i3F119652D42F224F
GO
Isoform 2 (identifier: Q96S90-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-60: MASPSRQPPPGGSGLLQGSRARSYGSLVQSACSPVRERRLEHQLEPGDTLAGLALKYGVT → MRSGPLRISEWK

Show »
Length:179
Mass (Da):20,171
Checksum:i3490AA3ACB0F1AE9
GO

Sequence cautioni

The sequence CAH10716 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti128T → G in CAH10716 (PubMed:17974005).Curated1
Sequence conflicti164Q → R in BAG60863 (PubMed:14702039).Curated1
Sequence conflicti198Q → R in CAH10716 (PubMed:17974005).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0410831 – 60MASPS…KYGVT → MRSGPLRISEWK in isoform 2. 1 PublicationAdd BLAST60

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY037156 mRNA. Translation: AAK67635.1.
AK298706 mRNA. Translation: BAG60863.1.
AL122088 mRNA. Translation: CAH10716.1. Different initiation.
BX647911 mRNA. Translation: CAH10574.1.
AL592424 Genomic DNA. Translation: CAI16380.1.
BC031649 mRNA. Translation: AAH31649.1.
CCDSiCCDS44218.1. [Q96S90-2]
CCDS986.1. [Q96S90-1]
RefSeqiNP_001130015.1. NM_001136543.1. [Q96S90-2]
NP_997716.1. NM_212551.4. [Q96S90-1]
UniGeneiHs.591482.

Genome annotation databases

EnsembliENST00000368908; ENSP00000357904; ENSG00000163155. [Q96S90-1]
ENST00000440902; ENSP00000404059; ENSG00000163155. [Q96S90-2]
GeneIDi388695.
KEGGihsa:388695.
UCSCiuc001ewy.4. human. [Q96S90-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY037156 mRNA. Translation: AAK67635.1.
AK298706 mRNA. Translation: BAG60863.1.
AL122088 mRNA. Translation: CAH10716.1. Different initiation.
BX647911 mRNA. Translation: CAH10574.1.
AL592424 Genomic DNA. Translation: CAI16380.1.
BC031649 mRNA. Translation: AAH31649.1.
CCDSiCCDS44218.1. [Q96S90-2]
CCDS986.1. [Q96S90-1]
RefSeqiNP_001130015.1. NM_001136543.1. [Q96S90-2]
NP_997716.1. NM_212551.4. [Q96S90-1]
UniGeneiHs.591482.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2DJPNMR-A32-95[»]
ProteinModelPortaliQ96S90.
SMRiQ96S90.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi132813. 4 interactors.
IntActiQ96S90. 8 interactors.
STRINGi9606.ENSP00000357904.

PTM databases

iPTMnetiQ96S90.
PhosphoSitePlusiQ96S90.

Polymorphism and mutation databases

BioMutaiLYSMD1.
DMDMi74752122.

Proteomic databases

EPDiQ96S90.
MaxQBiQ96S90.
PaxDbiQ96S90.
PeptideAtlasiQ96S90.
PRIDEiQ96S90.

Protocols and materials databases

DNASUi388695.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000368908; ENSP00000357904; ENSG00000163155. [Q96S90-1]
ENST00000440902; ENSP00000404059; ENSG00000163155. [Q96S90-2]
GeneIDi388695.
KEGGihsa:388695.
UCSCiuc001ewy.4. human. [Q96S90-1]

Organism-specific databases

CTDi388695.
GeneCardsiLYSMD1.
HGNCiHGNC:32070. LYSMD1.
HPAiHPA028055.
HPA064537.
neXtProtiNX_Q96S90.
OpenTargetsiENSG00000163155.
PharmGKBiPA142671493.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410J1FK. Eukaryota.
ENOG4111TII. LUCA.
GeneTreeiENSGT00520000055632.
HOGENOMiHOG000290644.
HOVERGENiHBG079723.
InParanoidiQ96S90.
OMAiHLSSPRM.
OrthoDBiEOG091G14H3.
PhylomeDBiQ96S90.
TreeFamiTF318444.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000163155-MONOMER.

Miscellaneous databases

EvolutionaryTraceiQ96S90.
GenomeRNAii388695.
PROiQ96S90.

Gene expression databases

BgeeiENSG00000163155.
CleanExiHS_LYSMD1.
GenevisibleiQ96S90. HS.

Family and domain databases

CDDicd00118. LysM. 1 hit.
Gene3Di3.10.350.10. 1 hit.
InterProiIPR018392. LysM_dom.
[Graphical view]
PfamiPF01476. LysM. 1 hit.
[Graphical view]
SMARTiSM00257. LysM. 1 hit.
[Graphical view]
SUPFAMiSSF54106. SSF54106. 1 hit.
PROSITEiPS51782. LYSM. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiLYSM1_HUMAN
AccessioniPrimary (citable) accession number: Q96S90
Secondary accession number(s): B4DQA1, Q69YX9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: September 5, 2006
Last sequence update: December 1, 2001
Last modified: November 30, 2016
This is version 119 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.