Q96RL1 (UIMC1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 82.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: BRCA1-A complex subunit RAP80 Alternative name(s): Receptor-associated protein 80 Retinoid X receptor-interacting protein 110 Ubiquitin interaction motif-containing protein 1 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 719 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Ubiquitin-binding protein that specifically recognizes and binds 'Lys-63'-linked ubiquitin. Plays a central role in the BRCA1-A complex by specifically binding 'Lys-63'-linked ubiquitinated histones H2A and H2AX at DNA lesions sites, leading to target the BRCA1-BARD1 heterodimer to sites of DNA damage at double-strand breaks (DSBs). The BRCA1-A complex also possesses deubiquitinase activity that specifically removes 'Lys-63'-linked ubiquitin on histones H2A and H2AX. Also weakly binds monoubiquitin but with much less affinity than 'Lys-63'-linked ubiquitin. May interact with monoubiquitinated histones H2A and H2B; the relevance of such results is however unclear in vivo. Does not bind Lys-48'-linked ubiquitin. May indirectly Act as a transcriptional repressor by inhibiting the interaction of NR6A1 with the corepressor NCOR1. Ref.1 Ref.11 Ref.12 Ref.17 Ref.18 Ref.19 Ref.24 Ref.26 Ref.27 |
| Subunit structure | Interacts with TSP57 By similarity. Component of the BRCA1-A complex, at least composed of the BRCA1, BARD1, UIMC1/RAP80, FAM175A/Abraxas, BRCC3/BRCC36, BRE/BRCC45 and BABAM1/NBA1. In the BRCA1-A complex, interacts directly with FAM175A/Abraxas. Interacts with ESR1, NR6A1 and UBE2I. Ref.1 Ref.10 Ref.12 Ref.13 Ref.14 Ref.15 Ref.23 Ref.24 |
| Subcellular location | Nucleus. Note: Localizes at sites of DNA damage at double-strand breaks (DSBs). Ref.1 Ref.11 Ref.12 Ref.17 Ref.18 Ref.19 |
| Tissue specificity | Expressed in testis, ovary, thymus and heart. Expressed in germ cells of the testis. Ref.1 |
| Domain | The UIM-linker region between the 2 UIM repeats determines the selectivity for 'Lys-63'-linked ubiquitin. The length of the linker is important. The linker reduces the flexibility between the UIM repeats and promotes high-affinity and linkage-selective interactions. Ref.25 The Abraxas-interacting region (AIR) mediates the interaction with FAM175A/Abraxas. Ref.25 |
| Post-translational modification | Sumoylated. Ref.10 Phosphorylated upon DNA damage by ATM or ATR. Ref.8 Ref.9 Ref.11 Ref.16 Ref.17 Ref.18 Ref.19 Ref.20 Ref.21 |
| Sequence similarities | Belongs to the RAP80 family. Contains 2 UIM (ubiquitin-interacting motif) repeats. |
| Sequence caution | The sequence AAH06078.1 differs from that shown. Reason: Erroneous termination at position 386. Translated as Glu. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| BRCA1 | P38398 | 9 | EBI-725300,EBI-349905 | |
| FAM175A | Q6UWZ7 | 9 | EBI-725300,EBI-1263451 |
Alternative products
| This entry describes 5 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q96RL1-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q96RL1-2) The sequence of this isoform differs from the canonical sequence as follows: 234-399: Missing. | ||||||
| Isoform 3 (identifier: Q96RL1-3) Also known as: XHRIP110; The sequence of this isoform differs from the canonical sequence as follows: 1-78: Missing. | ||||||
