Q96RL7 (VP13A_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 105.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Vacuolar protein sorting-associated protein 13A Alternative name(s): Chorea-acanthocytosis protein Chorein | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 3174 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | May play a role in the control of protein cycling through the trans-Golgi network to early and late endosomes, lysosomes and plasma membrane. |
| Tissue specificity | Widely expressed. Higher expression is found in brain, heart, skeletal muscle and kidney. |
| Involvement in disease | Choreoacanthocytosis (CHAC) [MIM:200150]: An autosomal recessive neurodegenerative disorder characterized by the gradual onset of hyperkinetic movements and abnormal erythrocyte morphology. Basal ganglia atrophy in the brain is a pathological feature of the disease. Other clinical symptoms include psychiatric features, epilepsy, peripheral neuropathy, myopathy and oral self-mutilation. |
| Sequence similarities | Belongs to the VPS13 family. Contains 10 TPR repeats. |
| Sequence caution | The sequence AAH20576.1 differs from that shown. Reason: Intron retention. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Protein transport Transport |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Disease | Disease mutation Epilepsy Neurodegeneration |
| Domain | Repeat TPR repeat |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | Golgi to endosome transport Non-traceable author statement Ref.1. Source: UniProtKB cell deathInferred from electronic annotation. Source: UniProtKB-KW locomotory behaviorInferred from electronic annotation. Source: Compara nervous system developmentInferred from electronic annotation. Source: Compara protein localizationNon-traceable author statement Ref.2. Source: UniProtKB protein transportInferred from electronic annotation. Source: UniProtKB-KW social behaviorInferred from electronic annotation. Source: Compara |
| Cellular_component | intracellular Non-traceable author statement Ref.2. Source: UniProtKB |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| NCK1 | P16333 | 3 | EBI-1752583,EBI-389883 |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q96RL7-1) Also known as: A; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q96RL7-2) Also known as: B; The sequence of this isoform differs from the canonical sequence as follows: 3064-3174: VMENGRFAKY...QEAREPSPSL → KIQFYREWIMTHSSSSDDDDDDDDDDESDLNH | ||||||
| Isoform 3 (identifier: Q96RL7-3) Also known as: Chorein 2A; The sequence of this isoform differs from the canonical sequence as follows: 1040-1078: Missing. | ||||||
| Isoform 4 (identifier: Q96RL7-4) Also known as: Chorein 1D; The sequence of this isoform differs from the canonical sequence as follows: 3064-3069: VMENGR → ASKSLI 3070-3174: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 3174 | 3174 | Vacuolar protein sorting-associated protein 13A | PRO_0000106277 | |||||
Regions | |||||||||
| Repeat | 212 – 245 | 34 | TPR 1 | ||||||
| Repeat | 373 – 406 | 34 | TPR 2 | ||||||
| Repeat | 537 – 575 | 39 | TPR 3 | ||||||
| Repeat | 1256 – 1289 | 34 | TPR 4 | ||||||
| Repeat | 1291 – 1320 | 30 | TPR 5 | ||||||
| Repeat | 2009 – 2041 | 33 | TPR 6 | ||||||
| Repeat | 2568 – 2601 | 34 | TPR 7 | ||||||
| Repeat | 2717 – 2751 | 35 | TPR 8 | ||||||
| Repeat | 2860 – 2898 | 39 | TPR 9 | ||||||
| Repeat | 3086 – 3119 | 34 | TPR 10 | ||||||
Amino acid modifications | |||||||||
| Modified residue | 2240 | 1 | Phosphotyrosine By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 1040 – 1078 | 39 | Missing in isoform 3. | VSP_014904 | |||||
| Alternative sequence | 3064 – 3174 | 111 | VMENG…PSPSL → KIQFYREWIMTHSSSSDDDD DDDDDDESDLNH in isoform 2. | VSP_006550 | |||||
| Alternative sequence | 3064 – 3069 | 6 | VMENGR → ASKSLI in isoform 4. | VSP_014905 | |||||
| Alternative sequence | 3070 – 3174 | 105 | Missing in isoform 4. | VSP_014906 | |||||
| Natural variant | 90 | 1 | I → K in CHAC. Ref.1 Corresponds to variant rs28939379 [ dbSNP | Ensembl ]. | VAR_038420 | |||||
| Natural variant | 161 | 1 | R → H in a colorectal cancer sample; somatic mutation. Ref.10 | VAR_036324 | |||||
| Natural variant | 565 | 1 | F → L. Ref.9 | VAR_058114 | |||||