| Isoform 4 (identifier: Q96RL1-4) Also known as: X2HRIP110; The sequence of this isoform differs from the canonical sequence as follows: 1-370: Missing. 371-400: SKTKDFQESSIKSLKEKLLLEEEPTTSHGQ → MLPLPDLDLWPLDRLPSPIKRKPQTLGSLK | ||||||
| Isoform 5 (identifier: Q96RL1-5) The sequence of this isoform differs from the canonical sequence as follows: 120-152: SCRPSDASATRSRPLATGPSSQSHQEKTTDSGL → VNMPCCKSLWRLISYIFDFCGVVVALGTSCSHL 153-719: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 719 | 719 | BRCA1-A complex subunit RAP80 | PRO_0000097547 | |||||||
Regions | |||||||||||
| Repeat | 79 – 96 | 18 | UIM 1 | ||||||||
| Repeat | 104 – 124 | 21 | UIM 2 | ||||||||
| Region | 1 – 101 | 101 | Necessary for transcriptional repression | ||||||||
| Region | 97 – 103 | 7 | UIM-linker | ||||||||
| Region | 100 – 200 | 101 | Necessary for interaction with NR6A1 N-terminus | ||||||||
| Region | 270 – 400 | 131 | AIR | ||||||||
| Region | 400 – 500 | 101 | Necessary for interaction with NR6A1 C-terminus | ||||||||
| Region | 505 – 582 | 78 | Zinc-finger-like region | ||||||||
| Compositional bias | 81 – 108 | 28 | Glu-rich | ||||||||
Amino acid modifications | |||||||||||
| Modified residue | 44 | 1 | Phosphoserine Ref.9 Ref.21 | ||||||||
| Modified residue | 46 | 1 | Phosphoserine Ref.9 Ref.21 | ||||||||
| Modified residue | 101 | 1 | Phosphoserine Ref.18 Ref.19 | ||||||||
| Modified residue | 140 | 1 | Phosphoserine Ref.16 Ref.17 | ||||||||
| Modified residue | 205 | 1 | Phosphoserine Ref.11 Ref.20 | ||||||||
| Modified residue | 402 | 1 | Phosphoserine Ref.11 Ref.16 Ref.17 | ||||||||
| Modified residue | 415 | 1 | Phosphoserine Ref.16 | ||||||||
| Modified residue | 419 | 1 | Phosphoserine Ref.16 Ref.17 | ||||||||
| Modified residue | 597 | 1 | Phosphoserine Ref.8 | ||||||||
| Modified residue | 627 | 1 | Phosphoserine Ref.21 | ||||||||
| Modified residue | 653 | 1 | Phosphoserine Ref.8 Ref.21 | ||||||||
| Modified residue | 677 | 1 | Phosphoserine Ref.8 Ref.21 | ||||||||
Natural variations | |||||||||||
| Alternative sequence | 1 – 370 | 370 | Missing in isoform 4. | VSP_012933 | |||||||
| Alternative sequence | 1 – 78 | 78 | Missing in isoform 3. | VSP_012932 | |||||||
| Alternative sequence | 120 – 152 | 33 | SCRPS…TDSGL → VNMPCCKSLWRLISYIFDFC GVVVALGTSCSHL in isoform 5. | VSP_037264 | |||||||
| Alternative sequence | 153 – 719 | 567 | Missing in isoform 5. | VSP_037265 | |||||||
| Alternative sequence | 234 – 399 | 166 | Missing in isoform 2. | VSP_012935 | |||||||
| Alternative sequence | 371 – 400 | 30 | SKTKD…TSHGQ → MLPLPDLDLWPLDRLPSPIK RKPQTLGSLK in isoform 4. | VSP_012934 | |||||||
| Natural variant | 15 | 1 | R → W Common polymorphism not associated with susceptibility to breast cancer. Ref.28 Corresponds to variant rs13167812 [ dbSNP | Ensembl ]. | VAR_051469 | |||||||
| Natural variant | 353 | 1 | M → T Common polymorphism not associated with susceptibility to breast cancer. Ref.28 | VAR_055328 | |||||||
| Natural variant | 435 | 1 | P → L Common polymorphism not associated with susceptibility to breast cancer. Ref.28 Corresponds to variant rs3733876 [ dbSNP | Ensembl ]. | VAR_051470 | |||||||
| Natural variant | 511 | 1 | C → R Common polymorphism not associated with susceptibility to breast cancer. Ref.28 Corresponds to variant rs13360277 [ dbSNP | Ensembl ]. | VAR_051471 | |||||||
| Natural variant | 596 | 1 | G → E. Corresponds to variant rs10475633 [ dbSNP | Ensembl ]. | VAR_051472 | |||||||
Experimental info | |||||||||||
| Mutagenesis | 9 | 1 | K → A: Does not affect symoylation; when associated with A-19; A-31; A-52 and A-61. Ref.10 | ||||||||
| Mutagenesis | 19 | 1 | K → A: Does not affect symoylation; when associated with A-9; A-31; A-52 and A-61. Ref.10 | ||||||||
| Mutagenesis | 31 | 1 | K → A: Does not affect symoylation; when associated with A-9; A-19; A-52 and A-61. Ref.10 | ||||||||
| Mutagenesis | 52 | 1 | K → A: Does not affect symoylation; when associated with A-9; A-19; A-31 and A-61. Ref.10 | ||||||||
| Mutagenesis | 61 | 1 | K → A: Does not affect symoylation; when associated with A-9; A-19; A-31 and A-52. Ref.10 | ||||||||
| Mutagenesis | 88 | 1 | A → G or S: Impairs localization to DNA damages sites; when associated with A-92; S-113 and A-117. Ref.11 Ref.17 Ref.19 | ||||||||
| Mutagenesis | 92 | 1 | S → A: Impairs localization to DNA damages sites; when associated with S-88; S-113 and A-117. Ref.17 Ref.19 | ||||||||
| Mutagenesis | 97 – 103 | 7 | REVNSQE → AA: Impairs the selectivity for 'K-63'-linked ubiquitin. Ref.25 | ||||||||
| Mutagenesis | 97 – 103 | 7 | REVNSQE → AAAAAAA: Increases the selectivity for 'K-63'-linked ubiquitin. Ref.25 | ||||||||
| Mutagenesis | 97 – 103 | 7 | REVNSQE → AAAAAAAAA: Impairs the selectivity for 'K-63'-linked ubiquitin. Ref.25 | ||||||||
| Mutagenesis | 101 | 1 | S → A or E: Slightly impairs the selectivity for 'K-63'-linked ubiquitin. Ref.25 | ||||||||
| Mutagenesis | 113 | 1 | A → G or S: Impairs ubiquitin-binding and localization to DNA damages sites; when associated with S-88; A-92 and A-117. Ref.11 Ref.17 Ref.19 | ||||||||
| Mutagenesis | 117 | 1 | S → A: Impairs ubiquitin-binding and localization to DNA damages sites; when associated with S-88; A-92 and S-113. Ref.17 Ref.19 | ||||||||
| Mutagenesis | 205 | 1 | S → G: Abolishes phosphorylation at this position. Ref.20 | ||||||||
| Mutagenesis | 508 | 1 | C → A: Abolishes interaction with histone monoubiquitinated H2B without affecting the interaction with H2A. Ref.26 | ||||||||
| Sequence conflict | 187 | 1 | E → K in AAH06078. Ref.7 | ||||||||
| Sequence conflict | 192 | 1 | E → G in BAG51153. Ref.4 | ||||||||
| Sequence conflict | 247 | 1 | V → C in AAG59851. Ref.3 | ||||||||
| Sequence conflict | 347 | 1 | E → G in AAK61871. Ref.1 | ||||||||
| Sequence conflict | 518 | 1 | E → G in AAK61871. Ref.1 | ||||||||
| Sequence conflict | 634 | 1 | H → R in AAG59855. Ref.3 | ||||||||
| Sequence conflict | 638 | 1 | D → N in BAG51153. Ref.4 | ||||||||
| Sequence conflict | 694 | 1 | D → V in AAG59855. Ref.3 | ||||||||
Secondary structure | |||||||||||
Helix Strand Turn | |||||||||||
| Helix | 82 – 119 | 38 | |||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "RAP80: a novel nuclear protein that interacts with the retinoid-related testis-associated receptor." Yan Z., Kim Y.-S., Jetten A.M. J. Biol. Chem. 277:32379-32388(2002) [PubMed: 12080054] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION IN TRANSCRIPTIONAL REPRESSION, INTERACTION WITH NR6A1, SUBCELLULAR LOCATION, TISSUE SPECIFICITY. Tissue: Testis. |
| [2] | "A novel gene expressed in the human hypothalamus." Peng Y., Gu Y., Gu J., Huang Q., Fu S., Wu T., Dong H., Jin W., Fu G., Han Z., Chen Z., Wang Y. Submitted (DEC-1998) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4). Tissue: Hypothalamus. |