| Natural variant | 898 | 1 | V → A. Ref.9 | VAR_058115 | |||||
| Natural variant | 1095 | 1 | A → P in CHAC. Ref.9 | VAR_058116 | |||||
| Natural variant | 1452 | 1 | S → P in CHAC. Ref.1 | VAR_012803 | |||||
| Natural variant | 1490 | 1 | R → K. Ref.9 | VAR_058117 | |||||
| Natural variant | 1587 | 1 | Y → C. Ref.9 | VAR_058118 | |||||
| Natural variant | 1973 | 1 | V → I. Ref.9 Corresponds to variant rs41289969 [ dbSNP | Ensembl ]. | VAR_058119 | |||||
| Natural variant | 2460 | 1 | W → R in CHAC. Ref.9 | VAR_058120 | |||||
| Natural variant | 2486 | 1 | I → T. Ref.9 | VAR_058121 | |||||
| Natural variant | 2721 | 1 | Y → C in CHAC. Ref.1 | VAR_038421 | |||||
| Natural variant | 3172 | 1 | P → L. Ref.9 | VAR_058122 | |||||
Experimental info | |||||||||
| Sequence conflict | 1198 | 1 | K → R in AAK61861. Ref.1 | ||||||
| Sequence conflict | 1850 | 1 | L → R in AAH41852. Ref.6 | ||||||
| Sequence conflict | 1880 | 1 | I → F in AAH41852. Ref.6 | ||||||
| Sequence conflict | 2281 | 1 | G → E in BAB14337. Ref.7 | ||||||
| Sequence conflict | 2354 | 1 | K → R in AAH41852. Ref.6 | ||||||
| Sequence conflict | 2413 | 1 | T → R in BAB14337. Ref.7 | ||||||
| Sequence conflict | 2567 | 1 | K → E in BAB14337. Ref.7 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
Web resources
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF337532 mRNA. Translation: AAK61861.1. AB054005 mRNA. Translation: BAB59128.1. AJ608769 mRNA. Translation: CAE75581.1. AJ626859 mRNA. Translation: CAF25186.1. AL158159, AL353710, AL359204 Genomic DNA. Translation: CAI40935.1. AL158159, AL353710, AL359204 Genomic DNA. Translation: CAI40936.1. AL353710, AL158159, AL359204 Genomic DNA. Translation: CAH74105.1. AL353710, AL158159, AL359204 Genomic DNA. Translation: CAH74106.1. AL359204, AL158159, AL353710 Genomic DNA. Translation: CAI39537.1. AL359204, AL158159, AL353710 Genomic DNA. Translation: CAI39538.1. AB023203 mRNA. Translation: BAA76830.1. BC020576 mRNA. Translation: AAH20576.1. Sequence problems. BC041852 mRNA. Translation: AAH41852.1. AK022967 mRNA. Translation: BAB14337.1. |
| IPI | IPI00478586. IPI00604660. IPI00746613. IPI00873376. |
| RefSeq | NP_001018047.1. NM_001018037.1. NP_001018048.1. NM_001018038.2. NP_056001.1. NM_015186.3. NP_150648.2. NM_033305.2. |
| UniGene | Hs.459790. Hs.662256. |
3D structure databases | |
| ProteinModelPortal | Q96RL7. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q96RL7. 6 interactions. |
PTM databases | |
| PhosphoSite | Q96RL7. |
Polymorphism databases | |
| DMDM | 71152975. |
Proteomic databases | |
| PaxDb | Q96RL7. |
| PRIDE | Q96RL7. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000357409; ENSP00000349985; ENSG00000197969. ENST00000360280; ENSP00000353422; ENSG00000197969. ENST00000376634; ENSP00000365821; ENSG00000197969. ENST00000376636; ENSP00000365823; ENSG00000197969. |
| GeneID | 23230. |
| KEGG | hsa:23230. |
| UCSC | uc004akp.4. human. uc004akq.4. human. uc004akr.3. human. uc004aks.3. human. |
Organism-specific databases | |
| CTD | 23230. |
| GeneCards | GC09P079793. |
| HGNC | HGNC:1908. VPS13A. |
| HPA | HPA021652. HPA021662. |
| MIM | 200150. phenotype. 605978. gene. |
| neXtProt | NX_Q96RL7. |
| Orphanet | 2388. Choreoacanthocytosis. |
| PharmGKB | PA26444. |
| HUGE | Search... |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG5043. |
| HOVERGEN | HBG079736. |
| OMA | MPKFKIF. |
| OrthoDB | EOG45QHC8. |
Gene expression databases | |
| ArrayExpress | Q96RL7. |
| Bgee | Q96RL7. |
| Genevestigator | Q96RL7. |
| GermOnline | ENSG00000197969. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR015412. Autophagy-rel_C. IPR026847. VPS13. IPR026854. VPS13A_N. IPR009543. VPSAP_dom. [Graphical view] |
| PANTHER | PTHR16166. PTHR16166. 1 hit. |
| Pfam | PF09333. ATG_C. 1 hit. PF12624. Chorein_N. 1 hit. PF06650. DUF1162. 1 hit. [Graphical view] |
| PROSITE | PS50005. TPR. False negative. PS50293. TPR_REGION. False negative. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 23230. |
| NextBio | 44845. |
| SOURCE | Search... |
Entry information
| Entry name | VP13A_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q96RL7 Secondary accession number(s): Q5JSX9 Q9Y2J1 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 9 Human chromosome 9: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