| [3] | Xu X., Yang Y., Gao G., Xiao H., Chen Z., Han Z. Submitted (JUL-2000) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 3 AND 4). Tissue: Hypothalamus. |
| [4] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 5). Tissue: Teratocarcinoma and Uterus. |
| [5] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed: 17974005] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Oesophageal carcinoma. |
| [6] | "The DNA sequence and comparative analysis of human chromosome 5." Schmutz J., Martin J., Terry A., Couronne O., Grimwood J., Lowry S., Gordon L.A., Scott D., Xie G., Huang W., Hellsten U., Tran-Gyamfi M., She X., Prabhakar S., Aerts A., Altherr M., Bajorek E., Black S. Rubin E.M.Nature 431:268-274(2004) [PubMed: 15372022] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Tissue: Ovary and Skin. |
| [8] | "Large-scale characterization of HeLa cell nuclear phosphoproteins." Beausoleil S.A., Jedrychowski M., Schwartz D., Elias J.E., Villen J., Li J., Cohn M.A., Cantley L.C., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 101:12130-12135(2004) [PubMed: 15302935] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-597; SER-653 AND SER-677, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [9] | "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M. Cell 127:635-648(2006) [PubMed: 17081983] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-44 AND SER-46, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [10] | "RAP80 interacts with the SUMO-conjugating enzyme UBC9 and is a novel target for sumoylation." Yan J., Yang X.-P., Kim Y.-S., Joo J.H., Jetten A.M. Biochem. Biophys. Res. Commun. 362:132-138(2007) [PubMed: 17698038] [Abstract] Cited for: SUMOYLATION, INTERACTION WITH UBE2I, MUTAGENESIS OF LYS-9; LYS-19; LYS-31; LYS-52 AND LYS-61. |
| [11] | "The ubiquitin-interacting motif containing protein RAP80 interacts with BRCA1 and functions in DNA damage repair response." Yan J., Kim Y.S., Yang X.-P., Li L.-P., Liao G., Xia F., Jetten A.M. Cancer Res. 67:6647-6656(2007) [PubMed: 17621610] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION, MUTAGENESIS OF ALA-88 AND ALA-113, PHOSPHORYLATION AT SER-205 AND SER-402. |
| [12] | "CCDC98 targets BRCA1 to DNA damage sites." Liu Z., Wu J., Yu X. Nat. Struct. Mol. Biol. 14:716-720(2007) [PubMed: 17643121] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION, INTERACTION WITH FAM175A. |
| [13] | "CCDC98 is a BRCA1-BRCT domain-binding protein involved in the DNA damage response." Kim H., Huang J., Chen J. Nat. Struct. Mol. Biol. 14:710-715(2007) [PubMed: 17643122] [Abstract] Cited for: INTERACTION WITH FAM175A. |
| [14] | "Ubiquitin-interaction motifs of RAP80 are critical in its regulation of estrogen receptor alpha." Yan J., Kim Y.S., Yang X.-P., Albers M., Koegl M., Jetten A.M. Nucleic Acids Res. 35:1673-1686(2007) [PubMed: 17311814] [Abstract] Cited for: INTERACTION WITH ESR1. |
| [15] | "Ubc13/Rnf8 ubiquitin ligases control foci formation of the Rap80/Abraxas/Brca1/Brcc36 complex in response to DNA damage." Wang B., Elledge S.J. Proc. Natl. Acad. Sci. U.S.A. 104:20759-20763(2007) [PubMed: 18077395] [Abstract] Cited for: INTERACTION WITH FAM175A. |
| [16] | "ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage." Matsuoka S., Ballif B.A., Smogorzewska A., McDonald E.R. III, Hurov K.E., Luo J., Bakalarski C.E., Zhao Z., Solimini N., Lerenthal Y., Shiloh Y., Gygi S.P., Elledge S.J. Science 316:1160-1166(2007) [PubMed: 17525332] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-140; SER-402; SER-415 AND SER-419, MASS SPECTROMETRY. Tissue: Embryonic kidney. |
| [17] | "Abraxas and RAP80 form a BRCA1 protein complex required for the DNA damage response." Wang B., Matsuoka S., Ballif B.A., Zhang D., Smogorzewska A., Giyi S., Elledge S.J. Science 316:1194-1198(2007) [PubMed: 17525340] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION, PHOSPHORYLATION AT SER-140; SER-402 AND SER-419, MUTAGENESIS OF ALA-88; SER-92; ALA-113 AND SER-117. |
| [18] | "RAP80 targets BRCA1 to specific ubiquitin structures at DNA damage sites." Sobhian B., Shao G., Lilli D.R., Culhane A.C., Moreau L.A., Xia B., Livingston D.M., Greenberg R.A. Science 316:1198-1202(2007) [PubMed: 17525341] [Abstract] Cited for: FUNCTION, IDENTIFICATION IN THE BRCA1-A COMPLEX, SUBCELLULAR LOCATION, UBIQUITIN-BINDING, PHOSPHORYLATION AT SER-101. |
| [19] | "Ubiquitin-binding protein RAP80 mediates BRCA1-dependent DNA damage response." Kim H., Chen J., Yu X. Science 316:1202-1205(2007) [PubMed: 17525342] [Abstract] Cited for: FUNCTION, IDENTIFICATION IN THE BRCA1-A COMPLEX, SUBCELLULAR LOCATION, UBIQUITIN-BINDING, PHOSPHORYLATION AT SER-101, MUTAGENESIS OF ALA-88; SER-92; ALA-113 AND SER-117. |
| [20] | "RAP80 responds to DNA damage induced by both ionizing radiation and UV irradiation and is phosphorylated at Ser 205." Yan J., Yang X.-P., Kim Y.-S., Jetten A.M. Cancer Res. 68:4269-4276(2008) [PubMed: 18519686] [Abstract] Cited for: PHOSPHORYLATION AT SER-205, MUTAGENESIS OF SER-205. |
| [21] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed: 18669648] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-44; SER-46; SER-627; SER-653 AND SER-677, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [22] | "MERIT40 controls BRCA1-Rap80 complex integrity and recruitment to DNA double-strand breaks." Shao G., Patterson-Fortin J., Messick T.E., Feng D., Shanbhag N., Wang Y., Greenberg R.A. Genes Dev. 23:740-754(2009) [PubMed: 19261746] [Abstract] Cited for: IDENTIFICATION IN THE BRCA1-A COMPLEX. |
| [23] | "NBA1, a new player in the Brca1 A complex, is required for DNA damage resistance and checkpoint control." Wang B., Hurov K., Hofmann K., Elledge S.J. Genes Dev. 23:729-739(2009) [PubMed: 19261749] [Abstract] Cited for: IDENTIFICATION IN THE BRCA1-A COMPLEX, UBIQUITIN-BINDING, INTERACTION WITH FAM175A. |
| [24] | "MERIT40 facilitates BRCA1 localization and DNA damage repair." Feng L., Huang J., Chen J. Genes Dev. 23:719-728(2009) [PubMed: 19261748] [Abstract] Cited for: FUNCTION, IDENTIFICATION BY MASS SPECTROMETRY, IDENTIFICATION IN THE BRCA1-A COMPLEX, INTERACTION WITH FAM175A. |
| [25] | "Linkage-specific avidity defines the lysine 63-linked polyubiquitin-binding preference of rap80." Sims J.J., Cohen R.E. Mol. Cell 33:775-783(2009) [PubMed: 19328070] [Abstract] Cited for: UBIQUITIN-BINDING, DOMAIN UIM-LINKER, MUTAGENESIS OF 97-ARG--GLU-103 AND SER-101. |
| [26] | "Histone ubiquitination associates with BRCA1-dependent DNA damage response." Wu J., Huen M.S.Y., Lu L.-Y., Ye L., Dou Y., Ljungman M., Chen J., Yu X. Mol. Cell. Biol. 29:849-860(2009) [PubMed: 19015238] [Abstract] Cited for: FUNCTION, MUTAGENESIS OF CYS-508. |
| [27] | "The Rap80-BRCC36 de-ubiquitinating enzyme complex antagonizes RNF8-Ubc13-dependent ubiquitination events at DNA double strand breaks." Shao G., Lilli D.R., Patterson-Fortin J., Coleman K.A., Morrissey D.E., Greenberg R.A. Proc. Natl. Acad. Sci. U.S.A. 106:3166-3171(2009) [PubMed: 19202061] [Abstract] Cited for: FUNCTION. |
| [28] | "Analysis of the genes coding for the BRCA1-interacting proteins, RAP80 and Abraxas (CCDC98), in high-risk, non-BRCA1/2, multiethnic breast cancer cases." Novak D.J., Sabbaghian N., Maillet P., Chappuis P.O., Foulkes W.D., Tischkowitz M. Breast Cancer Res. Treat. 117:453-459(2009) [PubMed: 18695986] [Abstract] Cited for: VARIANTS TRP-15; THR-353; LEU-435 AND ARG-511. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AF349313 mRNA. Translation: AAK61871.1. AF113538 mRNA. Translation: AAF14875.1. AF284749 mRNA. Translation: AAG59851.1. AF284753 mRNA. Translation: AAG59855.1. AK023044 mRNA. Translation: BAG51153.1. AK304794 mRNA. Translation: BAG65544.1. BX537376 mRNA. Translation: CAD97618.1. AC027318 Genomic DNA. No translation available. BC006078 mRNA. Translation: AAH06078.1. Different termination. BC032561 mRNA. Translation: AAH32561.1. | ||||||||||||
| IPI | IPI00328521. IPI00396071. IPI00552059. IPI00872390. IPI00910121. | ||||||||||||
| RefSeq | NP_001186226.1. NM_001199297.1. NP_001186227.1. NM_001199298.1. NP_057374.3. NM_016290.4. | ||||||||||||
| UniGene | Hs.232721. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | Q96RL1. | ||||||||||||
| SMR | Q96RL1. Positions 79-124. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| DIP | DIP-29936N. | ||||||||||||
| IntAct | Q96RL1. 42 interactions. | ||||||||||||
| MINT | MINT-1197441. | ||||||||||||
| STRING | Q96RL1. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | Q96RL1. | ||||||||||||
Polymorphism databases | |||||||||||||
| DMDM | 60390957. | ||||||||||||
Proteomic databases | |||||||||||||
| PRIDE | Q96RL1. | ||||||||||||
Protocols and materials databases | |||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000377227; ENSP00000366434; ENSG00000087206. | ||||||||||||
| GeneID | 51720. | ||||||||||||
| KEGG | hsa:51720. | ||||||||||||
| UCSC | uc003mfc.1. human. uc010jkh.1. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 51720. | ||||||||||||
| GeneCards | GC05M176265. | ||||||||||||
| H-InvDB | HIX0005450. | ||||||||||||
| HGNC | HGNC:30298. UIMC1. | ||||||||||||
| HPA | HPA037503. HPA037504. | ||||||||||||
| MIM | 609433. gene. | ||||||||||||
| neXtProt | NX_Q96RL1. | ||||||||||||
| PharmGKB | PA162408624. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | prNOG08946. | ||||||||||||
| HOVERGEN | HBG056783. | ||||||||||||
| OrthoDB | EOG4TXBRC. | ||||||||||||
| PhylomeDB | Q96RL1. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | Q96RL1. | ||||||||||||
| Bgee | Q96RL1. | ||||||||||||
| CleanEx | HS_UIMC1. | ||||||||||||
| Genevestigator | Q96RL1. | ||||||||||||
| GermOnline | ENSG00000087206. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| InterPro | IPR003903. Ubiquitin-int_motif. [Graphical view] | ||||||||||||
| SMART | SM00726. UIM. 2 hits. [Graphical view] | ||||||||||||
| PROSITE | PS50330. UIM. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| NextBio | 55772. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | UIMC1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q96RL1 Secondary accession number(s): A8MSA1 Q9UHX7 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 5 Human chromosome 5: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with